2JGVA

Structure of staphylococcus aureus d-tagatose-6-phosphate kinase in complex with adp
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
315
structure length
314
Chain Sequence
PRSHMILTLTLNPSVDISYPLTALKLDDVNRVQEVSKTAGGKGLNVTRVLAQVGEPVLASGFIGGELGQFIAKKLDHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPEIDNQEAAGFIKHFEQLLEKVEAVAISGSLPKGLNQDYYAQIIERCQNKGVPVILDCSGATLQTVLENPYKPTVIKPNISELYQLLNQPLDESLESLKQAVSQPLFEGIEWIIVSLGAQGAFAKHNHTFYRVNIPTISVLNPVGSGDSTVAGITSAILNHENDHDLLKKANTLGMLNAQEAQTGYVNLNNYDDLFNQIEVLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Staphylococcus Aureus D-Tagatose-6-Phosphate Kinase Implicate Domain Motions in Specificity and Mechanism.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
molecule keywords TAGATOSE-6-PHOSPHATE KINASE
total genus 94
structure length 314
sequence length 315
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.144: Tagatose-6-phosphate kinase.
pdb deposition date 2007-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 2jgvA00
2PKMA 4C5NA 3KEUA 3RU2A 3UBOA 3NM1A 3KZHA 1JXHA 3EWMA 3QA2A 3RSGA 2C4EA 3NC9A 4S1IB 3W4SA 4DU5A 1KYHA 4EN4A 1RFVA 2DCNA 3H49A 4K9CA 5TQIA 1BX4A 1YGKA 2AJRA 1RK2A 3OTXA 3RTGA 1L2LA 1TYYA 4JJPA 4E3AA 3PZSA 1WYEA 1LHRA 3NL2A 1JXIA 2FV7A 2NWHA 4S1MA 3RRJA 3RU3A 3RO4A 3Q92A 2DDMA 2RBCA 1VM7A 1V1BA 3GO7A 1RFTA 4E84A 2QCVA 4K8TA 5F11A 3RRFA 3IKHA 4YL5A 1RFUA 1UA4A 3KD6A 2DDOA 3FHXA 4XF6A 1TZ3A 2AX3A 2JGVA 4N08A 1C3QA 3BF5A 3HICA 2A9YA 5CGAA 2R3BA 3RQ6A 3LKIA 4GM6A 4E69A 4EOHA 3RSSA 3RSQA 4KAHA 5B6AA 3IQ0A 3VASA 1V1AA 4KALA 5COJA 5EY7A 2C49A 3JULA 3UQ6A 5C3YA 2AJPA 2XTBA 2HW1A 1TD2A 3B1OA 4KADA 1UB0A 3RT9A 3UMOA 3B1NA 4B8RA 3NL6A 1YGJA 4N09A 3UQEA 3RTBA 3RTDA 1GC5A 3KTNA 3N1CA 3RRBA 3K5WA 3UQ9A 3NL5A 2JG5A 1V1SA 3RPHA 3K9EA 4S1HA 3B3LA 3RQ2A 2V78A 4DC3A 3RS8A 4LBGA 2AFBA 1U2XA 2AB8A 2R3EA 3I3YA 3HPDA 5BYDA 5EYNA 4E8ZA 4C5KA 2HLZA 1VK4A 5C40A 3IE7A 3QAIA 3RQHA 3IBQA 2PKKA 3HYOA 3GO6A 3RT7A 3VAQA 4S1IA 4C5MA 1YHJA 1LIOA 2I6AA 3LHXA 1RKAA 3RPZA 4EBUA 1LIKA 1RKDA 2A9ZA 3LOOA 2I6BA 3MBHA 2JG1A 5C3ZA 4K8PA 4K93A 4KBEA 2AWDA 2AA0A 4O1GA 3RSFA 4EUMA 3NL3A 2ABSA 