2JGVA

Structure of staphylococcus aureus d-tagatose-6-phosphate kinase in complex with adp
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
315
structure length
314
Chain Sequence
PRSHMILTLTLNPSVDISYPLTALKLDDVNRVQEVSKTAGGKGLNVTRVLAQVGEPVLASGFIGGELGQFIAKKLDHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPEIDNQEAAGFIKHFEQLLEKVEAVAISGSLPKGLNQDYYAQIIERCQNKGVPVILDCSGATLQTVLENPYKPTVIKPNISELYQLLNQPLDESLESLKQAVSQPLFEGIEWIIVSLGAQGAFAKHNHTFYRVNIPTISVLNPVGSGDSTVAGITSAILNHENDHDLLKKANTLGMLNAQEAQTGYVNLNNYDDLFNQIEVLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Staphylococcus Aureus D-Tagatose-6-Phosphate Kinase Implicate Domain Motions in Specificity and Mechanism.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
molecule keywords TAGATOSE-6-PHOSPHATE KINASE
total genus 94
structure length 314
sequence length 315
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.144: Tagatose-6-phosphate kinase.
pdb deposition date 2007-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 2jgvA00
2JGVA 2R3EA 3FHYA 3HPDA 3IN1A 4EUMA 3UQDA 2I5BA 1V19A 3IE7A 3PL2A 4JKUA 1GC5A 3NCAA 1C3QA 1LIKA 3RQXA 3RT7A 2YXTA 2A9ZA 5F0ZA 2QCVA 4K9IA 1DGMA 4YL5A 3NBVA 5TRWA 5CGEA 3RU3A 1LHPA 3NM3A 1EKKA 3IKHA 4JJPA 3I3YA 4K8KA 5EYNA 3UMPA 3Q92A 4YWRA 3LKIA 3UBOA 3VAQA 4N08A 4C5MA 3N1CA 1UA4A 3RS9A 3RY7A 1TZ6A 2YXUA 3KTNA 3UMOA 3B1QA 3BGKA 3NL3A 2DCNA 3OTXA 5COJA 1RKDA 2PKMA 4WJMA 3IBQA 1WYEA 3HYOA 1RK2A 2JG5A 3KD6A 3QA2A 2DDWA 4LBXA 3B1OA 1YHJA 4KALA 1JXIA 4O1LA 2A9YA 2RBCA 2DDMA 4S1HA 4XDAA 2F02A 2AA0A 3NL5A 1RFVA 3MBHA 3RT9A 5F11A 3CQDA 4U7XA 3RRFA 4N09A 4O1GA 1ESQA 2F7KA 4S1IB 3RTGA 1U2XA 3RO4A 2Q5RA 3RQ2A 3LHXA 1V1AA 2JG1A 3KZHA 3RQ5A 5C41A 3RRJA 2C4EA 1UB0A 4DU5A 2VARA 1V1SA 2PKKA 2I6BA 3Q1YA 4XF6A 4KADA 3JULA 4C5KA 5BYDA 2HLZA 4E8WA 1YGJA 3H49A 4LC4A 3RTEA 3RTAA 1JXHA 4S1MA 2AWDA 3W4SA 4C5LA 2V78A 3IQ0A 4XCKA 3NC9A 2PKNA 3GO7A 5BYCA 4EBUA 1VI9A 3B1NA 3EWMA 4K8CA 3RREA 4E8ZA 4C5NA 1GQTA 3DRWA 3NL6A 1RKSA 4EN4A 1TYYA 1LIJA 1EKQA 3NM1A 3UQ9A 1LIOA 4S1IA 3HICA 4K9CA 3BF5A 5C3YA 4K8PA 3GO6A 5CM5A 3VASA 3B3LA 5BYFA 5TQIA 3PZSA 1LIIA 5B6AA 4GM6A 2FV7A 1RKAA 5EY7A 