2JI4A

Human phosphoribosylpyrophosphate synthetase - associated protein 41 (pap41)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
350
structure length
302
Chain Sequence
GLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQSIVSKLLASMMCKAGLTHLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDYRNAVIVAKSPASAKRAQSFAERLRLGIAVIHPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHGLLSSDAPRRIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human Phosphoribosylpyrophosphate Synthetase -Associated Protein 41 (Pap41)
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PHOSPHORIBOSYL PYROPHOSPHATE SYNTHETASE-ASSOCIATED PROTEIN 2
total genus 95
structure length 302
sequence length 350
ec nomenclature
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ji4A01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ji4A02
3GGJA 4ZFNA 4RHXA 5JV5A 1QK4A 4RQBA 1A96A 1OROA 5KAPA 2PRZA 1ECFA 1TC1A 3M3HA 1DQPA 3ACBA 5E38A 1HGXA 1TC2A 4Z1OA 2PS1A 4QYIA 3OHPA 3MJDA 2IGBA 1QB7A 1J7JA 3GEPA 4F8EA 1XTTA 1A98A 1QK3A 2C4KA 4LYGA 4P81A 4M0PA 1VDMA 1DKRA 4QYIB 1MZVA 4P83A 1A3CA 1Z7GA 1STOA 1VCHA 2HCRA 1U9YA 1GPH1 1P4AA 1ZN9A 5BSKA 1OREA 4OHCA 4QRIA 2VFAA 4RHUA 1VSTA 1A4XA 1A95A 3ACDA 5KAMA 5IPFA 3OZFA 1HMPA 1D6NA 4KN6A 5BQPA 1Y0BA 3DMPA 1I14A 2H06A 2JBHA 1O57A 1ECCA 2FXVA 3KB8A 1I0IA 1XTUA 5ESXA 1UPFA 5JSQA 4RACA 1DKUA 1W30A 1I0LA 3N2LA 4WMLA 4LZNA 4P3KA 4S2UA 4FYMA 3H83A 5ESWA 4M0UA 1BD4A 1OPRA 3GGCA 2JKZA 1IBSA 2AEEA 3S5JA 3DAHA 1ZN8A 1ECGA 2E55A 1L1QA 4X44A 3NAGA 4RABA 2XBUA 2JKYA 4P86A 4P80A 4P82A 1U9ZA 4X45A 3MBIA 4LYYA 4WN3A 1G9SA 1AO0A 4P84A 4RANA 1G9TA 3LRTA 1JLRA 4JITA 1O5OA 1DQNA 1P19A 2PRYA 4TWBA 4LZAA 5HKLA 1V9SA 1JLSA 1QB8A 1GRVA 1PZMA 1UFRA 1ECBA 1YFZA 1L1RA 1BZYA 1P18A 2GEBA 3G6WA 1XTVA 1I13A 4RADA 4RV4A 2JI4A 3O7MA 1NULA 3QW4B 1I5EA 1FSGA 3OZGA 3DEZA 4M0KA 5BQOA 1QCCA 1ECJA 1BD3A 5EUCA 1ZN7A 1XZNA 5HIAA 2DY0A 2H07A 1DBRA 4RHTA 4PAWA 2EHJA 3EFHA 2WNSA 1G2QA 4PFQA 1P17A 2P1ZA 1UPUA 4LZOA 4MB6A 3HVUA 4RAOA 3ACCA 4RQAA 4RHYA 4RAQA 1NONA 5IAOA 1WD5A 5BRNA 1A97A 1QK5A 3LPNA 5K51A 4IJQA 4JLSA 1QCDA 2H08A 1LH0A 1XZ8A 1G2PA 2YZKA 1CJBA 1R3UA
chains in the Genus database with same CATH superfamily
1KR2A 3CLVA 1ZNWA 2H29A 1QO9A 3GBVA 3O1IC 1BHSA 4JBGA 4DJTA 4E21A 1X9HA 2XE4A 5I7EA 5CP8A 1JSLA 1CDEA 1CRLA 4HYQA 1KE1A 2IPNA 4QPDA 3OLQA 4MMZB 3OLYA 3GG2A 2G4LA 1ZNYA 2FWJA 3OFNA 5FO0A 3WMFA 4YJHA 2PWYA 4HH4A 3RYFA 3ET4A 2XY4A 5EINA 1SQ5A 5DI9A 1WKCA 2NZYA 4WVFA 2Y66A 5B2FA 5EERA 3DTVA 3H04A 4NFYA 5B1IA 2B35A 3L1UA 2C29D 2BN4A 1IK4A 1A3CA 2HQ1A 2VHZA 1IXSB 2ZDGA 4Q12A 1MAAA 4ERXA 5B12A 3NPAA 2ZYSA 3CUWA 4IUBS 4KVZA 3BHMA 4UPDA 4XWTA 1IBLB 3Q87B 5T3UA 4NNOA 4QDXA 2ZJ1A 3EXIA 4C4PA 3HFJA 1D2EA 1FMTA 4RHUA 1T8UA 3DE2X 3GRAA 2I1QA 4FNMA 4IDHA 3SC2B 1UL1X 4IRMA 3IUPA 3GV0A 5H80A 2WQ6A 1RAAA 2VPWA 1G7SA 4HDCA 4QPJC 1ZLYA 5REQA 3ZV7A 4FFLA 1UBGA 3LLUA 5TQVA 4MS4B 4F56A 1X7HA 2EZ9A 2DFNA 1Z5NA 1QYWA 1HPLA 2IT1A 5JS6A 2NU7A 2N3ZA 1KHTA 4AURA 1I24A 1ODFA 3AL3A 3PC8A 5J63A 4BGIA 4EB8A 3BZWA 3PQ3A 5EE1A 1IB0A 2LCIA 3IQWA 4A8PA 2VQDA 5BSUA 1JFRA 5MDHA 2ZJAA 2VSYA 1GPJA 3F2IA 3CN7A 1TCUA 4H35A 4OM7A 3G9QA 3KVOA 3LHDA 4YH1A 3EGXA 4LI0A 3WRVA 4U7GA 1FTSA 4PY2A 1OUMA 1XMIA 3IIIA 5K0CA 1C7IA 5L7TA 3IEIA 4O2LA 3AJRA 2DVMA 4C3ZA 3DZBA 1RLMA 3OLZA 5CXXA 1FLVA 3U31A 1VG0B 1XF1A 1Z2OX 1RADA 2H3HA 2DUNA 2OGWA 1ZI9A 3H8VA 1XVVA 1GFIA 2BELA 3WLEA 2QBYB 4HX5A 3PX3A 1PR2A 1Z29A 5HZHA 5FXMA 1PKEA 4NFSA 4UBLA 3B5JA 4RLSA 4OOFA 2OLEA 3B5EA 3I12A 3RYIA 4WNAA 4XLLA 3GOQA 1KQNA 1ADJA 1PQUA 2OAGA 4K86A 3PRYA 3G8AA 5K01A 4HNRA 2X0FA 1HLPA 2MSNA 3GLGE 4R8SA 3TUZC 3CZQA 5ILGA 2GYYA 4I1RA 3G2IA 4C3VA 2Y6VA 3D64A 2XDAA 2ZBEA 4PYQA 3KRTA 1UXJA 2GCIA 4E46A 3BDAA 3R20A 3HG7A 4Z51A 4HQOA 2X2FA 1TJPB 3HA2A 5GZ3A 2PQ6A 3PHGA 1AD2A 1QOPB 2PLWA 4BFWA 3HJHA 1T1IA 3IUQA 4IFTA 5K0GA 3WB1A 4G1MB 1V4NA 4P31A 1NUTA 4M9XA 4B17A 3K8YA 3KB2A 3UWDA 3HBJA 1BEUB 3NT5A 2Y4NA 4P33A 3JRNA 3PQ5A 4W5JA 2F3SA 4RS4A 2G0TA 3STHA 4EEKA 1M2JA 4TRJA 2RC6A 1JP7A 3T5BA 4YECA 1KZGB 4KQ2A 4MB2A 4RY0A 2ONCA 1HNZB 4MVJA 2YFQA 1HEUA 2CE7A 3WIEA 3RQIA 4DDVA 2VQFB 4GX1A 5AKKA 3UT0A 3Q88A 5HRAA 1UK7A 3RYCB 2JG3A 2OLKA 1DQPA 5T4EA 4JJ7A 1CF2O 4FGUA 5AUPB 1Z06A 2PV7A 1NQUA 1ULSA 2WD7B 1I10A 1LCIA 4FINA 5CB6A 5AW4A 1TK2A 4YIHA 5JLJA 1EHCA 1JIXA 3AUKA 1S2OA 2GZ1A 1T6XA 4OMDA 3HK2A 1LPBB 3S2GA 4YLYA 2CKDA 3QUBA 3ULKA 2XB4A 3BIWA 2JLVA 1J0XO 1T3SA 1T9CA 1WV0A 2IXFA 3A32A 1MZVA 4QTUB 5I9IA 4X66B 1HSOA 3AM4A 2PVPA 4IKPA 2AJLI 5DULA 3WIVA 1GTJ1 3VR1A 5SYNA 4PO8A 4Q7EA 5JJCA 4R2HA 4OMUA 4BLSA 4EPXA 1XCLA 1NZJA 2XT6A 2AD5A 2RI6A 4YAGA 4MCJA 3AT1A 4WX2B 1WQ4A 2OHHA 1AGXA 1QGUB 2MYUA 4J0FA 2FTKE 4R9UC 1D6NA 1F20A 1Y4UA 1PTJC 2GT1A 2P91A 5ENZA 4E4RA 3I37X 4L72A 2IA5A 4A92A 4LTMA 4C7XA 3BH6A 1JR6A 3L8FA 2AG0A 1V8FA 2BRUA 4O4JF 3KTAB 1S2MA 2PRJA 4HFRA 2OCLA 2D4AA 2VDWA 2WVHA 2QTNA 