3RS9A 3NC2A 4O1LA 3B1PA 5CM5A 3UMPA 3RY7A 3MBJA 1TZ6A 4XCKA 4JKSA 5TRWA 4C5JA 3DRWA 1ESJA 2DDWA 3RQ5A 3BGKA 4B8SA 1V19A 4X8FA 2ABQA 3RM5A 4JKUA 4C5LA 4E8YA 5BYEA 1DGMA 4K8KA 2PKNA 3ZS7A 3NM3A 3RQQA 2YXUA 3NBWA 3RREA 3CQDA 3H74A 1LIIA 2I5BA 4PVVA 3LJSA 3NBVA 4UBEA 5BYFA 1LIJA 2Q5RA 2PKFA 2YXTA 3IH0A 1LHPA 3DZVA 4WJMA 4XF7A 1RKSA 3RQ8A 5BYCA 5F0ZA 1ESQA 1EKQA 5C41A 3NCAA 4KANA 3RTCA 4XDAA 2F02A 3Q1YA 3UQDA 4LC4A 3B1QA 2HQQA 5CGEA 2F7KA 4LCAA 2QHPA 2VARA 4K8CA 3B1RA 1EKKA 4K9IA 3IN1A 3RQXA 4U7XA 4LBXA 4YWRA 3RTEA 1VI9A 3PL2A 4E8WA 3GBUA 3FHYA 1GQTA 3RTAA
chains in the Genus database with same CATH superfamily
2PKMA 4C5NA 4DU5A 3KEUA 3QCZA 3RU2A 3UBOA 3HN7A 3NM1A 3KZHA 1JXHA 3EWMA 2GCAA 3QA2A 3RSGA 2C4EA 3NC9A 4S1IB 4C13A 3W4SA 3ZM5A 1KYHA 2UAGA 1GQQA 1RFVA 2DCNA 1UAGA 3H49A 4K9CA 1BX4A 5TQIA 1YGKA 2AJRA 1RK2A 3OTXA 3RTGA 2F00A 1L2LA 3ZM6A 1TYYA 4JJPA 4E3AA 3PZSA 1WYEA 1LHRA 2JFHA 1JXIA 2FV7A 2NWHA 3NL2A 4S1MA 3RRJA 3RO4A 5A5FA 3Q92A 2DDMA 4UAGA 2RBCA 1VM7A 1V1BA 3GO7A 1RFTA 4E84A 2QCVA 4K8TA 5F11A 1E0DA 3RRFA 3IKHA 4YL5A 1RFUA 1UA4A 3KD6A 2DDOA 3FHXA 4XF6A 1TZ3A 2AX3A 2JGVA 4BUBA 4N08A 4CVLA 1C3QA 3BF5A 3HICA 2A9YA 5A5EA 5CGAA 2R3BA 3RQ6A 3LKIA 4GM6A 3EAGA 4E69A 3RSSA 3RSQA 4EN4A 4EOHA 4KAHA 1J6UA 5B6AA 3IQ0A 3VASA 1V1AA 2AM1A 4KALA 2UUOA 5COJA 2C49A 3JULA 5EY7A 4C12A 5C3YA 3UQ6A 2VTDA 2AJPA 2XTBA 2HW1A 1TD2A 2Y66A 3B1OA 1UB0A 3HJ6A 4KADA 3B1NA 1O5ZA 3RT9A 3UMOA 3NL6A 2WTZA 1YGJA 4N09A 3UQEA 3RTBA 3RTDA 1GC5A 2Y67A 1JBWA 3KTNA 3N1CA 3RRBA 3K5WA 3UQ9A 3NL5A 2JG5A 1V1SA 3RPHA 3K9EA 1FGSA 3B3LA 4S1HA 2V78A 3RQ2A 4DC3A 1GG4A 3RS8A 4LBGA 2AFBA 2VOSA 1U2XA 2AB8A 4QF5A 2R3EA 3I3YA 3HPDA 3NRSA 2VTEA 1E8CA 5BYDA 5EYNA 4E8ZA 4C5KA 1VK4A 2GC6A 2HLZA 5C40A 3IE7A 3QAIA 3RQHA 3IBQA 4B8RA 2PKKA 1P31A 3HYOA 3GO6A 1JBVA 3RT7A 2XJAA 4BUCA 3UAGA 3VAQA 4S1IA 4C5MA 4HV4A 1YHJA 1LIOA 2I6AA 2WJPA 3PYZA 2Y68A 3LHXA 1RKAA 3RPZA 4EBUA 1LIKA 1GQYA 2X5OA 1RKDA 2UUPA 2A9ZA 3LOOA 2I6BA 3MBHA 1EEHA 2JG1A 5C3ZA 4ZIYA 2XPCA 4K8PA 4K93A 4KBEA 2AWDA 2AA0A 4O1GA 4CVKA 3RSFA 4EUMA 3NL3A 2ABSA 3RS9A 3NC2A 4O1LA 3B1PA 5CM5A 3UMPA 3RY7A 3MBJA 1TZ6A 3N2AA 4JKSA 4XCKA 5TRWA 4C5JA 3DRWA 