3UQEA 5C3ZA 2HQQA 5BYEA 3DZVA 2AB8A 3ZS7A 2AFBA 4LBGA 3IH0A 1RFTA 3RS8A 4KANA 3RPZA 1LHRA 2I6AA 2QHPA 1V1BA 1KYHA 3KEUA 3B1PA 4UBEA 4DC3A 3H74A 1TZ3A 2NWHA 3RQQA 4KAHA 3RTBA 2XTBA 3GBUA 1YGKA 4LCAA 3RPHA 3RRBA 5C40A 1RFUA 4E69A 2C49A 1TD2A 4B8SA 4XF7A 4K8TA 2ABSA 4KBEA 4B8RA 4JKSA 3B1RA 3NC2A 3K5WA 2HW1A 2AX3A 3RM5A 3QAIA 4E3AA 3RQHA 4C5JA 2DDOA 1VK4A 3FHXA 4E84A 2AJPA 5CGAA 3NBWA 2PKFA 3RSGA 3RU2A 3UQ6A 4E8YA 3MBJA 4X8FA 3RQ6A 3RTCA 1VM7A 3LJSA 2ABQA 3K9EA 1BX4A 3LOOA 4EOHA 3RSFA 2AJRA 3RTDA 4K93A 4PVVA 3RSSA 2R3BA 3RSQA 3NL2A 3RQ8A 1L2LA 1ESJA
chains in the Genus database with same CATH superfamily
1JBWA 2JGVA 2R3EA 3FHYA 3HPDA 3IN1A 4EUMA 3UQDA 2I5BA 1V19A 3IE7A 3PL2A 4JKUA 1GC5A 3NCAA 1C3QA 1LIKA 1P3DA 2Y68A 3N2AA 3RQXA 3RT7A 2YXTA 1UAGA 2A9ZA 5F0ZA 2QCVA 4K9IA 1DGMA 4YL5A 1EEHA 3NBVA 5TRWA 1FGSA 3RU3A 1LHPA 5CGEA 3NM3A 1EKKA 2JFHA 3IKHA 4JJPA 2Y67A 3I3YA 4K8KA 5EYNA 3UMPA 3Q92A 4YWRA 3LKIA 3UBOA 3VAQA 4CVLA 4N08A 4C5MA 3NRSA 3N1CA 1UA4A 1E8CA 3RS9A 3RY7A 1TZ6A 2YXUA 3KTNA 3UMOA 3B1QA 3BGKA 2UUOA 2DCNA 2VORA 3NL3A 3OTXA 5COJA 1RKDA 2PKMA 4WJMA 2VOSA 1WYEA 3IBQA 3PYZA 4ZIYA 3ZM6A 3HYOA 1RK2A 4C13A 2JG5A 3KD6A 3QA2A 2DDWA 3QCZA 4LBXA 3B1OA 1YHJA 2UUPA 4KALA 1JXIA 2GCAA 2VTEA 4O1LA 2A9YA 2RBCA 4BUCA 2VTDA 2DDMA 4S1HA 4XDAA 4CVMA 2F02A 2AA0A 1GQYA 3NL5A 1RFVA 3MBHA 2AM2A 1E0DA 3CQDA 3RT9A 5F11A 4U7XA 3RRFA 4N09A 4O1GA 1ESQA 2F7KA 4S1IB 1W78A 2JFGA 3RTGA 1U2XA 3RO4A 2Q5RA 3RQ2A 3LHXA 1V1AA 2JG1A 3KZHA 3RQ5A 5C41A 3RRJA 2C4EA 1UB0A 2JFFA 2Y66A 4DU5A 2VARA 1V1SA 2PKKA 4BUBA 2I6BA 3Q1YA 4XF6A 3EAGA 4KADA 1JBVA 3JULA 4C5KA 5BYDA 2HLZA 2F00A 4E8WA 1YGJA 3H49A 4LC4A 3RTEA 4HV4A 3RTAA 1JXHA 4S1MA 2AWDA 3W4SA 4C5LA 2V78A 3IQ0A 4XCKA 3NC9A 2PKNA 3GO7A 4UAGA 5BYCA 4EBUA 1VI9A 3B1NA 3EWMA 4K8CA 3RREA 4E8ZA 4C5NA 5A5EA 1GQTA 3DRWA 3NL6A 2GCBA 3HN7A 1RKSA 4EN4A 1TYYA 1LIJA 1EKQA 1O5ZA 3NM1A 1W7KA 1LIOA 4S1IA 3HICA 4K9CA 3UQ9A 4CVKA 3BF5A 5C3YA 4K8PA 3GO6A 5CM5A 3VASA 3B3LA 5BYFA 5TQIA 3PZSA 1LIIA 5B6AA 1P31A 4GM6A 4QF5A 2XPCA 2FV7A 1RKAA 5EY7A 3UQEA 5C3ZA 2HQQA 5BYEA 3DZVA 2AB8A 3ZS7A 1J6UA 2AFBA 4LBGA 3UAGA 3IH0A 3ZM5A 1GQQA 1RFTA 4KANA 3HJ6A 3RPZA 