1LBQA 1T5IA 5DHFA 4M8SA 1NBOA 1PJ2A 2ERXA 2J1LA 2MOKA 7MHTA 4Q03A 3NHJA 1H0HA 3MW8A 5ED4A 1D1TA 4JI5B 1MO6A 2E0IA 4WZAE 1QFYA 3TGPA 3EUEA 5EJ8A 1DELA 2G8LA 1EI9A 3PGKA 2PPVA 3ROGA 4NICA 4UEJA 1TVKB 1M2HA 1SXIA 2L17A 4P4GA 2WJWA 3U4GA 2XBUA 3OQOA 5FX2A 3Q8KA 1GR0A 1SU7A 3MIIA 4KXYA 4BZZA 1QBKC 2V4UA 1R0ZA 2DBZA 1YDMA 2FZGA 4ME6A 3PIRA 3ZIDA 2PXHA 4PSCA 2WMDA 4FYVA 1N9GA 5AK3A 3OJXA 1T0IA 1V1MA 3ADCA 4Q4CA 1QO7A 2WNHA 3ZCQA 5TQ2B 4BECA 3GA0A 2Y76A 5E4JA 2YY5A 2ZRMA 1V11A 3GAFA 3R7AA 5EPOA 1LDGA 2YMMA 1QZTA 4GMFA 3WGOA 4DMRA 4I4LA 2WKSA 3EQ2A 1BZYA 1P18A 1FXSA 3ZBUA 4RV4A 4BJ6A 2A0WA 1I1HA 3FKQA 3FPJA 4AS2A 2WKQA 3IODA 3DQQA 5IX8A 5JFTA 4BXOA 2R68A 1PWZA 1RE1A 3QXXA 4F04A 2YYAA 3HP4A 5AK6A 3S1LA 3PUHA 3BCHA 2PZFA 3EAFA 4NC9A 1WXQA 1GQ2A 1GXSA 1HT2E 2X3UA 3JVDA 4Q4AA 2FPSA 2HA0A 3HQ4O 3O8BA 1RWXA 2Y2UA 4I1UA 3RB8A 3EVDA 3WHIA 4R1NA 3LBFA 1H2ZA 1KVSA 2GEFA 3M6FA 4GPZA 3RTEA 4CNQA 7MDHA 4BNUA 2R4TA 2VCEA 1ODIA 3EW9A 1TO6A 2WZCA 3ZTYA 2NU9A 4B6QA 3VAZA 2JVIA 5KTMA 4REQB 4MH0R 1OT3A 2FSFA 3DTVD 1BIFA 3LJKA 3PHHA 4JENA 1A97A 4TSRA 4YPVA 4JJAA 4BEVA 3UENA 4MARA 2Q0XA 2EP5A 5JFGA 4JLSA 1GTG1 2F90A 3H5IA 4YEDA 4DKJA 4BGEA 4LJSA 5F2KA 4BFLA 3GCWA 5BR4A 2PX2A 2QX9A 4AXBA 4IS2A 3NKFA 1QGYA 4LQCA 2WDPA 3LT4A 3OZCA 4ZVRA 2OCYC 3PJEA 2I1LA 2Q3CA 2BKLA 3PHLA 2D1YA 2N0SA 3UH0A 1UZAA 1LGYA 5FPHA 1N9GB 2B5VA 5H16A 1J23A 2H5JA 1B6RA 3FTQA 3ORSA 4L08A 1VE3A 4P34A 4FFVA 4REMA 3X1YA 2OAQ1 4DMGA 4CTMA 3F9IA 4F5EA 1NJ5A 1ADBA 1DDIA 1Q15A 1TQ8A 2ZTMA 5F5NA 1RLJA 1O58A 4TRRA 3KYCA 2JAOA 1B2RA 3OZDA 1ESZA 1HOXA 1Z7GA 3BCSA 4HVAA 4O3FA 3SLKA 2BKUA 4Y6PA 1U7XA 4II3A 1HQDA 3A06A 4PGHA 1NTRA 5A9TA 1MC1A 2XT9A 1SY7A 4RZHA 4BCDA 4ICIA 2JATA 1HYEA 1X1EA 1ORHA 5GVRA 4E5YA 5EZYB 3RHTA 4AO6A 2BY4A 3WC4A 4F5DA 2FE1A 1E0KA 1XD2B 2A6PA 4V0QA 1Z34A 2VN8A 3QELA 3ZV5A 3MJVA 3UGJA 2OZEA 1RPZA 4ANFA 3R3UA 4CTNA 1VPWA 2JGIA 3TQHA 4FOPA 3S7TA 1TX4B 2QUKA 1P0PA 4KYIB 4QFCA 2ONZA 3ZHRA 1TXGA 1DEOA 5I9BA 5A3SA 4C6TA 1GAEO 1P1IA 3G17A 5EJIA 2Q1YA 4QVIA 4OY3A 2VF2A 1M1YE 5KHLB 3ID6C 5AHKA 1KMQA 2XTAA 3EXHA 1WF6A 4BP9A 3FSEA 4IV8A 1B8UA 1RHKA 5IU6A 3JQ9C 1Q2UA 2WWYA 4P0QB 2C4WA 1Y82A 1DG9A 1GRNA 3KU1A 4KQFA 3A70A 2FP4A 3K1YA 4RPJA 3WMEA 2JZNA 1WETA 1J5EB 1Y3CE 3L79A 1YKFA 3LY9A 4MYCA 4OQDA 3ZXXA 1NVUQ 1J2EA 4MVWA 5KJ6A 1WMDA 2FZKA 2P6NA 3H99A 3EVEA 5G2OA 2AR7A 2J0VA 4LJAA 2GD1O 3PNVA 1F2TA 1QYIA 4HTAA 3ZU5A 5KB3A 4MROA 1A8HA 3ZBQA 2PGJA 3ND6A 1RVV1 4DADA 3W1WA 5FYDA 2XV1A 3L43A 2YV1A 3ITEA 2VT7A 3AM1A 4HWPA 3JQAD 4BAUA 1SU4A 2D2VA 3K0FA 2H18A 2CDRA 4WTOA 1GADO 3UC5A 1ZD5A 3SP1A 2BV3A 2MYNA 4F3RA 4OA8A 1L8XA 2QPLA 1DO8A 1ZGCA 4DPLA 2DWUA 2DUMA 1L5QA 1R0BA 1SAYA 3FMPB 4KO4S 3GMSA 1E4EB 1YRBA 3STYA 1PJSA 5DI3A 3DEKA 5KWSA 4W5OA 2ZJZA 1QH9A 3I45A 1N2JA 3KQSA 1HL3A 1USWA 3HYLA 3KSDO 4OUDA 2Q3BA 3SMVA 4ALJA 2ZYIA 1XQXA 2VXYA 1JDTA 2XQVA 4KMOA 3A1CA 4GIBA 3L9WA 2Q45A 2IUSA 4EOGA 4AKIA 3Q3VA 2NV2B 3FWZA 5K20A 1HLFA 3SR0A 1IG0A 2H1HA 1BDJA 3N5CA 1QK5A 3I2YX 4J1TC 4O0LA 1KFCB 1QLWA 5EE5B 4UE3S 1U2TA 4YJFB 1UDWA 4PO1A 2NP7A 3IXMA 3PU6A 4QPZA 1IAVA 1BG6A 2VR1A 1NHWA 2NZVG 5JV5A 2CWWA 1VM6A 1A96A 2FQ1A 4JMPA 4D99A 4UKDA 2G67A 2J5KA 4E5KA 2PBFA 2I2CA 1GA6A 1I6LA 2X5XA 5T6BA 1XX6A 1LSJA 4P4SB 3ETLA 5GOZA 1QVAA 4EYSA 1BSVA 1W88B 1PLJA 1SG0A 2J30A 4RJLA 3IHTA 4PBTA 4J94A 1NIPA 2VH1A 3DMRA 5HX7A 5ICEA 1IRIA 4FJ0A 4V1CB 1N36B 1U0HC 2QYHA 3GRCA 3GGDA 4X6XA 1BGXT 4CV2A 3EGEA 2ODAA 5G40A 1VGQA 3ZLTA 2BM1A 4WRRA 4BBJA 2RGRA 4QU9A 1Z0SA 3D4NA 1JDBC 1QIKA 2GPAA 2GN6A 4RPLA 1Y3HA 1GARA 4RD1A 4Q1VA 2NN3C 1H2XA 2YQ5A 5U9CA 3TQIA 2JARA 1MMFB 1NVGA 1IXKA 2J3KA 4NS4A 1W76A 1AS2A 3K0AB 1NZDA 2Q7DA 2QN2A 2YVKA 2G77B 2HOQA 2RHBA 1TAHA 5KNCH 4AX4A 3I4CA 4L8VA 5IF9A 4GLLA 4KQKA 3RGWS 2FMHA 3SNKA 2YR0A 3FBTA 1HTWA 4EF5A 9GPBA 1HE5A 2GPWA 4FHCA 4OU5A 1T29A 3HJNA 2P5UA 3KC2A 2FW9A 3FSJX 3LDGA 1B2LA 5IVHA 3QU5A 1Q3HA 1YOBA 2FR1A 2W22A 2I71A 1E1CA 3BHIA 3GMIA 1XQVA 4OQLA 4Y2JA 1HMYA 1VXRA 3NVAA 4G0WA 3LSTA 3GD5A 3QFHA 2VPQA 3K73O 4U2CA 2A14A 3ZUPA 3EISA 1D6JA 3HM9A 4K1XA 3UNXA 4YV0A 2X0IA 3ABSB 4BU0A 1PT7A 1ZMTA 2ZRFA 1QCZA 2AG1A 1U3VA 3HCCA 4KGZA 3M81A 2HU8A 1ZR2A 4KXMA 1MHPA 3TEJA 4YLEA 1MP0A 1NJ8A 4ZCQA 5CB8A 4DQLA 1TLLA 4F8JA 3PEWA 1UT6A 5F98A 1H4VB 4LQ4A 1GQFA 4F2GA 4EG1A 5L53A 1FY2A 1MH1A 1QF7A 3CINA 3WGVA 2GGSA 2MSWA 1TZKA 3OEED 4D25A 4PCAA 3GPCA 3KKNA 2XMRA 1X7DA 4RL4A 1QZ3A 4ZEVA 4XOUA 3RVMA 2QYSA 5L4NA 4NCBA 2X2PA 3C97A 1MG0A 3N2ZB 4Y9UA 1MO5A 2WV7A 4WOCA 2J4CA 2VWPA 5HKBA 4XQEA 3N8DA 2DFPA 4EHDA 3LP6A 1WU7A 2DBQA 2GD2A 3PUIA 3TR0A 5E9WA 3MFQA 2XGGA 4HVTA 4OAQA 5BW6B 4JB0A 1U98A 3HKBB 1AUOA 2B37A 4LF6B 3N2IA 4JS0A 2Q3EA 2CLDX 3MUNA 1Q1BA 3GLFB 4E3ZA 4BAZA 4C7VA 1C50A 2PKRA 1NNEA 3BB4A 3L7MA 2DFVA 3GGGA 1E6KA 5ER9A 4BEWA 3FGNA 3WQHA 1GG9A 5KKCA 2IYAA 4TMZA 2O2HA 1QGDA 4F9FA 3IIEA 3KX2A 4JI7B 1YZTA 3CF4G 2ZBQA 1HFKA 3CVYA 3JARB 2UV8A 3CIFA 5E9AA 3VZQA 4OGWA 4KREA 