1ESJA 2DDWA 3RQ5A 2VORA 3BGKA 4B8SA 1V19A 4X8FA 2ABQA 3RM5A 1W78A 4JKUA 4C5LA 4E8YA 5BYEA 1DGMA 4K8KA 2PKNA 2JFFA 3ZS7A 3NM3A 3RQQA 2YXUA 3NBWA 3RREA 3CQDA 3H74A 1LIIA 2I5BA 4PVVA 3LJSA 3NBVA 4UBEA 5BYFA 1LIJA 2Q5RA 2PKFA 2YXTA 3IH0A 1LHPA 3DZVA 4WJMA 4XF7A 1RKSA 3RQ8A 3RU3A 4CVMA 5BYCA 5F0ZA 1ESQA 1EKQA 5C41A 3NCAA 4KANA 3RTCA 4XDAA 1W7KA 2F02A 3Q1YA 3UQDA 4LC4A 3B1QA 3ZL8A 2AM2A 2HQQA 5CGEA 2F7KA 4LCAA 2QHPA 2VARA 4K8CA 3B1RA 2Y1OA 1EKKA 4K9IA 2GCBA 3IN1A 4QDIA 4U7XA 4LBXA 3RQXA 1P3DA 2JFGA 4YWRA 2GC5A 3RTEA 1VI9A 3PL2A 4E8WA 3GBUA 3FHYA 3LK7A 1GQTA 3RTAA
chains in the Genus database with same CATH topology
2PKMA 4C5NA 3KEUA 3RU2A 3UBOA 3NM1A 3KZHA 1JXHA 3EWMA 3QA2A 3RSGA 2C4EA 3NC9A 4S1IB 3W4SA 4DU5A 1KYHA 4EN4A 1RFVA 2DCNA 3H49A 4K9CA 5TQIA 1BX4A 1YGKA 2AJRA 1RK2A 3OTXA 3RTGA 1L2LA 1TYYA 4JJPA 4E3AA 3PZSA 1WYEA 1LHRA 3NL2A 1JXIA 2FV7A 2NWHA 4S1MA 3RRJA 3RU3A 3RO4A 3Q92A 2DDMA 2RBCA 1VM7A 1V1BA 3GO7A 1RFTA 4E84A 2QCVA 4K8TA 5F11A 3RRFA 3IKHA 4YL5A 1RFUA 1UA4A 3KD6A 2DDOA 3FHXA 4XF6A 1TZ3A 2AX3A 2JGVA 4N08A 1C3QA 3BF5A 3HICA 2A9YA 5CGAA 2R3BA 3RQ6A 3LKIA 4GM6A 4E69A 4EOHA 3RSSA 3RSQA 4KAHA 5B6AA 3IQ0A 3VASA 1V1AA 4KALA 5COJA 5EY7A 2C49A 3JULA 3UQ6A 5C3YA 2AJPA 2XTBA 2HW1A 1TD2A 3B1OA 4KADA 1UB0A 3HJ6A 3RT9A 3B1NA 3UMOA 4B8RA 3NL6A 1YGJA 4N09A 3UQEA 3RTBA 3RTDA 1GC5A 3KTNA 3N1CA 3RRBA 3K5WA 3UQ9A 3NL5A 2JG5A 1V1SA 3RPHA 3K9EA 4S1HA 3B3LA 3RQ2A 2V78A 4DC3A 3RS8A 4LBGA 2AFBA 1U2XA 2AB8A 2R3EA 3I3YA 3HPDA 5BYDA 5EYNA 4E8ZA 4C5KA 2HLZA 1VK4A 5C40A 3IE7A 3QAIA 3RQHA 3IBQA 2PKKA 3HYOA 3GO6A 3RT7A 3VAQA 4S1IA 4C5MA 1YHJA 1LIOA 2I6AA 3LHXA 1RKAA 3RPZA 4EBUA 1LIKA 1RKDA 2A9ZA 3LOOA 2I6BA 3MBHA 2JG1A 5C3ZA 4K8PA 4K93A 4KBEA 2AWDA 2AA0A 4O1GA 3RSFA 4EUMA 3NL3A 2ABSA 3RS9A 3NC2A 4O1LA 3B1PA 5CM5A 3UMPA 3RY7A 3MBJA 1TZ6A 4XCKA 4JKSA 5TRWA 4C5JA 3DRWA 1ESJA 2DDWA 3RQ5A 3BGKA 4B8SA 1V19A 4X8FA 2ABQA 3RM5A 4JKUA 4C5LA 4E8YA 5BYEA 1DGMA 4K8KA 2PKNA 3ZS7A 3NM3A 3RQQA 2YXUA 3NBWA 3RREA 3CQDA 3H74A 1LIIA 2I5BA 4PVVA 3LJSA 3NBVA 4UBEA 5BYFA 1LIJA 2Q5RA 2PKFA 2YXTA 3IH0A 1LHPA 3DZVA 4WJMA 4XF7A 1RKSA 3RQ8A 5BYCA 5F0ZA 1ESQA 1EKQA 5C41A 3NCAA 4KANA 3RTCA 