3RS8A 1LHRA 3LK7A 2I6AA 1V1BA 1KYHA 2QHPA 3KEUA 3B1PA 4UBEA 2XJAA 4DC3A 3H74A 1GG4A 4C12A 1TZ3A 2NWHA 2WTZA 2UAGA 2X5OA 4KAHA 2XTBA 3GBUA 3RQQA 2GC5A 1YGKA 4LCAA 3RPHA 3RRBA 3RTBA 5C40A 1RFUA 2Y1OA 2C49A 4E69A 1TD2A 4B8SA 4XF7A 4K8TA 2ABSA 4KBEA 4B8RA 4JKSA 3B1RA 3NC2A 3K5WA 2HW1A 2AX3A 3RM5A 3QAIA 4E3AA 3RQHA 4C5JA 2DDOA 3ZL8A 1VK4A 3FHXA 4E84A 2AJPA 5CGAA 3NBWA 2PKFA 3RSGA 3RU2A 5A5FA 4E8YA 3UQ6A 3MBJA 4X8FA 3RQ6A 3RTCA 1VM7A 3LJSA 2ABQA 2AM1A 1BX4A 3K9EA 3LOOA 4EOHA 3RSFA 2AJRA 3RTDA 2GC6A 4K93A 2WJPA 4PVVA 3RSSA 2R3BA 3RSQA 3NL2A 3RQ8A 1L2LA 1ESJA 4QDIA
chains in the Genus database with same CATH topology
2JGVA 2R3EA 3FHYA 3HPDA 3IN1A 4EUMA 3UQDA 2I5BA 1V19A 3IE7A 3PL2A 4JKUA 1GC5A 3NCAA 1C3QA 1LIKA 3RQXA 3RT7A 2YXTA 2A9ZA 5F0ZA 2QCVA 4K9IA 1DGMA 4YL5A 3NBVA 5TRWA 5CGEA 3RU3A 1LHPA 3NM3A 1EKKA 3IKHA 4JJPA 3I3YA 4K8KA 5EYNA 3UMPA 3Q92A 4YWRA 3LKIA 3UBOA 3VAQA 4N08A 4C5MA 3N1CA 1UA4A 3RS9A 3RY7A 1TZ6A 2YXUA 3KTNA 3UMOA 3B1QA 3BGKA 3NL3A 2DCNA 3OTXA 5COJA 1RKDA 2PKMA 4WJMA 3IBQA 1WYEA 3HYOA 1RK2A 2JG5A 3KD6A 3QA2A 2DDWA 4LBXA 3B1OA 1YHJA 4KALA 1JXIA 4O1LA 2A9YA 2RBCA 2DDMA 4S1HA 4XDAA 2F02A 2AA0A 3NL5A 1RFVA 3MBHA 3RT9A 5F11A 3CQDA 4U7XA 3RRFA 4N09A 4O1GA 1ESQA 2F7KA 4S1IB 3RTGA 1U2XA 3RO4A 2Q5RA 3RQ2A 3LHXA 1V1AA 2JG1A 3KZHA 3RQ5A 5C41A 3RRJA 2C4EA 1UB0A 4DU5A 2VARA 1V1SA 2PKKA 2I6BA 3Q1YA 4XF6A 4KADA 3JULA 4C5KA 5BYDA 2HLZA 4E8WA 1YGJA 3H49A 4LC4A 3RTEA 3RTAA 1JXHA 4S1MA 2AWDA 3W4SA 4C5LA 2V78A 3IQ0A 4XCKA 3NC9A 2PKNA 3GO7A 5BYCA 4EBUA 1VI9A 3B1NA 3EWMA 4K8CA 3RREA 4E8ZA 4C5NA 1GQTA 3DRWA 3NL6A 1RKSA 4EN4A 1TYYA 1LIJA 1EKQA 3NM1A 3UQ9A 1LIOA 4S1IA 3HICA 4K9CA 3BF5A 5C3YA 4K8PA 3GO6A 5CM5A 3VASA 3B3LA 5BYFA 5TQIA 3PZSA 1LIIA 5B6AA 4GM6A 2FV7A 1RKAA 5EY7A 3UQEA 5C3ZA 2HQQA 5BYEA 3DZVA 2AB8A 3ZS7A 2AFBA 4LBGA 3IH0A 1RFTA 3RS8A 4KANA 3HJ6A 3RPZA 1LHRA 2I6AA 2QHPA 1V1BA 1KYHA 3KEUA 3B1PA 4UBEA 4DC3A 3H74A 1TZ3A 2NWHA 3RQQA 4KAHA 3RTBA 2XTBA 3GBUA 1YGKA 4LCAA 3RPHA 3RRBA 5C40A 1RFUA 4E69A 2C49A 1TD2A 4B8SA 4XF7A 4K8TA 2ABSA 4KBEA 4B8RA 4JKSA 3B1RA 3NC2A 3K5WA 2HW1A 2AX3A 3RM5A 3QAIA 4E3AA 3RQHA 4C5JA 2DDOA 1VK4A 3FHXA 4E84A 2AJPA 5CGAA 