3ESCA 4P93A 3UCEA 4C0QC 4DV1B 4YBZA 4M0LA 4CQMD 3AL0C 5JVDB 3T1NA 4XXHA 1UBTS 1W5AA 2XVAA 4N40A 1WDMA 4XW2A 1X7YA 4JLUA 4EA8A 2R7LA 2P6PA 5DHAA 2GAJA 3LYAA 3E9DA 2H4YA 4PWYA 3T7DA 3KOYA 1KPHA 3EDRA 1GRCA 3NBXX 4WKBA 1P1FA 2QUHA 2P0AA 4H3KB 1TQHA 2B61A 2OQRA 3OHSX 5MGNA 3LVBA 3GR6A 3EJWA 4EY6A 4RORA 5J4VA 2IZ0A 5J4LA 2NUPA 5BRAA 5ELMA 1UFQA 3E35A 4RKEA 1CD5A 4RQUA 1BCSA 1GOTA 1P7ZA 1TFRA 3LWNA 3TB6A 4JUCA 2XUGA 1CRZA 1DKRA 1A71A 2IHJA 4D9GA 2RJ3A 4Z2YA 4KZKA 1UC9A 2RGDA 4KXUA 1IB6A 1TUIA 4LXTA 2R48A 3NDJA 2XE7A 1F6BA 2LPMA 4MV6A 3TW8B 4D4HA 5BUSA 3R3VA 2VF5X 2FDXA 4GR4A 1RZUA 1DV1A 1I36A 1RAEA 2XVMA 2YJ3A 3A1TA 1NRIA 2ZREA 1QE5A 4TM8A 5CT9A 2IK8A 5F1KA 1J5PA 2E9SA 1FFWA 1SUBA 3EZLA 3EQ8A 1UWLA 1PR9A 3JAWA 4PS1A 2RGNA 4KIUA 4ZPJA 3CH4B 1AKMA 1F17A 4JZYA 1O1YA 5IPFA 3GJ3A 1G1MA 3FW1A 3TZCA 3G1UA 5FUVA 1R6AA 1TZBA 1US8A 1JPVA 4N8SA 5G1PA 4EZIA 5JAQA 2HAEA 1X80A 3JQFC 4RTOA 2RK6A 2H2HA 3FCSB 5DCLA 5DN6A 4Z0PA 4K9DA 4QGHA 1Y5LA 2DSNA 3D4LA 3KJFA 4V0KA 3NVDA 5IEBA 2AQ8A 1DBSA 4ON9A 1HDXA 4DT1B 4ER0A 1GYQA 3A1EA 3N0TA 3OT1B 1OLSB 2IVZA 1D2RA 3A4VA 3M1YA 4MAFA 4MUGA 1MTOA 1GZUA 4HXEB 5IAJA 4A16A 2WKRA 2HRQA 2ZRCA 1YA6A 4AN1A 1FDWA 2Y1DA 3HBFA 3MTIA 4ZDJA 4P86A 1C9EA 3QTLA 3M6VA 4G9BA 3DONA 1FUEA 1C9YA 2CUNA 1SMKA 4BRSA 3ONDA 2IIVA 2QGNA 1ANKA 1OIVA 2VQSA 1ZY2A 4EZBA 1DOAA 5DLQC 4UDOA 4TGLA 1P4JA 1LRJA 4G4JA 3DPIA 4Z9AA 1E9BA 4AY4A 2X0RA 3I9MA 1ZGGA 1P5JA 1DWQA 1U0SY 3HUDA 4PYKA 4TPKA 3HI4A 3WKCA 4IIYA 4KKVA 2ZK7A 4EGJA 3IHLA 3TZHA 3GY0A 4QULA 3CGGA 4PONA 2IU6A 4HATA 2XUJA 4OGLA 5JD4A 2X8AA 3PE3A 1KAMA 2B5OA 3L7YA 1NWCA 2Q1SA 1T43A 3DEIA 3SZRA 3M6XA 4BWFB 1RXIA 2GK7A 4G5YA 1XWFA 4R84A 3BEOA 3K2BA 5C3UA 3U7EB 2J5XA 4J91A 2Z2JA 1O4WA 2MYTA 1V5WA 1EZ4A 2Y8EA 3EIUA 3CLUD 4BLUA 1QUFA 3JTEA 3SOPA 1KSFX 4S0ZA 4MUAA 2O1EA 2WNSA 1O95D 2HSJA 2EIHA 2VG8A 2YV2A 2IUYA 2VNJA 4U2EA 3N0XA 4MQFB 1T5OA 2OQ2A 4CEHB 1MQ8B 4OFBA 1CR4A 1AURA 1W4BA 4C4XA 4FGJA 3UV6A 4FC6A 1AT1A 1SXJC 1T1GA 1Z6ZA 4A6EA 4C0XA 1ZM3A 4OB6A 3T5MA 4AJJA 3OTOB 3B51X 1PWEA 1PJQA 1KQGA 3CZCA 4LF5B 3KLOA 4FSXA 5CLIA 4RD3A 3ABQB 3HFGA 3FNEA 3AJAA 4MQUA 1OROA 2Z04A 3K9GA 1I4WA 2A84A 2ANBA 1ECFA 2PSJA 4C22A 4QGSA 2IS1A 3B3QA 5A9RA 4FMDF 2CJPA 2YQ4A 4PPFA 3NC0C 3N0WA 1F48A 5HBGA 2VPIA 2IJGX 4P4SA 2V6JA 1ATIA 2XDQB 3KQPA 2YWRA 3BXXA 1YFLA 3JQ6A 3GFPA 3FNHA 3LQ1A 1E2KA 3HR8A 1KVRA 1T9AA 3MMPA 4PAGA 4QHSA 3W6ZA 4QG3A 2GF0A 5EMMA 3OT4A 5U1PA 3IBFA 4OL0A 3DJFA 3T06B 3NUZA 1FLAA 2DBYA 1X6VA 3FYUB 2ON6A 3ANLA 1F12A 2HK6A 1T2UA 3KUKA 1YXMA 3THYB 1TTQB 2Z0MA 1WP4A 3E81A 1DAKA 1QRRA 5TQ0B 5JALA 1YH3A 1Z6GA 2ATVA 3IQDB 4R1PA 4RZQA 4F93B 4G9EA 5LQMA 3J7AC 2H00A 1UBEA 4RA9B 4HT3B 5I7VA 4RVNA 3ZCTA 5BN5A 1Z5ZA 3S8MA 1JDVA 1MORA 3ORFA 3AX6A 3S68A 1HQCA 3D8UA 3QUAA 4C3UA 4F12A 2Q3HA 4JLDA 1CYEA 1UJ4A 3CX7A 3TNJA 1I3CA 1ML4A 2X8JA 1WR8A 2HA2A 1QQ5A 4GE0A 5KSWB 2N47A 4BIIA 1ZWLA 3LHFA 1M54A 3BJMA 5FBLB 1RZRA 2EFCB 1Y37A 3NI2A 1DKLA 4JJKA 4X1OA 3A6DA 5IM4A 1E62A 3QBJA 3SJZA 2P2ZA 4IX1A 4PAMA 4X00A 5EMJA 2HI0A 2VAMA 1GQYA 1IQPA 3JQGA 4M1TA 3W1VA 1MQ9A 4PSVA 2QGFA 4D79A 4EI8A 2O8CB 4HNQA 1RC8A 3NVMB 5AJUA 4KR6A 3NHBA 1G6HA 2HCFA 5EJ2A 5HDQA 1GLVA 4WJLA 2FN7A 1E3LA 3TUJC 1F8GA 1FS4A 1GM5A 3NHZA 2Z8XA 3IDZA 1HNXB 2DTXA 2JFWA 1KO1A 2JJ1A 2RKOA 4RH1A 2CDAA 4NQRA 1ZUHA 2ZJ8A 3H2ZA 4NBRA 1HDIA 1Q0UA 1E5VA 1PUJA 1W1UA 2VWQA 4NZPA 3KR9A 3VZCA 4DY6A 3LKZA 1UBJS 3FBGA 1NBHA 3KQVA 2ZDQA 4L5CA 4OP2A 4CHTA 2Y1LA 1H69A 5DBIA 1L1RA 3SEFA 3LL7A 1YZFA 3AEUA 3FHCB 2Z5FA 3D43A 4MGKR 1NVAA 4RY8A 3ABZA 3TMYA 4W7SA 2HFJA 1O89A 4X8MA 2HRRA 4LYFA 1F06A 1KOJA 2X15A 1SOVA 5BVHA 1MPXA 3H19A 3PEEA 3QLUC 1RWWA 1P81A 4NEQA 4RJJA 1VJCA 4H6PA 1QAMA 4L50A 5K1ZA 5C32A 4RD2A 2I6UA 4Y6RA 4YJ3F 4D4MA 2WUEA 3RAFC 1U3FA 3OO1A 3A14A 4LZOA 5KWJA 5JS1A 3FUTA 2R6ZA 1OB2A 3R7FA 1HURA 5EKXA 2COUA 5JS2A 4CCYB 1UADA 1QFXA 3LPNA 3WBBA 3X1XA 2PHZA 4IP0A 4BNHA 1VFNA 4PIVA 1DQRA 1ESEA 2X7XA 2EKDA 1XVIA 4HWGA 4X7BA 3V6MA 3PXUA 3KXKA 5A05A 4EFNA 3T4XA 1WMEA 1J22A 4QYTA 1ZOIA 5DHRA 4G1CA 1I2CA 4RKQA 4Z9FA 5DW0A 5C8YA 2WM2A 1NBIA 3BE4A 2OBYA 4MJ3A 4MS4A 4NU0A 4CQLA 4EM6A 4RULA 5T67A 3G79A 3RG8A 5EHQA 1SUPA 2XXBA 3IT3A 1P5FA 1TJYA 3DZCA 4QLBA 4YP9A 4QYWA 1B42A 3TSAA 2BKEA 3WADA 1XZPA 4DRXB 4CLRA 3Q40A 4XQCA 3QE9Y 3H5WA 4U2DA 3UCXA 3A37A 1P4HA 4GNKA 3T7TA 3TJZA 2HPAA 5TARA 4R8LA 2NG1A 2I3GA 1MF7A 3HJAA 3A4TA 4TS9A 3ILVA 4B46A 2JI9A 5CFPA 1WSAA 2ZIFA 5T64A 2VJYA 3R7BA 2NZUG 1U0NA 4G3XA 4LGMA 3RU9A 3VRHA 2QPAA 1EDDA 3KL2A 2WYIA 3B7PA 4IL5A 5EWMA 1RJ9A 1TFUA 3UT5B 1O9GA 1YF3A 3LBAA 3GP3A 1SK8A 3JVIA 5JWHA 2OG1A 4LXHA 4DRYA 1RWKA 3IMEA 4ARBA 4E94A 3MG9A 2IYLD 4UW9A 3OESA 5EI5A 4L9WA 3FOZA 1BQ3A 3DPUA 1Q1NA 5C7IO 2C07A 3NHYA 4FWIB 2O8BB 4GXQA 1N57A 2FPOA 1NLFA 3DZ8A 2ZPAA 2AN4A 1G5HA 1RC1A 4Z4HA 1FX0B 4Q18A 3OPYI 4V2UA 2J48A 2PJUA 1HE2A 5K0FA 4P3OA 5F73A 3ZY5A 2O2IA 3FPGA 2WU0A 3H13A 1GKIA 3HM2A 3ILYA 5HM6A 3DMTC 4EJ6A 