4XDAA 2F02A 3Q1YA 3UQDA 4LC4A 3B1QA 2HQQA 5CGEA 2F7KA 4LCAA 2QHPA 2VARA 4K8CA 3B1RA 1EKKA 4K9IA 3IN1A 3RQXA 4U7XA 4LBXA 4YWRA 3RTEA 1VI9A 3PL2A 4E8WA 3GBUA 3FHYA 1GQTA 3RTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PKM A;  4C5N A;  3KEU A;  3RU2 A;  3UBO A;  3NM1 A;  3KZH A;  1JXH A;  3EWM A;  3QA2 A;  3RSG A;  2C4E A;  3NC9 A;  4S1I B;  3W4S A;  4DU5 A;  1KYH A;  4EN4 A;  1RFV A;  2DCN A;  3H49 A;  4K9C A;  5TQI A;  1BX4 A;  1YGK A;  2AJR A;  1RK2 A;  3OTX A;  3RTG A;  1L2L A;  1TYY A;  4JJP A;  4E3A A;  3PZS A;  1WYE A;  1LHR A;  3NL2 A;  1JXI A;  2FV7 A;  2NWH A;  4S1M A;  3RRJ A;  3RU3 A;  3RO4 A;  3Q92 A;  2DDM A;  2RBC A;  1VM7 A;  1V1B A;  3GO7 A;  1RFT A;  4E84 A;  2QCV A;  4K8T A;  5F11 A;  3RRF A;  3IKH A;  4YL5 A;  1RFU A;  1UA4 A;  3KD6 A;  2DDO A;  3FHX A;  4XF6 A;  1TZ3 A;  2AX3 A;  2JGV A;  4N08 A;  1C3Q A;  3BF5 A;  3HIC A;  2A9Y A;  5CGA A;  2R3B A;  3RQ6 A;  3LKI A;  4GM6 A;  4E69 A;  4EOH A;  3RSS A;  3RSQ A;  4KAH A;  5B6A A;  3IQ0 A;  3VAS A;  1V1A A;  4KAL A;  5COJ A;  5EY7 A;  2C49 A;  3JUL A;  3UQ6 A;  5C3Y A;  2AJP A;  2XTB A;  2HW1 A;  1TD2 A;  3B1O A;  4KAD A;  1UB0 A;  3RT9 A;  3UMO A;  3B1N A;  4B8R A;  3NL6 A;  1YGJ A;  4N09 A;  3UQE A;  3RTB A;  3RTD A;  1GC5 A;  3KTN A;  3N1C A;  3RRB A;  3K5W A;  3UQ9 A;  3NL5 A;  2JG5 A;  1V1S A;  3RPH A;  3K9E A;  4S1H A;  3B3L A;  3RQ2 A;  2V78 A;  4DC3 A;  3RS8 A;  4LBG A;  2AFB A;  1U2X A;  2AB8 A;  2R3E A;  3I3Y A;  3HPD A;  5BYD A;  5EYN A;  4E8Z A;  4C5K A;  2HLZ A;  1VK4 A;  5C40 A;  3IE7 A;  3QAI A;  3RQH A;  3IBQ A;  2PKK A;  3HYO A;  3GO6 A;  3RT7 A;  3VAQ A;  4S1I A;  4C5M A;  1YHJ A;  1LIO A;  2I6A A;  3LHX A;  1RKA A;  3RPZ A;  4EBU A;  1LIK A;  1RKD A;  2A9Z A;  3LOO A;  2I6B A;  3MBH A;  2JG1 A;  5C3Z A;  4K8P A;  4K93 A;  4KBE A;  2AWD A;  2AA0 A;  4O1G A;  3RSF A;  4EUM A;  3NL3 A;  2ABS A;  3RS9 A;  3NC2 A;  4O1L A;  3B1P A;  5CM5 A;  3UMP A;  3RY7 A;  3MBJ A;  1TZ6 A;  4XCK A;  4JKS A;  5TRW A;  4C5J A;  3DRW A;  1ESJ A;  2DDW A;  3RQ5 A;  3BGK A;  4B8S A;  1V19 A;  4X8F A;  2ABQ A;  3RM5 A;  4JKU A;  4C5L A;  4E8Y A;  5BYE A;  1DGM A;  4K8K