3NBWA 2PKFA 3RSGA 3RU2A 3UQ6A 4E8YA 3MBJA 4X8FA 3RQ6A 3RTCA 1VM7A 3LJSA 2ABQA 3K9EA 1BX4A 3LOOA 4EOHA 3RSFA 2AJRA 3RTDA 4K93A 4PVVA 3RSSA 2R3BA 3RSQA 3NL2A 3RQ8A 1L2LA 1ESJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JGV A;  2R3E A;  3FHY A;  3HPD A;  3IN1 A;  4EUM A;  3UQD A;  2I5B A;  1V19 A;  3IE7 A;  3PL2 A;  4JKU A;  1GC5 A;  3NCA A;  1C3Q A;  1LIK A;  3RQX A;  3RT7 A;  2YXT A;  2A9Z A;  5F0Z A;  2QCV A;  4K9I A;  1DGM A;  4YL5 A;  3NBV A;  5TRW A;  5CGE A;  3RU3 A;  1LHP A;  3NM3 A;  1EKK A;  3IKH A;  4JJP A;  3I3Y A;  4K8K A;  5EYN A;  3UMP A;  3Q92 A;  4YWR A;  3LKI A;  3UBO A;  3VAQ A;  4N08 A;  4C5M A;  3N1C A;  1UA4 A;  3RS9 A;  3RY7 A;  1TZ6 A;  2YXU A;  3KTN A;  3UMO A;  3B1Q A;  3BGK A;  3NL3 A;  2DCN A;  3OTX A;  5COJ A;  1RKD A;  2PKM A;  4WJM A;  3IBQ A;  1WYE A;  3HYO A;  1RK2 A;  2JG5 A;  3KD6 A;  3QA2 A;  2DDW A;  4LBX A;  3B1O A;  1YHJ A;  4KAL A;  1JXI A;  4O1L A;  2A9Y A;  2RBC A;  2DDM A;  4S1H A;  4XDA A;  2F02 A;  2AA0 A;  3NL5 A;  1RFV A;  3MBH A;  3RT9 A;  5F11 A;  3CQD A;  4U7X A;  3RRF A;  4N09 A;  4O1G A;  1ESQ A;  2F7K A;  4S1I B;  3RTG A;  1U2X A;  3RO4 A;  2Q5R A;  3RQ2 A;  3LHX A;  1V1A A;  2JG1 A;  3KZH A;  3RQ5 A;  5C41 A;  3RRJ A;  2C4E A;  1UB0 A;  4DU5 A;  2VAR A;  1V1S A;  2PKK A;  2I6B A;  3Q1Y A;  4XF6 A;  4KAD A;  3JUL A;  4C5K A;  5BYD A;  2HLZ A;  4E8W A;  1YGJ A;  3H49 A;  4LC4 A;  3RTE A;  3RTA A;  1JXH A;  4S1M A;  2AWD A;  3W4S A;  4C5L A;  2V78 A;  3IQ0 A;  4XCK A;  3NC9 A;  2PKN A;  3GO7 A;  5BYC A;  4EBU A;  1VI9 A;  3B1N A;  3EWM A;  4K8C A;  3RRE A;  4E8Z A;  4C5N A;  1GQT A;  3DRW A;  3NL6 A;  1RKS A;  4EN4 A;  1TYY A;  1LIJ A;  1EKQ A;  3NM1 A;  3UQ9 A;  1LIO A;  4S1I A;  3HIC A;  4K9C A;  3BF5 A;  5C3Y A;  4K8P A;  3GO6 A;  5CM5 A;  3VAS A;  3B3L A;  5BYF A;  5TQI A;  3PZS A;  1LII A;  5B6A A;  4GM6 A;  2FV7 A;  1RKA A;  5EY7 A;  3UQE A;  5C3Z A;  2HQQ A;  5BYE A;  3DZV A;  2AB8 A;  3ZS7 A;  2AFB A;  4LBG A;  3IH0 A;  1RFT A;  3RS8 A;  4KAN A;  3RPZ A;  1LHR A;  2I6A A;  2QHP A;  1V1B A;  1KYH A;  3KEU A;  3B1P A;  4UBE A;  4DC3 A;  3H74 A;  1TZ3 A;  2NWH A;  3RQQ A;  4KAH A;  