2CSXA 2Y9MB 3IQIX 3AL2A 4Z9XA 1JXMA 1TRKA 3GA7A 3PZBA 4PANA 4RMGA 1LI4A 1QDEA 5EMNA 2JGEA 4R81A 4DA6A 3RIGA 1NXVA 1L8QA 2EFEB 2J46A 2KMLA 4UDNA 4UTNA 3W0LB 1BMTA 2FB9A 2Z6UA 3DXXA 1EVQA 2JZOA 4XOIA 4QBGB 2NPIA 1V9SA 1IM8A 1C1YA 2O2SA 5THKA 2ZYRA 4JT9A 1Z39A 3N6XA 2BFEB 2HTFA 3AI7A 3F9RA 1AKVA 2YW9A 1AU9A 1ECBA 2H7XA 2P7IA 1OLOA 1XVUA 2XBLA 1N6KA 3AUUA 4N0QA 4HYEA 1XMPA 4ZRDA 2NU6B 3SX2A 1EBFA 2AHOA 4K88A 1YMQA 2XKJE 3WKAA 2CJWB 5DYYA 4KQEA 1ADFA 1NLUA 5JZMA 2WA1A 1Z17A 3DDSA 1N2GA 1PTKA 4NYJQ 3HEAA 2FRDC 3IMFA 4UCXA 4OHYA 1Z6QA 5D5QA 3KKMA 3ZDQA 4KAFA 2N9UA 2AVDA 3L0CA 3D3JA 4MO9A 2GYVA 3QLVA 4R16A 4EW2A 5DBOA 2YV3A 3FAKA 2F9MA 2WW8A 4S12A 1E0DA 1RWMA 1XU9A 3RS9A 3SPXA 3SYRA 2C83A 1OBFO 1Z6XA 4RDIA 2A94A 2CW5A 1KK2A 4NULA 1ZL0A 1L4UA 3S0JA 3WZLA 4RA6A 1H6CA 1U2GA 1FU8A 2J7PD 2WT9A 3KUUA 3MRXA 4ITVA 4ZOAA 3LPDA 4ND7A 3TINA 3DE3X 2D1FA 1B73A 5CXSA 3IALA 4CE6A 5I7RA 2IX3A 3SZLA 1CKEA 3ELBA 2PXAA 1OIXA 3HA7A 1G66A 3IP5A 4PEVA 3RC1A 3L77A 8ABPA 1I7LA 5HK9A 4E5PA 1RQXA 3OZRA 3S7ZA 4WCFB 5D00A 4DMKA 2D6FA 1V8OA 2QTMA 1TAUA 1Y4ZA 1N0WA 5IVDA 3IQHX 4HL6A 1VCOA 2XKKA 4TTJA 1T9DA 4A36A 2QRMA 4JI8B 4ZJYA 1DAOA 1E66A 1J97A 3M5DA 4XEUA 5DFAA 3B9QA 4EVIA 1SVKA 1B43A 2XMZA 3KB6A 4JLBA 2WWIA 1QZUA 5JAPA 2R84A 1FA9A 4G56A 1I9CA 1KU6A 3N6VA 4L7VA 4BZPA 2JGRA 1JLLB 1VHJA 3R3HA 1J2TA 1P44A 2XHEA 2FHSA 4QEKA 2GD0A 3FROA 4D45A 3RRYA 3BJZA 1OWLA 3LUBA 2N1MA 1N1GA 3NHPA 2GKOA 1RRKA 2EU8A 2YRXA 4FX2A 4NPHA 2O3SA 5THXA 3IAFA 4G4SP 4MWTA 2BCEA 2GN9A 3R76A 5M04A 3IIKA 4B2IA 4EPYA 5C4IA 4RZUA 1DOHA 1EAYA 1KJWA 3EA0A 4I6GA 3W5CA 1KZ9A 1JBKA 1MLDA 2NVUA 3WL7A 2Q0SA 5DP2A 1O2DA 2BEJA 4M8NE 4XX0B 5JCPA 2HBQA 2O19A 2DXIA 2A8YA 4UVDA 3MPUA 4Q9IA 2HLPA 1V7QA 1XZDA 1P2GA 2MSEB 3DQPA 5DDIP 4E7PA 4IIEA 2ZU6A 1U1IA 1XL0A 1T4CB 2VC2B 2IOHA 3I83A 4FYMA 3TCNA 4EFLA 5CIYA 4DVGA 2QYOA 4DPKA 5BOSA 3R8CA 1D4AA 1IAQA 1Q3TA 4ZJZA 1WXFA 1XN4A 1MH9A 3NIGB 5FLYA 1C9MA 4HH3C 5CA1F 3N8KA 4CM8A 1CB7A 3P9ZA 3T9CA 3Q3HA 3UJDA 1NDHA 3K3PA 1OX6A 4QXAA 5KYYA 2EKZA 2PJDA 1YR1A 1FNBA 3FTCA 1JG7A 3Q0EA 721PA 5LJLA 3WYDA 5IW8A 3A3KA 3ZTWA 5AKLA 2ZCVA 4K9PA 3ZHQA 1M34B 1TGYA 3NH9A 2ODEA 3DZJA 1W29A 3PC2A 3QOFA 4UHBA 3E7XA 4JI6B 4CMGA 5BQFA 2AHRA 3WWDA 4IOLA 2ZBRA 1JVSA 4C14A 1H3FA 2C9MA 4HP8A 1Y1RA 3EWSA 1UT8A 4KQXA 3M7IA 3O4GA 1FUKA 1NVVR 3QF4A 5ENVA 3TLZA 3KLNA 2IBSA 1UAAA 3CRNA 4NOJA 1QX4A 4ZOQI 5AJYA 5EVJA 3V48A 3OLVA 4ZARA 2X22A 1IZYA 4GBED 3VC2A 1JKXA 4JQYA 2X14A 1XZNA 1ZL2A 2FK7A 3K4PA 3A3YA 3K9LA 3TSYA 1CZNA 1QIMA 2X13A 1K4KA 3IMKA 1KAEA 1CJKC 3NS7A 1YCFA 1MT0A 5FV4A 4JLOA 1JVNA 3DV9A 4EJ2A 5A0FA 5AM0A 3UATA 1P17A 1TUBA 2OSVA 2H59A 5KREA 1X7ZA 1S4QA 3Q7IA 1DKMA 1E1RD 1R8XA 2AFHB 3L8MA 4AECA 4UMEA 4FYPA 4GFDA 3CQ9A 2I2FA 3PLRA 5J2TF 3SX0A 4JYCA 3CEJA 3H9QA 3QVSA 5E1OA 3ST7A 3RT9A 1CBUA 1ZH8A 2W2NA 3GJRA 3LHKA 4RVFA 5CX1A 4B4VA 2DR2A 2HA7A 1H22A 4CIWA 1MRSA 3DT9A 3M33A 1PQWA 3MGAA 4MI1A 2FFJA 3M9WA 5EHGA 4TTRA 1NP6A 1I6MA 2CNOA 5D6NA 1X1SA 5E3IA 3MQ4A 3IMGA 3MTQA 4D82A 1R4MA 3CNOA 3I5UA 2GM5A 5SYAA 3R3WA 1WO8A 1TVCA 3LCMA 4K2AA 5GGXA 3GVIA 1RAIA 3MJDA 1GKKA 2R62A 2YHBA 1JEDA 3K4QA 5JLAA 3MGCA 2J7KA 1KHHA 2VAXA 5AKJA 4DVJA 4HF7A 3DKVA 4CLRB 3DKRA 4PSKA 4D8YA 2WYVA 3SJUA 1TKAA 3O2NA 4GRAA 4YRBA 1UMDA 3ZW8A 1KMMA 3CT6A 5EIEA 2GX6A 4IV0A 1FDUA 3SIPA 1RXCA 5LBUA 1FEZA 5FUYA 2JFZA 4TYWA 5CNJA 1ZN9A 3E7WA 4HJXA 2DT8A 4OHCA 3NTOA 3UMCA 4BLPA 2A30A 1WB6A 2BR3A 2OORC 3WTBA 1KI9A 1EU1A 5FFFA 4BO5A 2V74B 4D8UA 2VFAA 3PXDA 3VC7A 3O74A 4CMHA 1JJBA 2QPOA 1ZJ5A 4JKIA 4R2LA 5TB5A 4AMBA 1JMYA 4OXYA 4GRDA 5IFLA 3WK4A 2YIVX 4MKZA 5IKPA 2VWHA 4PYJA 1SG9A 3ILHA 2WOJA 2OMEA 4Y9RA 1BHQ1 3GU3A 5JS7A 1LPAB 1EYZA 1DQSA 3RTGA 1FYXA 1R6DA 3K94A 4CKCA 1TADA 3IP3A 1AQLA 2WQZA 1GTSA 1L3CA 2G76A 3GJZA 1RJDA 4G41A 3UFXA 4EX7A 4TMTA 4RSGA 2XYVA 3E22A 5FJIA 5CAEA 2P9ZA 2QRKA 2ZB4A 1KMCA 2JFOA 2REQB 1X9GA 4TL7A 1DBIA 3Q6NA 4YB8A 1EDOA 2D2FA 4PF1A 3COYA 2I6FA 2P9JA 1IATA 2X5JO 2OL4A 3CY6A 1D0IA 3JATB 1LDBA 1UFOA 5C1IA 3TSOA 3OJEA 1HDYA 1SC3A 3D5EA 3ZI7A 1B8VA 5CDSA 2F8TA 1N6LA 3LVFO 1ZC3A 2IYPA 5G0VA 3FUVA 2BMAA 3E5RA 4NAVA 2A0FA 6REQB 2B4YA 3PVZA 3GJTA 3P19A 5I9LA 5PGMA 2P79A 1PR4A 2YWEA 3I34X 4HRXA 1NNLA 1THMA 3NC1C 7AT1A 3LCCA 3BRSA 1JECA 1E9VA 1UKBA 1YB5A 2GUGA 3U4IA 4K6HA 1GAWA 4L4YA 4R51A 1GUFA 2XW6A 3ANNA 4YAEA 3WZ2A 4EJMA 3N2GB 1HORA 1DJLA 2JKVA 4G63A 4X7MA 4MQ5A 1SCIA 1EEXB 3JSXA 4JD5A 4W5WA 1OW3B 4LZZA 4MRMB 1B8NA 1MNQA 3EFHA 3H8JA 1SZCA 3BWCA 4WCVA 3WSVA 2OFPA 1OASA 2W6JA 3VUEA 3V00A 2QAIA 3AILA 2BGUA 2RHGB 3FRJA 4YGXB 2J3MA 4PINA 5JAIA 4WLEA 3T5PA 5H3CA 5EFZA 5HXAA 2I54A 2CN1A 3A9RA 4HQRA 4B0OA 2VHVA 5FR2A 2SKDA 3ZBPA 3W5DA 4NCAA 2LZ0A 2Q2NA 2R8BA 4HV4A 4EQ6A 5K7SA 4HDNB 1Q0LA 4BFVA 5B58T 5EMLA 1BA2A 4YAFA 1TE2A 1X0VA 5AJTA 2BLLA 2AOUA 1DKPA 4NCHA 2ZUEA 2ADMA 4BY9E 1R3UA 2ATXA 1ZMRA 2NQ8A 2DC1A 5L3QB 4C2AA 3ZUGA 2NTJA 4MVJH 4R1SA 1RXSA 3S44A 1N2CB 4CDGA 3S1SA 