A;  2PKN A;  3ZS7 A;  3NM3 A;  3RQQ A;  2YXU A;  3NBW A;  3RRE A;  3CQD A;  3H74 A;  1LII A;  2I5B A;  4PVV A;  3LJS A;  3NBV A;  4UBE A;  5BYF A;  1LIJ A;  2Q5R A;  2PKF A;  2YXT A;  3IH0 A;  1LHP A;  3DZV A;  4WJM A;  4XF7 A;  1RKS A;  3RQ8 A;  5BYC A;  5F0Z A;  1ESQ A;  1EKQ A;  5C41 A;  3NCA A;  4KAN A;  3RTC A;  4XDA A;  2F02 A;  3Q1Y A;  3UQD A;  4LC4 A;  3B1Q A;  2HQQ A;  5CGE A;  2F7K A;  4LCA A;  2QHP A;  2VAR A;  4K8C A;  3B1R A;  1EKK A;  4K9I A;  3IN1 A;  3RQX A;  4U7X A;  4LBX A;  4YWR A;  3RTE A;  1VI9 A;  3PL2 A;  4E8W A;  3GBU A;  3FHY A;  1GQT A;  3RTA A; 
#chains in the Genus database with same CATH topology
 2PKM A;  4C5N A;  4DU5 A;  3KEU A;  3QCZ A;  3RU2 A;  3UBO A;  3HN7 A;  3NM1 A;  3KZH A;  1JXH A;  3EWM A;  2GCA A;  3QA2 A;  3RSG A;  2C4E A;  3NC9 A;  4S1I B;  4C13 A;  3W4S A;  3ZM5 A;  1KYH A;  2UAG A;  1GQQ A;  1RFV A;  2DCN A;  1UAG A;  3H49 A;  4K9C A;  1BX4 A;  5TQI A;  1YGK A;  2AJR A;  1RK2 A;  3OTX A;  3RTG A;  2F00 A;  1L2L A;  3ZM6 A;  1TYY A;  4JJP A;  4E3A A;  3PZS A;  1WYE A;  1LHR A;  2JFH A;  1JXI A;  2FV7 A;  2NWH A;  3NL2 A;  4S1M A;  3RRJ A;  3RO4 A;  5A5F A;  3Q92 A;  2DDM A;  4UAG A;  2RBC A;  1VM7 A;  1V1B A;  3GO7 A;  1RFT A;  4E84 A;  2QCV A;  4K8T A;  5F11 A;  1E0D A;  3RRF A;  3IKH A;  4YL5 A;  1RFU A;  1UA4 A;  3KD6 A;  2DDO A;  3FHX A;  4XF6 A;  1TZ3 A;  2AX3 A;  2JGV A;  4BUB A;  4N08 A;  4CVL A;  1C3Q A;  3BF5 A;  3HIC A;  2A9Y A;  5A5E A;  5CGA A;  2R3B A;  3RQ6 A;  3LKI A;  4GM6 A;  3EAG A;  4E69 A;  3RSS A;  3RSQ A;  4EN4 A;  4EOH A;  4KAH A;  1J6U A;  5B6A A;  3IQ0 A;  3VAS A;  1V1A A;  2AM1 A;  4KAL A;  2UUO A;  5COJ A;  2C49 A;  3JUL A;  5EY7 A;  4C12 A;  5C3Y A;  3UQ6 A;  2VTD A;  2AJP A;  2XTB A;  2HW1 A;  1TD2 A;  2Y66 A;  3B1O A;  1UB0 A;  3HJ6 A;  4KAD A;  3B1N A;  1O5Z A;  3RT9 A;  3UMO A;  3NL6 A;  2WTZ A;  1YGJ A;  4N09 A;  3UQE A;  3RTB A;  3RTD A;  1GC5 A;  2Y67 A;  1JBW A;  3KTN A;  3N1C A;  3RRB A;  3K5W A;  3UQ9 A;  3NL5 A;  2JG5 A;  1V1S A;  3RPH A;  3K9E A;  1FGS A;  3B3L A;  4S1H A;  2V78 A;  3RQ2 A;  4DC3 A;  1GG4 A;  3RS8 A;  4LBG A;  2AFB A;  2VOS A;  1U2X A;  