3RTB A;  2XTB A;  3GBU A;  1YGK A;  4LCA A;  3RPH A;  3RRB A;  5C40 A;  1RFU A;  4E69 A;  2C49 A;  1TD2 A;  4B8S A;  4XF7 A;  4K8T A;  2ABS A;  4KBE A;  4B8R A;  4JKS A;  3B1R A;  3NC2 A;  3K5W A;  2HW1 A;  2AX3 A;  3RM5 A;  3QAI A;  4E3A A;  3RQH A;  4C5J A;  2DDO A;  1VK4 A;  3FHX A;  4E84 A;  2AJP A;  5CGA A;  3NBW A;  2PKF A;  3RSG A;  3RU2 A;  3UQ6 A;  4E8Y A;  3MBJ A;  4X8F A;  3RQ6 A;  3RTC A;  1VM7 A;  3LJS A;  2ABQ A;  3K9E A;  1BX4 A;  3LOO A;  4EOH A;  3RSF A;  2AJR A;  3RTD A;  4K93 A;  4PVV A;  3RSS A;  2R3B A;  3RSQ A;  3NL2 A;  3RQ8 A;  1L2L A;  1ESJ A; 
#chains in the Genus database with same CATH topology
 1JBW A;  2JGV A;  2R3E A;  3FHY A;  3HPD A;  3IN1 A;  4EUM A;  3UQD A;  2I5B A;  1V19 A;  3IE7 A;  3PL2 A;  4JKU A;  1GC5 A;  3NCA A;  1C3Q A;  1LIK A;  1P3D A;  2Y68 A;  3N2A A;  3RQX A;  3RT7 A;  2YXT A;  1UAG A;  2A9Z A;  5F0Z A;  2QCV A;  4K9I A;  1DGM A;  4YL5 A;  1EEH A;  3NBV A;  5TRW A;  1FGS A;  3RU3 A;  1LHP A;  5CGE A;  3NM3 A;  1EKK A;  2JFH A;  3IKH A;  4JJP A;  2Y67 A;  3I3Y A;  4K8K A;  5EYN A;  3UMP A;  3Q92 A;  4YWR A;  3LKI A;  3UBO A;  3VAQ A;  4CVL A;  4N08 A;  4C5M A;  3NRS A;  3N1C A;  1UA4 A;  1E8C A;  3RS9 A;  3RY7 A;  1TZ6 A;  2YXU A;  3KTN A;  3UMO A;  3B1Q A;  3BGK A;  2UUO A;  2DCN A;  2VOR A;  3NL3 A;  3OTX A;  5COJ A;  1RKD A;  2PKM A;  4WJM A;  2VOS A;  1WYE A;  3IBQ A;  3PYZ A;  4ZIY A;  3ZM6 A;  3HYO A;  1RK2 A;  4C13 A;  2JG5 A;  3KD6 A;  3QA2 A;  2DDW A;  3QCZ A;  4LBX A;  3B1O A;  1YHJ A;  2UUP A;  4KAL A;  1JXI A;  2GCA A;  2VTE A;  4O1L A;  2A9Y A;  2RBC A;  4BUC A;  2VTD A;  2DDM A;  4S1H A;  4XDA A;  4CVM A;  2F02 A;  2AA0 A;  1GQY A;  3NL5 A;  1RFV A;  3MBH A;  2AM2 A;  1E0D A;  3CQD A;  3RT9 A;  5F11 A;  4U7X A;  3RRF A;  4N09 A;  4O1G A;  1ESQ A;  2F7K A;  4S1I B;  1W78 A;  2JFG A;  3RTG A;  1U2X A;  3RO4 A;  2Q5R A;  3RQ2 A;  3LHX A;  1V1A A;  2JG1 A;  3KZH A;  3RQ5 A;  5C41 A;  3RRJ A;  2C4E A;  1UB0 A;  2JFF A;  2Y66 A;  4DU5 A;  2VAR A;  1V1S A;  2PKK A;  4BUB A;  2I6B A;  3Q1Y A;  4XF6 A;  3EAG A;  4KAD A;  1JBV A;  3JUL A;  4C5K A;  5BYD A;  2HLZ A;  2F00 A;  4E8W A;  