3G5MA 4IVQA 2GHQA 2W8BB 2M32A 3QELB 2HSGA 2Z6QA 5LQDA 2DQYA 2H2IA 5JSKA 1KTVA 1GHTA 1NP7A 3ZV4A 1PFYA 1UC5B 2H1RA 1CZKA 1UT5A 4G25A 1M8JA 4KMSA 3JWEA 3E5NA 1YL6A 2CXTA 1HG0A 2ZT7A 3D4OA 1E0SA 1F8UA 1JHMA 2WTXA 1QHNA 1UPBA 3I52A 4MV1A 3AEQA 5ALLA 3UUWA 3WSWA 2VUHB 5KUTA 1OFUX 1G7RA 3F3SA 2A58A 3VSAA 3CKYA 4MQ6A 2KWIA 4B3CA 3FPFA 1P1HA 2UZIR 2XUHA 3CUSA 4Y3UA 5KNBA 3VR4D 1KRXA 1KBQA 3BICA 4MHTA 1U2EA 4P53A 5AK5A 2FX2A 2Y1KA 2IXBA 2O2DA 3EDYA 4JYAB 2XCOA 2CNBA 1CY4A 1N1MA 4FNAA 5DTQA 2RH4A 1RQ2A 3GELA 5LA6F 4BC1A 3A26A 4GSLA 5AO9A 2EAUA 3V5NA 3JALA 3H9GA 4RWEA 2NVOA 4DCGA 3VZRA 2EARA 3I61A 2YL2A 2GTIA 4NDAA 3C70A 4H2DA 2HRDA 1CQIB 1NLZA 2OHIA 1IQUA 3A10A 1O6FA 4AZVA 1KAHA 1ZI6A 3IE1A 2HCBA 4KDEA 2OBXA 3Q4GA 1WVIA 5IZCC 2GN8A 3SICE 3ZWKA 4E6EA 2GBPA 1A4RA 1Z4QA 4K0KB 4ZVSA 1DBVO 1P61B 2AD1A 4FYYA 5EJ6A 4R2XA 4G23A 3ZWPA 4X8LA 5A03A 5AIAA 4EUKA 2IKQA 4IDAA 1H6AA 1U28C 3P45A 3NIWA 1L1FA 2PNJA 1V43A 5LP6F 2J32A 1Y9AA 3K9BA 4DNPA 3QK7A 4PZZA 4NXMB 3CPEA 3HL0A 4J4HA 1SB9A 5DXAA 1LW6E 1YUMA 2P5YA 4BATA 4QJ5A 1V5GA 2A0XA 2GWHA 2OV6A 4KEAA 1NXWA 2GPSA 1W581 2OKGA 3ZJ5A 2EOAA 1JG1A 1W9HA 1G291 3A9VA 2HLHA 2QZJA 2YBEA 1H1LA 3CF2A 3CVOA 3OCVA 2VRNA 1S2LA 2X76A 3KLBA 3N76A 1AMOA 1NNI1 2BZSA 3K53A 1OVMA 3HTXA 4KAXA 4PG6A 3TQCA 2GBGA 3DE5X 1YIOA 4Q9LA 4D4JA 1RXWA 3ZE8A 2HFKA 1U3DA 2PUJA 3MHPA 3CXUA 3SEZA 4HX9A 4QVKA 5E3JA 1MRZA 3BWXA 3E84A 4WNIA 4J4BA 5LU9A 5KPJA 1O94A 3IBTA 1LX7A 2BUCA 1KYWA 4UUQA 5CLLA 3BK1A 1XUOA 2AUNA 4QKQA 2CJYA 4EHFA 4W7HA 3KCNA 3TKYA 3F3YA 3X1DA 2XYHA 4Z53A 4MKRA 5KPDA 2IXAA 3LZCA 4F60A 1SC4A 1WE2A 2IPXA 3O4RA 5K6AA 1G63A 3TL6A 2I78A 2AG8A 1GGFA 2OBFA 2P2NA 3B3AA 3QLUA 5IAEA 3VOAA 4CL8A 2XTMA 4I55B 3CXRA 1KFJB 3C3AA 4CEIA 1FDVA 1DX9A 3EUFA 4KXQA 3B38A 5JZOA 3NGLA 4CIBA 1B1AA 2UYCA 2RGEA 5CX1B 1EVKA 3OTQA 4KVAA 5FTLA 3I0NA 1CJTC 1Y8AA 2F3PA 3R5TA 2OZVA 2OV1A 1CE8A 2GPJA 3BRQA 5AM1A 3C3CA 1CT9A 1PEYA 1SQ6A 1M6HA 5FPYA 1BX0A 2YIDA 2B0CA 3EOZA 3G2NA 3DKPA 3MS2A 1X14A 4LVNA 3MNFA 2R60A 1Q1AA 3H2JA 1XKTA 1SXJB 3MOGA 4YREA 3W5HA 4PR0A 2ZCUA 3OQ1A 1G6Q1 1G5IA 2RAFA 2W6JD 4FEGA 4GI2A 4BUZA 2V65A 1A9XA 2ODBA 1OYYA 4I8DA 4KRXA 3I5XA 4P7BA 4WHMA 1U81A 1TQ6A 1G64A 1VMIA 4FEYA 4AN0A 4XARA 5LA6B 4D98A 4M9ZA 1K3TA 5L6LB 3LRPA 2BMVA 2GKSA 3BFKA 3EULA 4RX1A 2WSSD 3RU7A 4G0MA 5BY2A 3PI6A 2X1VA 3DDOA 4FZ3A 2OBMA 1JAIA 4U5XA 3T7IA 3ZLVA 1TD9A 3CKMA 1L3BA 4PICA 3LF2A 4EKDA 1OI3A 1KY5A 4AQ7A 1YZLA 2HRZA 2H5EA 3D5QA 2XNKA 3QENA 3SE7A 1XQYA 4YDQA 2UYQA 3ZZ0A 3CEMA 3FPSA 4MUKA 1QHEA 3O38A 4JASB 2V4ZA 2HHHB 4AUNA 5I5EA 3QVVA 1FFGA 1UWKA 4TVBA 2Y71A 2OQVA 5GADl 2ZWOA 4LOKA 3ZHTA 5ESXA 1A1VA 4FMCF 1X7XA 3OF3A 2AMLA 4HC4A 2HSWA 2DPGA 2W11A 5JANA 4ZCLA 2Q6IA 2C2WA 3SJAA 3ONNA 5K3CA 2FOLA 1J21A 1V5EA 3KKKA 3KVNA 3UFXB 3V3TA 1ZKMA 1Z0UA 1PFUA 4OXQA 1LPMA 1GD1O 1KYXA 1YI0A 3WHLA 5J4KA 3NAGA 2G1AA 1GCOA 1GV0A 1XQ9A 3L5KA 4NHEA 2ZS8A 3AHJA 5L3SA 4P82A 4QTYA 1PO7A 3QWIA 1BVRA 3UJ6A 1EXMA 2PUFA 2IEDA 4QGBA 3GUVA 1X7WB 3FMGA 4TTAA 2YUIA 2QMZA 1G3QA 4XJXA 1C8LA 1O96B 3NBFA 2GZMA 2X7JA 5FTJA 3M70A 3RRNA 3VNSA 1Y42X 1YONA 3JQQA 1A9XB 4HFNA 4RM3A 5F51A 5AI4A 3JQFA 2RGWA 2DUUA 3AEKA 1C3EA 2FMKA 1DCMA 3UTDA 4E12A 3KALA 1QMGA 4X1KA 3CJQA 1HRDA 2GXQA 3P4XA 4U00A 5L40A 2G8NA 1D09A 5CFLA 3UW1A 3LM8A 3GPIA 2CUKA 1E2HA 1ZGHA 4EVQA 5EUCA 5FR1A 1PJLA 2NACA 2DECA 3AFMA 4B4WA 3R7SA 2WKWA 3E5HA 5MN6A 2DH6A 1C3OB 1D3AA 3LOUA 5KYGA 4I1VA 2NNWB 4DLXA 3GT0A 1B8OA 2R1VA 3T5TA 5DTRA 1ZM2A 3AR7A 1TB4A 1YQEA 4M0DA 4I14A 4UFOA 3QOWA 2C84A 4QUDA 5EIOA 4QLAA 5CVTA 3AUXA 3I3OA 1A1SA 3Q7SA 1REQB 5C8YF 3KHTA 4LJ9A 2P69A 2D0OB 1EHIA 2C57A 2GPNA 5FOXA 1L5SA 3CKKA 1RYHA 1TT5A 1NLYA 3JZMA 3DT6A 3HZHA 4J03A 4UEWA 5FWAA 1GPDG 3Q9NA 2C8LA 3EFOA 2AFHA 4DYDA 4F4UA 3LI2A 2CCKA 4D1YA 1U0JA 4XB6B 4BUCA 4L4XA 4YAWA 1Y5IA 1I7QB 2DY1A 2W70A 3RSHA 1CRPA 1NXOA 1G8HA 5IMSA 4DLVA 1PQPA 3AVUA 3K0AA 1H3NA 4Q00A 4YUVA 4E15A 3VR5A 2OC9A 3O26A 4CF6A 3DSRA 3NBYC 2ZE6A 4US1R 3EQ9A 1ZUD1 1S5PA 2IV7A 3O1HB 1NVVQ 2FWBA 4UZSA 3TIGA 4DV3B 4MS1B 1T5SA 4KLZA 4IVPA 1Z6YA 2IITA 4NFHA 1E96A 5E7IA 5LZ4A 3KJIA 2HA6A 4D97A 2QJOA 1FFEA 2VJBA 4HD8A 4XYBA 4GGMX 2PBLA 1JGTA 3IAUA 3T1OA 3WIOA 4XVCA 1XV5A 1XA4A 2AS0A 3KD2A 4HX2A 1P2SA 1CVLA 4BVLA 2VSXA 1RSZA 3EAQA 3K9QO 3TX6A 1L4GA 1K8ZB 1L7RA 4RZ2A 4WGFA 1EFVA 1NAIA 1W8DA 1NW6A 1YZNA 1YGYA 3PC8C 4EELA 2BTQB 1VHLA 4NBWA 5LDDC 1A8IA 1JDUA 2JEZA 4EQZA 3V1KA 1J0BA 4BMVA 4ETWA 1GNVA 4D3SA 1RC0A 4NCKA 3IB3A 5IDXA 4DV5B 2VCHA 2F8LA 3PC6A 3SK0A 2HK8A 3MRVA 5AW9A 1EUQA 4B45A 1KDRA 3LPLA 4RCZA 3RABA 1QHHA 4DQ0A 1PVVA 3OIGA 3WGIA 3ZWCA 3PXAA 5KTYA 2Z8YA 1MB4A 2LXNA 2NO1A 3ESDA 4TWJA 3UJ3X 4MQEA 1IN6A 1GSOA 2YNMD 5JOQA 1NUQA 3GRPA 3H16A 4S1NA 4ROSA 3GFFA 3EFOB 3KOUA 1UDXA 2ET6A 3MC1A 3ZVRA 4ENTA 3JD0A 1R6TA 5FBVB 2XTNA 4KPEC 1U7DA 1RR6A 4A26A 1I3NA 3II6X 3RVPA 2OMKA 3BQ9A 3WQQA 4DIDA 1XTQA 3C98A 2V1UA 3SS9X 4IF6A 3G9UA 5HS4A 2HQOA 2BP7B 1T5HX 