2AB8 A;  4QF5 A;  2R3E A;  3I3Y A;  3HPD A;  3NRS A;  2VTE A;  1E8C A;  5BYD A;  5EYN A;  4E8Z A;  4C5K A;  1VK4 A;  2GC6 A;  2HLZ A;  5C40 A;  3IE7 A;  3QAI A;  3RQH A;  3IBQ A;  4B8R A;  2PKK A;  1P31 A;  3HYO A;  3GO6 A;  1JBV A;  3RT7 A;  2XJA A;  4BUC A;  3UAG A;  3VAQ A;  4S1I A;  4C5M A;  4HV4 A;  1YHJ A;  1LIO A;  2I6A A;  2WJP A;  3PYZ A;  2Y68 A;  3LHX A;  1RKA A;  3RPZ A;  4EBU A;  1LIK A;  1GQY A;  2X5O A;  1RKD A;  2UUP A;  2A9Z A;  3LOO A;  2I6B A;  3MBH A;  1EEH A;  2JG1 A;  5C3Z A;  4ZIY A;  2XPC A;  4K8P A;  4K93 A;  4KBE A;  2AWD A;  2AA0 A;  4O1G A;  4CVK A;  3RSF A;  4EUM A;  3NL3 A;  2ABS A;  3RS9 A;  3NC2 A;  4O1L A;  3B1P A;  5CM5 A;  3UMP A;  3RY7 A;  3MBJ A;  1TZ6 A;  3N2A A;  4JKS A;  4XCK A;  5TRW A;  4C5J A;  3DRW A;  1ESJ A;  2DDW A;  3RQ5 A;  2VOR A;  3BGK A;  4B8S A;  1V19 A;  4X8F A;  2ABQ A;  3RM5 A;  1W78 A;  4JKU A;  4C5L A;  4E8Y A;  5BYE A;  1DGM A;  4K8K A;  2PKN A;  2JFF A;  3ZS7 A;  3NM3 A;  3RQQ A;  2YXU A;  3NBW A;  3RRE A;  3CQD A;  3H74 A;  1LII A;  2I5B A;  4PVV A;  3LJS A;  3NBV A;  4UBE A;  5BYF A;  1LIJ A;  2Q5R A;  2PKF A;  2YXT A;  3IH0 A;  1LHP A;  3DZV A;  4WJM A;  4XF7 A;  1RKS A;  3RQ8 A;  3RU3 A;  4CVM A;  5BYC A;  5F0Z A;  1ESQ A;  1EKQ A;  5C41 A;  3NCA A;  4KAN A;  3RTC A;  4XDA A;  1W7K A;  2F02 A;  3Q1Y A;  3UQD A;  4LC4 A;  3B1Q A;  3ZL8 A;  2AM2 A;  2HQQ A;  5CGE A;  2F7K A;  4LCA A;  2QHP A;  2VAR A;  4K8C A;  3B1R A;  2Y1O A;  1EKK A;  4K9I A;  2GCB A;  3IN1 A;  4QDI A;  4U7X A;  4LBX A;  3RQX A;  1P3D A;  2JFG A;  4YWR A;  2GC5 A;  3RTE A;  1VI9 A;  3PL2 A;  4E8W A;  3GBU A;  3FHY A;  3LK7 A;  1GQT A;  3RTA A; 
#chains in the Genus database with same CATH homology
 2PKM A;  4C5N A;  3KEU A;  3RU2 A;  3UBO A;  3NM1 A;  3KZH A;  1JXH A;  3EWM A;  3QA2 A;  3RSG A;  2C4E A;  3NC9 A;  4S1I B;  3W4S A;  4DU5 A;  1KYH A;  4EN4 A;  1RFV A;  2DCN A;  3H49 A;  4K9C A;  5TQI A;  1BX4 A;  1YGK A;  2AJR A;  1RK2 A;  3OTX A;  3RTG A;  1L2L A;  1TYY A;  4JJP A;  4E3A A;  3PZS A;  1WYE A;  1LHR A;  3NL2 A;  1JXI A;  2FV7 A;  2NWH A;  4S1M A;  3RRJ A;  3RU3 A;  3RO4 A;  3Q92 A;  2DDM A;  