1YGJ A;  3H49 A;  4LC4 A;  3RTE A;  4HV4 A;  3RTA A;  1JXH A;  4S1M A;  2AWD A;  3W4S A;  4C5L A;  2V78 A;  3IQ0 A;  4XCK A;  3NC9 A;  2PKN A;  3GO7 A;  4UAG A;  5BYC A;  4EBU A;  1VI9 A;  3B1N A;  3EWM A;  4K8C A;  3RRE A;  4E8Z A;  4C5N A;  5A5E A;  1GQT A;  3DRW A;  3NL6 A;  2GCB A;  3HN7 A;  1RKS A;  4EN4 A;  1TYY A;  1LIJ A;  1EKQ A;  1O5Z A;  3NM1 A;  1W7K A;  1LIO A;  4S1I A;  3HIC A;  4K9C A;  3UQ9 A;  4CVK A;  3BF5 A;  5C3Y A;  4K8P A;  3GO6 A;  5CM5 A;  3VAS A;  3B3L A;  5BYF A;  5TQI A;  3PZS A;  1LII A;  5B6A A;  1P31 A;  4GM6 A;  4QF5 A;  2XPC A;  2FV7 A;  1RKA A;  5EY7 A;  3UQE A;  5C3Z A;  2HQQ A;  5BYE A;  3DZV A;  2AB8 A;  3ZS7 A;  1J6U A;  2AFB A;  4LBG A;  3UAG A;  3IH0 A;  3ZM5 A;  1GQQ A;  1RFT A;  4KAN A;  3HJ6 A;  3RPZ A;  3RS8 A;  1LHR A;  3LK7 A;  2I6A A;  1V1B A;  1KYH A;  2QHP A;  3KEU A;  3B1P A;  4UBE A;  2XJA A;  4DC3 A;  3H74 A;  1GG4 A;  4C12 A;  1TZ3 A;  2NWH A;  2WTZ A;  2UAG A;  2X5O A;  4KAH A;  2XTB A;  3GBU A;  3RQQ A;  2GC5 A;  1YGK A;  4LCA A;  3RPH A;  3RRB A;  3RTB A;  5C40 A;  1RFU A;  2Y1O A;  2C49 A;  4E69 A;  1TD2 A;  4B8S A;  4XF7 A;  4K8T A;  2ABS A;  4KBE A;  4B8R A;  4JKS A;  3B1R A;  3NC2 A;  3K5W A;  2HW1 A;  2AX3 A;  3RM5 A;  3QAI A;  4E3A A;  3RQH A;  4C5J A;  2DDO A;  3ZL8 A;  1VK4 A;  3FHX A;  4E84 A;  2AJP A;  5CGA A;  3NBW A;  2PKF A;  3RSG A;  3RU2 A;  5A5F A;  4E8Y A;  3UQ6 A;  3MBJ A;  4X8F A;  3RQ6 A;  3RTC A;  1VM7 A;  3LJS A;  2ABQ A;  2AM1 A;  1BX4 A;  3K9E A;  3LOO A;  4EOH A;  3RSF A;  2AJR A;  3RTD A;  2GC6 A;  4K93 A;  2WJP A;  4PVV A;  3RSS A;  2R3B A;  3RSQ A;  3NL2 A;  3RQ8 A;  1L2L A;  1ESJ A;  4QDI A; 
#chains in the Genus database with same CATH homology
 2JGV A;  2R3E A;  3FHY A;  3HPD A;  3IN1 A;  4EUM A;  3UQD A;  2I5B A;  1V19 A;  3IE7 A;  3PL2 A;  4JKU A;  1GC5 A;  3NCA A;  1C3Q A;  1LIK A;  3RQX A;  3RT7 A;  2YXT A;  2A9Z A;  5F0Z A;  2QCV A;  4K9I A;  1DGM A;  4YL5 A;  3NBV A;  5TRW A;  5CGE A;  3RU3 A;  1LHP A;  3NM3 A;  1EKK A;  3IKH A;  4JJP A;  3I3Y A;  4K8K A;  5EYN A;  3UMP A;  3Q92 A;  4YWR A;  3LKI A;  3UBO A;  3VAQ A;  4N08 A;  4C5M A;  3N1C A;  1UA4 