1BGVA 1QIHA 1WB9A 4FFMA 1LX6A 2HQRA 3ZX4A 5DXFA 2RHJA 1CDZA 4RSHA 8MHTA 4BVGA 2QL9A 1O4VA 2ZYGA 4A9AA 5KIAA 1HKUA 1RWPA 1BWQA 2I1VB 2PX6A 2Q5EA 3K1AA 4DEVA 2NXWA 5K8IA 4N47A 4CM8B 3ZWVA 3KWMA 1WSWA 1BYUA 2G17A 3HS3A 4ZAXA 4YP7A 3VVBA 1R6BX 4CM6A 1BO6A 3LIPA 4EO9A 1RHMA 4MTCA 2NZ8A 4JB8A 1NMYA 1Y8QB 1NVFA 3FZEA 3HL4A 4MZXA 3WDSA 1JW9B 3N2KA 1QMPA 3D81A 4IBOA 4DQUA 1CC1S 1U6IA 1JKMA 1JHPA 4R0MA 1J1UA 4CG2A 4HUQB 4Q1EA 5M34A 3UWMA 5C9ZA 1VIAA 2CXHA 2HXSA 3NUQA 2FPLA 1N25A 1SKQA 2WAYA 3OZTA 5EGNA 3K16A 1EK1A 4U3JB 3EDCA 2C9OA 1VSBA 1U90A 3E1SA 2PA3A 4QUJA 2IHZA 5FOWA 3VNBA 3B1VA 1GZ5A 1OFIA 2NUPB 2C95A 1J00A 3DFUA 2VVTA 2POQX 1BKDR 1ETUA 5A1TA 1IVSA 1LU9A 4HSEA 1HNWB 1PZFA 1Q17A 1LDEA 1RLUA 1W49A 1UZUA 2TMYA 5FOTA 4QC2A 2ZCJA 3QYFA 3CO5A 4MQEB 2Q4DA 2OPHA 4I99A 3WKBA 3D3EA 1GFWA 1RMTA 2QRUA 3Q7TA 2QF7A 4ILKA 1AKNA 3UC9A 4YXFA 4QWWA 4K9MA 1TC1A 3HCRA 2FG7C 3JVVA 3PT5A 4OH1A 4DLUA 3U7FB 4Z3KA 4JELA 5E7JA 3CBQA 1EINA 1L4FA 3B70A 3NJ4A 3QZUA 3VMFA 1RWQA 1RKUA 2C0PA 1FUUA 4JVOA 3QXGA 1E1LA 5GV7A 5FWYB 2BM9A 2Q5IA 1B76A 2ZSUA 4OUKX 4ZQBA 4HDAA 1CUVA 3KYDA 1EE2A 1V1JA 4DB4A 1T5TA 2A1UB 4RJKA 4BDSA 4XCXA 2BGTA 5BNWA 4MPRA 4DLAA 2OHGA 2IE0A 1MIHA 2HDWA 3PKZA 5M3BA 1PAUA 3GLHA 3LF1A 1TVEA 1RQPA 4G26A 4LYEA 2H8GA 3UQZA 4F5WA 1YIDA 4C4AA 4H17A 1J33A 3COZA 3CZ4A 1G6KA 4PQGA 3L92A 3TZQA 1M2VA 2ZRHA 3BKXA 4CN9A 1OFHA 2CLHB 4D4GA 1TO1E 5BNTA 4L28A 3GJXC 4L3OA 1O95A 1P29A 1XTJA 1T0PA 1P4GA 2X77A 3DVRX 3FN4A 4ITRC 3X3HA 2JJ2A 1GG8A 4YWHA 3V32A 2R6GA 4H6XA 5KMGA 3MWFA 2XTJA 4RO0A 5JO0A 2XMGA 3WGGA 4MS3A 2EL9A 3IV9A 2RGYA 3O9VA 3RYTC 4D3FA 3WYAA 3FH0A 3KAPA 2CFIA 4DCMA 3VVMA 1OY1A 3NBUA 4AAYA 1N6RA 2VP4A 1J5XA 1REQA 5D5PA 1VE7A 4I9FA 3TNDA 1DU4A 3M9XA 2ZR8A 2CVOA 1TT5B 4DV4B 2Q5QA 1CX9B 2IUTA 4FI3F 5JW6A 3WNZA 4NBTA 1YI1A 1SKYB 1HDEA 2YV4A 4MO2A 1W47A 2HXGA 3M89A 4BVJA 1P19A 3AGPA 2WFLB 3E18A 5IUKC 2JCBA 2QRVA 4JLWA 4RK0A 2XMBA 1M7HA 3EXEA 4X8OA 5CDFA 4TL6A 1Q84A 3H4TA 1A72A 2VDOB 4L75A 2WHPA 3T1VA 4BX3A 1UMCA 2WZBA 2CLIB 1QWOA 3F6RA 4RADA 1FVOA 4YUZA 1OFVA 1XNQB 4NMXB 1PLKA 1FXWA 1QR6A 3QY9A 5GZ1A 4WBNF 5KC8A 2H31A 2WWRA 3OCYA 2QQFA 2H1SA 2BFWA 1DAFA 3LXRA 4GICA 2C8VA 4ISBA 2I2WA 4Y6SA 3T1QA 3T54A 2QTLA 1CUSA 2Z58A 3NYRA 5GMOA 3R7LA 1GG2A 1PHPA 3VJLA 1K7EB 3DE6X 4QOSA 2O54A 2V7BA 4INOA 4J0JA 3NEYA 4QSHA 1DIGA 1EJ2A 2CLLB 3EGVA 2FZEA 4IEIA 3SQXA 4YP6A 1UKCA 5A7HA 3KWLA 1K6XA 1Y6ZA 4UTVA 3TF5A 2J9FA 3GUUA 1VGRA 1PS9A 2WJGA 3QX9A 4BP1A 4F97A 4K9KA 5CG2A 1M8PA 3DHWC 1VLMA 2CEAA 3AIOA 1Q22A 1IY0A 2BLNA 4NL4H 4PSUA 2NADA 1D7AA 5C1PA 1ZICA 5A4KA 4BN5A 2FSHA 4BVAA 3B3FA 5CD1A 4FOTA 5BSTA 3PX2A 3U9SA 3KVRA 3FI0A 3MGKA 2H6EA 2GCOB 4NBUA 4PU0A 1OZFA 4I5EA 1KAOA 4CCWA 2HT1A 1B0UA 1IBMB 4JVSB 3CPHA 4LSGA 4B4KA 3G2PA 5JCJA 4XVQA 4QOIA 4CV1A 3TDKA 2I55A 2H4JA 2PRSA 4I1YA 3K8OE 4HK4A 4ZPXA 2NYUA 2Q6LA 3GH3A 1OTXA 4YN3A 3M3DA 2XYQA 1DBPA 5ILOA 4B81A 2AFVA 2LDXA 1SEPA 1WTCA 3DHNA 5HF5A 3NDBB 3IDAA 4BVKA 1IOLA 3ZWNA 1H2WA 1VJTA 1XSEA 3V4RA 2BP7A 5KC9A 1ZIDA 5IANA 1ENZA 5INTA 3W2EA 3KKZA 4U7HA 2G9RA 4I1IA 2GRJA 2CLSA 1KVUA 1KDPA 1PDVA 3GEBA 3NEPX 3SHWA 1NVEA 4AJ2A 1FIUA 4LX8A 4HMPA 3L6OO 3UPTA 1P7PA 4ZT5A 5IUNC 5I9SA 3KQLA 3UHFA 5JXJA 4J0DA 4EEZA 2NO5A 3FYTA 3ABRB 1T1EA 4IIFA 3U80A 2JL1A 1PUIA 1H9CA 3AY0A 4UOQA 1V16A 1KVQA 1XRMA 4HUQA 4DBLC 1YS7A 1G17A 1OSNA 4RM2A 1I1OA 1YBHA 3LWZA 1HLGA 4XQ9A 5F3DA 4FOLA 3E3OA 1MO3A 1EEHA 1FF9A 4UJ5A 1RZRD 5TLSA 2I3ZA 1JBQA 2HV9A 2ICAA 5H3HA 4I81A 1LDYA 1P72A 5T6MA 3UJAA 4MVJI 1M7GA 3WWCA 3R7WA 3EY4A 4B4UA 4E70A 4Q1BA 1BTOA 1EK6A 1YB7A 2QMHA 2JRCA 3KUDA 1CR1A 5DX1A 2P4EA 5AVZA 3NW9A 1XPRA 4WN3A 4R3UC 1UP7A 1XNGA 4RE5A 5KVSA 1YCHA 5JCOA 5TNXA 5TF0A 2ZRGA 4ACAA 5CFOA 3TAUA 1O5OA 1DQNA 3R6GA 1QGAA 1X87A 2JH9A 3AFGA 4BV9A 3FCAA 3AOEC 1WVGA 3DR3A 3DVSX 4R41A 8ATCA 3CLUC 2BFCB 4K9LA 1QGOA 4KXLA 4V02A 2VUIB 1ND5A 2AFIB 2KE5A 2BI4A 4GSKA 2QE7D 5IAKA 4OVKA 2RSLA 4W8OA 3WMXA 3ZDZB 1UZLA 5BWCA 4L85A 2HJSA 1L5LA 4ZOBA 4EW3A 3KPVA 2UXDB 4DPMA 2IBMA 3AO0B 4G4IA 1PT6A 1R6XA 2RBEA 2C5AA 3KHUA 3U4CA 4BVFA 3G2HA 3NPMA 4A8TA 1L4EA 4J1TA 2HO5A 3SKXA 2C1ZA 4GM0A 3ZX5A 2PL5A 5CW2A 3O8OB 1JWLA 3CNLA 4XIGS 2W2OA 3R9XA 3DWFA 3RUCA 2C94A 2VNSA 5J59A 4ER5A 2VYVA 3PWKA 4CTKA 2HKIA 2R1VB 5B4UA 4LDNA 1YB2A 2AF4C 4S1TA 4MIYA 3UK0A 3A1WA 3FOWA 3WNQA 2HLNA 1F0YA 1X70A 1KY2A 3TMAA 4ER7A 3L0YA 3HB9A 1K8RA 1W96A 1K68A 4J8PA 4FBMA 1X1RA 5TMEA 2IYWA 1BA3A 3FUUA 3HB7A 3K5IA 3OA2A 1O6CA 1T8RA 1K4MA 4LK2A 2VCYA 4JLJA 1PFVA 3IUMA 3L1JA 2FZLA 2ODTX 3QBVA 4GVLA 4PQRA 1Q0PA 2ZRNA 5BYAA 3PCXA 5JJKA 1JVBA 3DTVB 5JCXA 5KWIA 1H0KA 1HYHA 3UB3A 1OVGA 4WIAA 2FRDA 1WEHA 2GPBA 3L4SO 2C5LA 1E59A 1OKKA 5LB2A 1U3GA 2BIFA 2DPLA 4C0JA 4LY9A 3F6EX 4OU4A 2A35A 2AJTA 3NC4A 1IXRC 4YPFA 2OGSA 2WYHA 2HHAA 2UU9B 4L4SA 4FQ5A 2WMNB 1U8FO 4O1IA 4COOA 3OI7A 5CCBA 3OZVA 2Q3LA 5K3EA 2PLFA 4PLTA 4XPIA 1KNXA 3SU8A 4KHZA 4YALA 1EZZA 1T4MA 4I4TA 5ALQA 2RBKA 