2RBC A;  1VM7 A;  1V1B A;  3GO7 A;  1RFT A;  4E84 A;  2QCV A;  4K8T A;  5F11 A;  3RRF A;  3IKH A;  4YL5 A;  1RFU A;  1UA4 A;  3KD6 A;  2DDO A;  3FHX A;  4XF6 A;  1TZ3 A;  2AX3 A;  2JGV A;  4N08 A;  1C3Q A;  3BF5 A;  3HIC A;  2A9Y A;  5CGA A;  2R3B A;  3RQ6 A;  3LKI A;  4GM6 A;  4E69 A;  4EOH A;  3RSS A;  3RSQ A;  4KAH A;  5B6A A;  3IQ0 A;  3VAS A;  1V1A A;  4KAL A;  5COJ A;  5EY7 A;  2C49 A;  3JUL A;  3UQ6 A;  5C3Y A;  2AJP A;  2XTB A;  2HW1 A;  1TD2 A;  3B1O A;  4KAD A;  1UB0 A;  3HJ6 A;  3RT9 A;  3B1N A;  3UMO A;  4B8R A;  3NL6 A;  1YGJ A;  4N09 A;  3UQE A;  3RTB A;  3RTD A;  1GC5 A;  3KTN A;  3N1C A;  3RRB A;  3K5W A;  3UQ9 A;  3NL5 A;  2JG5 A;  1V1S A;  3RPH A;  3K9E A;  4S1H A;  3B3L A;  3RQ2 A;  2V78 A;  4DC3 A;  3RS8 A;  4LBG A;  2AFB A;  1U2X A;  2AB8 A;  2R3E A;  3I3Y A;  3HPD A;  5BYD A;  5EYN A;  4E8Z A;  4C5K A;  2HLZ A;  1VK4 A;  5C40 A;  3IE7 A;  3QAI A;  3RQH A;  3IBQ A;  2PKK A;  3HYO A;  3GO6 A;  3RT7 A;  3VAQ A;  4S1I A;  4C5M A;  1YHJ A;  1LIO A;  2I6A A;  3LHX A;  1RKA A;  3RPZ A;  4EBU A;  1LIK A;  1RKD A;  2A9Z A;  3LOO A;  2I6B A;  3MBH A;  2JG1 A;  5C3Z A;  4K8P A;  4K93 A;  4KBE A;  2AWD A;  2AA0 A;  4O1G A;  3RSF A;  4EUM A;  3NL3 A;  2ABS A;  3RS9 A;  3NC2 A;  4O1L A;  3B1P A;  5CM5 A;  3UMP A;  3RY7 A;  3MBJ A;  1TZ6 A;  4XCK A;  4JKS A;  5TRW A;  4C5J A;  3DRW A;  1ESJ A;  2DDW A;  3RQ5 A;  3BGK A;  4B8S A;  1V19 A;  4X8F A;  2ABQ A;  3RM5 A;  4JKU A;  4C5L A;  4E8Y A;  5BYE A;  1DGM A;  4K8K A;  2PKN A;  3ZS7 A;  3NM3 A;  3RQQ A;  2YXU A;  3NBW A;  3RRE A;  3CQD A;  3H74 A;  1LII A;  2I5B A;  4PVV A;  3LJS A;  3NBV A;  4UBE A;  5BYF A;  1LIJ A;  2Q5R A;  2PKF A;  2YXT A;  3IH0 A;  1LHP A;  3DZV A;  4WJM A;  4XF7 A;  1RKS A;  3RQ8 A;  5BYC A;  5F0Z A;  1ESQ A;  1EKQ A;  5C41 A;  3NCA A;  4KAN A;  3RTC A;  4XDA A;  2F02 A;  3Q1Y A;  3UQD A;  4LC4 A;  3B1Q A;  2HQQ A;  5CGE A;  2F7K A;  4LCA A;  2QHP A;  2VAR A;  4K8C A;  3B1R A;  1EKK A;  4K9I A;  3IN1 A;  3RQX A;  4U7X A;  4LBX A;  4YWR A;  3RTE A;  1VI9 A;  3PL2 A;  4E8W A;  3GBU A;  3FHY A;  1GQT A;  3RTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...