A;  3RS9 A;  3RY7 A;  1TZ6 A;  2YXU A;  3KTN A;  3UMO A;  3B1Q A;  3BGK A;  3NL3 A;  2DCN A;  3OTX A;  5COJ A;  1RKD A;  2PKM A;  4WJM A;  3IBQ A;  1WYE A;  3HYO A;  1RK2 A;  2JG5 A;  3KD6 A;  3QA2 A;  2DDW A;  4LBX A;  3B1O A;  1YHJ A;  4KAL A;  1JXI A;  4O1L A;  2A9Y A;  2RBC A;  2DDM A;  4S1H A;  4XDA A;  2F02 A;  2AA0 A;  3NL5 A;  1RFV A;  3MBH A;  3RT9 A;  5F11 A;  3CQD A;  4U7X A;  3RRF A;  4N09 A;  4O1G A;  1ESQ A;  2F7K A;  4S1I B;  3RTG A;  1U2X A;  3RO4 A;  2Q5R A;  3RQ2 A;  3LHX A;  1V1A A;  2JG1 A;  3KZH A;  3RQ5 A;  5C41 A;  3RRJ A;  2C4E A;  1UB0 A;  4DU5 A;  2VAR A;  1V1S A;  2PKK A;  2I6B A;  3Q1Y A;  4XF6 A;  4KAD A;  3JUL A;  4C5K A;  5BYD A;  2HLZ A;  4E8W A;  1YGJ A;  3H49 A;  4LC4 A;  3RTE A;  3RTA A;  1JXH A;  4S1M A;  2AWD A;  3W4S A;  4C5L A;  2V78 A;  3IQ0 A;  4XCK A;  3NC9 A;  2PKN A;  3GO7 A;  5BYC A;  4EBU A;  1VI9 A;  3B1N A;  3EWM A;  4K8C A;  3RRE A;  4E8Z A;  4C5N A;  1GQT A;  3DRW A;  3NL6 A;  1RKS A;  4EN4 A;  1TYY A;  1LIJ A;  1EKQ A;  3NM1 A;  3UQ9 A;  1LIO A;  4S1I A;  3HIC A;  4K9C A;  3BF5 A;  5C3Y A;  4K8P A;  3GO6 A;  5CM5 A;  3VAS A;  3B3L A;  5BYF A;  5TQI A;  3PZS A;  1LII A;  5B6A A;  4GM6 A;  2FV7 A;  1RKA A;  5EY7 A;  3UQE A;  5C3Z A;  2HQQ A;  5BYE A;  3DZV A;  2AB8 A;  3ZS7 A;  2AFB A;  4LBG A;  3IH0 A;  1RFT A;  3RS8 A;  4KAN A;  3HJ6 A;  3RPZ A;  1LHR A;  2I6A A;  2QHP A;  1V1B A;  1KYH A;  3KEU A;  3B1P A;  4UBE A;  4DC3 A;  3H74 A;  1TZ3 A;  2NWH A;  3RQQ A;  4KAH A;  3RTB A;  2XTB A;  3GBU A;  1YGK A;  4LCA A;  3RPH A;  3RRB A;  5C40 A;  1RFU A;  4E69 A;  2C49 A;  1TD2 A;  4B8S A;  4XF7 A;  4K8T A;  2ABS A;  4KBE A;  4B8R A;  4JKS A;  3B1R A;  3NC2 A;  3K5W A;  2HW1 A;  2AX3 A;  3RM5 A;  3QAI A;  4E3A A;  3RQH A;  4C5J A;  2DDO A;  1VK4 A;  3FHX A;  4E84 A;  2AJP A;  5CGA A;  3NBW A;  2PKF A;  3RSG A;  3RU2 A;  3UQ6 A;  4E8Y A;  3MBJ A;  4X8F A;  3RQ6 A;  3RTC A;  1VM7 A;  3LJS A;  2ABQ A;  3K9E A;  1BX4 A;  3LOO A;  4EOH A;  3RSF A;  2AJR A;  3RTD A;  4K93 A;  4PVV A;  3RSS A;  2R3B A;  3RSQ A;  3NL2 A;  3RQ8 A;  1L2L A;  1ESJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...