1WULS 4ESOA 1T9HA 1M2VB 5DIFA 2DAPA 2WHEA 4AZ0B 3GAMA 4W5TA 1F0PA 4JYMA 3HHEA 3WMGA 4ALKA 4CGZA 4BEJA 1X8JA 1XTUA 3PFWO 1E2MA 1A4IA 2JI8A 5HCIA 1UPFA 2ORED 2VJMA 3F96A 1D7OA 3RVBA 2ZJOA 3H83A 2QUIA 1SZJG 5E6SB 2BHLA 1J8FA 5IM5A 5I47A 4NXNB 4EENA 1JU9A 5JUWA 1JEQA 3HY4A 4XWYA 5FBQB 4JUDX 2HM7A 4H18A 1O9BA 2Z5VA 1OX4A 5TQ2A 1R0SA 5HE8A 3M6UA 3B6KA 3ZXYA 2C5GA 3P5SA 1AA9A 4KVFA 3PYXA 1HE4A 4D26A 1XOIA 4PX9A 1P60A 2X1LA 3RF7A 4FHFA 3E70C 4XQGA 2O3RA 4P32A 4EQ6B 1TYCA 2I7TA 1IN7A 4G0XA 1XJWA 2JGFA 2YWXA 2C04A 3EXFA 3CVUA 2GEVA 2P2CA 2VATA 4OM8A 5ECYA 4CLXA 2WUWE 4FT2A 2XUOA 3QWBA 4XVUA 3B1ZA 2CMGA 3KKEA 4P3PA 4L9SA 5BVGA 3C39A 1XEFA 3ZY3A 1JQ5A 4DA8A 3C16C 3PS9A 1I13A 4MUNA 3KYIB 4R7ZA 2RHWA 4E07A 4PYMA 4HLNA 4A1FA 2BSXA 1K5HA 5BQOA 3ZZMA 1WZ2A 2LTAA 4UARA 3TOCA 2VRCD 4IGEA 3Q7RA 1G20A 3HDGA 2QX7A 3CRVA 3FVTA 4YAUA 3TZ6A 1GNQA 2W0MA 4J16A 5JEDA 1RPNA 4DV2B 4LVOA 5I8ZA 5FLEX 1NRXA 1Y9ZA 2QG4A 3N2KB 1YJ8A 2CLKB 5HF8A 3ACCA 1V96A 3EHEA 3MCTA 3ESQA 1LLQA 4QEZA 4S35A 3MWYW 4GECA 4KRYA 3FUXA 5MFZA 4KIGA 1ZBQA 2V7QD 2F55A 3C4JA 3L01A 4NR0A 3CB2A 2C99A 4K6FA 2NUBA 3BB3A 5DE3A 3W7VA 1EZ1A 3KR1A 3T12A 2HU7A 1I51A 4UTRA 4DQVA 4CUJA 2AKYA 4R4JA 5A0TA 2FCAA 4Q3EA 4BKMA 5KEIA 3F8TA 3NAMA 1SHLA 1Q1ZA 3WGKA 1E2LA 4OHKA 3ZE7A 1QF9A 1LJ8A 4FKBA 4RK7A 2CCGA 1UMBB 3FPCA 4M1ZA 3AVYA 2YKGA 3C5EA 4PNEA 3C7KA 1M66A 4EWLA 4FYJA 2IHVA 1PFQA 4QA9A 1N5IA 4YT5A 5KX5F 4P0TA 1QV7A 2RI0A 4B6SA 4RA6B 1IN5A 1PS8A 3AV3A 2GAIA 5H82A 2FWMX 5JSZA 5L3VA 1CUYA 3FJOA 1S89A 1OXSC 5CGZA 2FKNA 5B58C 2FCRA 2P2YA 2J31A 4EUNA 3JU3A 1XTSA 1NLMA 4UAGA 3OU7A 1WY5A 3I30X 5I51A 1WEKA 2D0IA 1NYLA 2PT5A 3F3KA 3FVVA 5FV7A 3UJPA 4KBFA 4MV7A 3EEBA 4R8KA 4LYHA 3L18A 3ZVMA 4DB2A 1D5CA 4F6CA 4ARUA 1U8EA 1NQAO 3Q8WA 4RGVA 1XLWA 5JD3A 3GZNA 2JAQA 3DMFA 3O95A 1T10A 5FI5A 5GV8A 3WLJA 4AX8A 4K3UA 4OBWA 3ZJVA 3K9CA 4WA7A 1UP6A 1W52X 2H52A 4D44A 1Z2DA 3L8DA 5IBPA 2GZ2A 1K8YB 1KEKA 2JFUA 5C1DA 3ZGLA 4EIWA 5LIPA 1CG6A 3G2OA 1R3DA 2GBCA 1KERA 1LBIA 3IAHA 5BUZA 3UMSA 3H5VA 4MVJM 3BFXA 4EMUA 2M6SA 4YA6A 5KWEA 2WMOB 4QJ3A 5DWVA 5LBIA 5K6AC 1YI8A 2CHUA 4FT4A 4R7TA 3VSCA 1L4MA 3MJRA 4R7GA 4PAQA 4OPMA 1J42A 4US0R 4FIZA 1L5WA 2OZKA 1N2HA 1OAKA 1T36A 2QR5A 5EXSA 2QR2A 2AMJA 2WSBA 3LP5A 5EHZA 3EIFA 5COBA 3SYTA 2JPDA 1NU6A 1G0NA 1TU0A 2SNIE 1Z12A 2ZSHA 3QYJA 3OCUA 4RVUA 1ZC4A 3LDHA 1DC6A 4RFLA 4XLTA 3VOSA 1KF0A 3CPSA 3AVWA 2QMUA 3P4UA 4YAOA 1LPSA 2QM7A 2ZDHA 3HE3A 1J8MF 4CEJB 4R5MA 1TTTA 4GYYA 1IUPA 1QGUA 1CY2A 4DR3B 3HDJA 2AYYA 1EWYA 1FYEA 3EXIB 4HO1X 1AX9A 1KSHA 4UM7A 1G2IA 2P3QA 2DB3A 3KB1A 4DIUA 3QU7A 2Q8QA 3H3XA 5EQTA 1OIWA 2AR0A 1I6WA 2VYQA 3Q6IA 2XB9A 3I32A 2EHJA 1JEOA 4TKMA 3UGKA 4WXEA 4CL2A 3ZNOA 3B89A 3B52X 3O03A 4X8HA 3TYXA 2FVYA 4CLOA 5FPSA 4WADA 2O3UA 3ZTTA 3W7BA 3QPWA 2QUAA 3K5WA 2QRPA 4B74A 4DCOA 4PGFA 5TQJA 4G5OA 1J9GA 1N0VC 1QTIA 1TVKA 4HTFA 4REOA 5FPTA 4HLUA 5IAOA 1XPOA 3NTUA 2BKXA 3UHAA 3HN6A 1TW3A 5D87A 5CVEA 3RV4A 5FLXA 1BEEA 5KSOA 3GC6A 2IZ7A 3WJ7A 2EQ5A 5AOCA 4EPRA 1G5PA 1U28A 3BCRA 1KH2A 4CZ2A 3KO8A 3MJFA 3THXB 5BYJA 3F5FA 5KTPA 4UM5A 3QV1A 4DMCA 1CY0A 1CS4C 5H0IA 1YDFA 3WJ1A 5BMVA 1NVWQ 4YRQA 5F77A 4L22A 4DZTA 5I7UA 4IZIA 3HVHA 2AYXA 3H0CA 3ADDA 4GLBA 4N4AA 4N5IX 2GEJA 4XD7A 4ZAGA 1WD7A 2AEFA 2Y4OA 4HDQB 4IH4A 1Z4PX 3IQFA 4GVXA 4YDRA 3ZZTA 4ID9A 4DYHA 5JAZA 4WINA 3T9DA 1USIA 3Q3CA 4H7PA 4WZ6A 3X44A 2W37A 3GIWA 3RSCA 4ZALA 2JASA 3BERA 3GLHE 2MT9A 3ZXSA 2XCSB 3JWHA 4AMZA 1FUIA 3PSHA 4Q7MB 2PAAA 3R44A 4GYWA 4PXSA 5TT1A 3IKTA 3EC7A 1L9KA 4M8KA 2BF7A 4PLFA 5TV2A 2E4UA 3DVQX 4AY3A 4AZWA 4NY1A 4D56A 2Q9BA 2ZJ2A 4LWZA 4ODIA 3H9JA 3ES9A 4ALIA 2SKEA 3I09A 3PD7A 4N5HX 3ANXA 1I32A 1WABA 2GJAA 2BE9A 5ALHA 3I4FA 1BJRE 4NK4A 2E2WA 3LK7A 2DT5A 5F1OA 1AKUA 4XLZA 1K27A 3UKDA 1QHXA 1WUJS 2EW8A 3K0SA 3ZVNA 3S2FA 3V1YA 1N78A 4HQLA 5B64A 2GZAA 4EKIA 2BISA 3QIAA 3QA9A 2IRWA 1T8PA 3TTVA 3M6AA 1A9QA 1RI5A 1VIDA 4NNJA 5EG5A 4LE1A 4IIUA 1FQKA 4V2IA 2H54A 5FBHA 2D1RA 5K0ZA 4E11A 4MDEA 1CIPA 2IH4A 2AFRA 2CMFA 4IJWA 4WLNA 4A6PA 5J2TA 2O5EA 3ZZ1A 2FEOA 1PX2A 3J81k 3KQTA 3Q8LA 2PKEA 9LDBA 5D3MB 4AL4A 3D59A 4EHLA 3T1TA 4PIPA 3EVFA 1MQAA 1NI4B 3V7WA 1Z4JA 3MBIA 3RR2A 3JQ8B 2B8NA 2JIOA 3W8NA 1GUAA 1JHYA 3KQOA 1WDLA 4X41A 5A6VA 4Y1FA 2QRJA 3ZJYA 2H7CA 5ARCA 1P91A 5K4HA 3CUEF 5BMVB 2OP0A 4OLAA 4L74A 3ANTA 3PZRA 2ZIAA 5J5CA 4ZANA 3N3BC 4F3NA 4ED9A 1K8XB 4EA7A 3G0CA 1GRVA 5HKKD 2Y77A 5ALFA 3RW9A 4XUCA 2X9VA 3DMYA 3QWAA 2HN9A 3A2NA 3QFCA 1DC4A 5IMBA 1E9EA 4X71A 3O7MA 1XYGA 5H02A 3R5SA 2JAPA 2Y0BA 3IKMB 2R5FA 3WZMA 3OFKA 4S1OA 4BU1A 3EPKA 3AR6A 5CT5A 1VYUA 3WHKA 5LZ8A 4CMKA 1ICIA 1T8WA 5AUQA 5IZCA 3ED5A 4IJKA 3LY8A 3PNLA 5JECA 4B6RA 3DD5A 1PTJA 3AHIA 3SNHA 5K0BA 3AKDA 3PR2B 2CE2X 3QU4A 4QBIA 4JT4A 1XRSB 3D6VA 4IH1A 4GL4A 4L9AA 4A8JC 1PQ4A 1SQGA 1QAOA 2P9TA 2DU8A 1BVHA 1KEZA 3PF9A 3TLMA 2O48X 3B1KA 1Z33A 1JT2A 1B6SA 3FLEA 2NIPA 4U9HS 4YRJA 3BEDA 1QCDA 1QDLB 3TZKA 4UZEA 1FPMA 5DM0A 3I2HA 1SIWA 3QOXA 1SUFA 3LGXA 3HBMA 3T7AA 2GK6A 2HGSA 4GBMA 4ZC1A 4Z3DA 4R3WA 1R64A 1Z6PA 2BPOA 2FWPA 1XZIA 2IOFK 2V55B 1QHIA 3OFJA 3IPCA 3IT0A 1ESNA 3QUCA 4JHXA 1ZVJA 1LB1B 1QHHB 4LHVA 1OI7A 4A27A 4CG0A 5AFSA 3QKWA 1NBMA 2WKPA 4D8VA 1FJGB 3R0QA 3HXTA 3R3ZA 4HGOA 3EXG1 2X5OA 3H97A 3FDZA 4HH1A 4ARZB 4B84A 4DE5A 1I7SB 1V41E 3IVRA 3W1EA 2G5GX 1CUZA 1T2AA 1CP3A 1D0SA 4GPD1 5KS2A 1VHQA 5C4GB 3ICEA 2CHQA 3FLBA 1EE9A 2AOUB 2ZAOA 3U3KA 3ZU2A 2VXBA 3QKUA 4FMPA 4ZI7B 1W19A 1XXHB 4MJLA 3L8EA 5C5EA 4P2GA 3QX3A 1IY9A 1P4AA 1C7RA 2FW1A 3LC1O 1WTAA 2ONJA 5L3QA 2YNMC 1CY1A 2C2HA 2WLTA 3AUAA 3AVQA 4J3JA 4NJEB 5AOBA 4B47A 4Z54A 2EL7A 1R0CA 1Z0KA 4G86A 3KV1A 2PQ0A 1K6IA 4I1OA 4KQHA 2ZUDA 1A4XA 2LKDA 4NSNA 1E94E 3ICWA 3K0BA 4L95C 1JZQA 2QN6A 1R12A 3BOSA 1U7UA 5CEFA 1SVIA 1J1IA 1WPRA 2HWWA 2Q29A 2C3OA 2Z2IA 4GDMA 2GK3A 3DQZA 4A8JA 4G89A 1E1CB 3CUKA 1SN7A 1YNSA 4II7A 4NU8X 1XZGA 2YUTA 4YRMA 3MMSA 2C3UA 2P2SA 4OKIA 4Q1CA 1XMOB 4M8IA 5FAKA 2LRHA 4V3CA 3MAJA 5LXTA 1DMSA 1DEKA 3I9JA 5ERXA 3GFOA 2R8OA 1MX3A 1PV1A 3FVWA 3C14C 4WV3A 4FK8A 5DLDA 1XWWA 3NNDA 4TL9A 4GR9A 3RQSA 3DL7A 2JB9A 1NSFA 1JJFA 4Z4GA 1XDSA 2OB2A 3AY7A 1TIPA 1DSSG 2WU3A 3NHFA 4F3TA 4RK6A 3NTQA 5DRTA 2PEYA 1M6WA 5CXUA 1HBJA 2G07A 5FWXA 1KU0A 2ZYHA 3ASZA 5CT8A 4ECAA 1H94A 1VL6A 1Z2NX 3UMGA 3KKQA 2J09A 1NVMB 2HJWA 3NAQA 4RANA 3EBLA 3GARA 3DFZA 4R6XA 3LRTA 5JQWA 3F46A 1GPBA 4GZMA 1PJ8A 2AIRA 4DABA 3F47A 5HBRA 1XRRA 4WBXC 1URPA 2XCUA 2ZSBA 3K05A 3OFSA 3P2OA 5DU2A 4EJ0A 2VZEA 1E1DA 2NO7A 1UBHS 3EK2A 3B82A 2EFJA 2WQ7A 3EUAA 3WO0A 4F4JA 2O4CA 1NF8A 2VWGA 2FFHA 2ZT5A 5KDLA 5KZMB 1PYDA 4I4TF 2B69A 4DGQA 1DHTA 3ZDFA 4QUKA 2IX9A 3U48A 3RKRA 4ZICA 2W98A 5JDIC 4RQTA 5EXEA 3TRHA 1NKTA 1Z5VA 1GAQA 3IBCA 3JVUA 1QPGA 4FR0A 2ZYUX 5D7NA 3R5KA 1I0ZA 2FKAA 1BVUA 1C2YA 3RUFA 1VLLA 4DUGD 1C1DA 2W4QA 1DEHA 2IYXA 4A0GA 1MVOA 1DWUA 5JAUA 4Q19A 1QVZA 1MZPA 3I1IA 4H1UA 3PEYA 5CJ2A 3VHLB 2GXUA 2Q5HA 1P80A 1AK1A 1COZA 4DLRA 1DMRA 2WVAA 2OHJA 2CFCA 3SLRA 2V3CC 2YS6A 1C81A 3T3OA 2C4HA 2YOHA 3RS7A 3BL5A 4F4HA 1XZ8A 3UA3A 2WHYA 5DRYA 1OYWA 1RT9A 3RHZA 1G20E 2K2WA 1P9RA 1PG2A 1XMXA 1ZISA 5KQMA 5DIZA 1XDBA 2Q8PA 1LTHR 4K0RA 3Q3EA 4EG7A 1B93A 3THXA 4LSZA 4ZIRA 1UDRA 3RVSA 1KIMA 3IPAA 5C53B 3OHPA 5KQSA 5FI1B 3FHTA 3FRHA 5DYGA 3SKYA 2XRFA 1QB7A 1RWNA 3ZW9A 5JATA 4NMLA 2QL5A 2OO5C 4CNBA 5CIWA 3T0IA 1APBA 3F90A 4R8RA 1ZBDA 2ORIA 1J70A 3FLMA 4LFCB 3OX1A 1NA5A 1DTWB 1D03A 1RQRA 1X86B 3GJ8A 3PIDA 3GI1A 3UH1A 1ZD2P 2P30A 2CFOA 1YQTA 1G8FA 5DCWA 5KHOC 1RYEA 3PFHA 2QJRA 2C31A 3DB1A 4I9UA 4JGBA 4MW0A 1D4OA 2C8KA 2N1BA 4KBYA 4XQ0A 4A91A 2PRIA 2XMSA 1HUQA 2WA2A 4ZOLF 1ZVVA 3OG9A 1J8DA 2GLTA 2WT8A 4GOND 4UU1A 3TLCA 3ZHXA 1FP2A 5LU8A 3DS8A 3NBKA 4HDRA 3K6SB 3NYWA 4A0RA 1RHUA 1WHSB 4JH0A 1MAHA 2QIOA 1JB9A 1NASA 3QVJA 3I2IA 1Z4LA 3M2PA 1U3UA 4GKVA 2P6RA 1PDWA 5DTEA 1UBRS 3Q0IA 3LUPA 4Z9YA 4YXWA 2BMEA 2GBIA 3ZC3A 4XIIA 1P0MA 5DYTA 5KVAA 2QD4A 1MT3A 3B6EA 3QWFA 2GASA 4JJ4A 2O3JA 1GQQA 2C1EA 2DGDA 3JD2A 1RKXA 3E3NA 1WUIS 2ZYTX 5DH9A 3ZXIA 1P0QA 4BKQA 2BFEA 3T99A 1J39A 4IQ4A 1MDFA 1UMDB 3W9SA 3FF4A 5F9HA 1B14A 3C1TA 1PNVA 3KPWA 1E8DA 1ULTA 1YE3A 4JYPA 5BV0A 1C7ZA 2O7RA 5JSHA 3F5SA 3K0EA 4BNJA 4YHHB 1B23P 4DQDA 2A1TR 1IXZA 3RKUA 2NTVA 3GRUA 1BEZA 4YRIA 2NYVA 5H59A 4F3KA 3COSA 3HDQA 3KTFA 2J3EA 2J6IA 2ZVDA 4OLJA 5JT1A 4RY2A 5DNDA 4EPVA 5LLDA 1LFAA 4TTVA 3RSOA 1XHLA 2PRKA 1ZWKA 1NM5A 5EJ9A 5H9WA 1RU3A 1H1TA 4W1QA 2BFDB 4DV0B 1ZN7A 2P2DA 3IPXA 1Q7RA 4D9EA 1N2IA 4BGDA 2NGRA 2P4UA 5DYIA 2JBAB 2IYOA 3G0GA 3JZAA 4DLWA 2PO5A 3P94A 1MBZA 5KYYB 2GTHA 2PYDA 4YJGB 3W5JA 4M36A 4MB6A 4Y2HA 1S3IA 1Z0FA 2I1WA 3OEEA 3JRWA 3LE8A 3W7AA 1UJMA 1MVLA 4WKPA 1BXRA 4MR7B 5KCZA 3CH5A 2Q5LA 2C9DA 1OXKB 3JYLA 2Q2VA 4LCEA 1JLHA 3JWGA 2EATA 2IQ5A 3IVCA 2YYSA 1BH6A 3FMFA 4OQZA 5FOUA 1U5BB 1CDOA 4A8JB 4Y2PA 1W85A 4M1YA 4OI0A 4XR9A 2AWNA 1OGIA 1RM4A 1MXHA 2QSZA 4D8XA 4MAMA 1PZHA 1XCBA 4MYUA 1E7SA 4D7AA 3F0TA 4MI3A 4ZCRA 2CDCA 3LXUX 1Q6YA 1YU6A 4JDUA 4DY4A 4QBTA 3M4XA 1TCBA 2XUAA 2Y27A 4GLFA 1TRHA 3FB1A 4M7OA 3EH1A 2I4IA 2RBGA 2XUKA 4CR7A 2V6IA 4K46A 4QOEA 1J7JA 1W9MA 3ZDXB 2FMTA 3NP9A 4JK3A 4NHOA 4D3XA 1A98A 1R0WA 3W9BA 1E20A 1UPTA 4AS3A 1OLUB 3FG9A 1B26A 3KEMA 5EIBC 5EWMB 1ZHOA 3LQ4A 5BV7A 2XR1A 1HE3A 3HWWA 5H68A 3RPEA 3VOTA 2X6QA 3JYOA 4ZAFA 3U4HA 4YJHB 4EY7A 3LV8A 3WGQA 4B33A 4Y8VA 3PPXA 1UKEA 3WLLA 3PJRA 3I6ZA 2ZJFA 3TB4A 3O94A 3PA8A 4XWAA 4JXJA 2O5RA 3RS5A 1A2KC 2Z5LA 4Q24A 4EA6A 4CIAA 1TJ3A 4N8DA 4HY3A 2ZKIA 3CONA 5H5JA 2A5GA 3UN1A 4B0PA 1KMHB 2M98A 2XX3A 2R66A 1EVJA 2A59A 2PV0A 4ALMA 2RB4A 4GI1A 2PK3A 3LT0A 3VR6A 4B85A 5JISA 4ZT7A 5L95A 3OX3A 2P0EA 5L9AA 2FXVA 1LV8A 4E51A 3AQ4A 4K6KA 1HFWA 4B3IA 2QRZA 5JPCA 3NHKA 4EFMA 2WYWA 4ENVA 3NHSA 2QAGC 5HUHA 4ND8B 2W2TA 1C14A 3I72A 4S0XA 4DCPA 1Y1KE 1YC5A 3QFSA 4LDPA 1JLMA 1K63A 4I8XA 4LEIA 3WRXA 5C1BA 2I3AA 4WN9B 1P2FA 2FNAA 3PSAA 2B34A 2IWHA 4PNZA 2A5DA 1GNRA 2A9JA 5B6PA 2ZXEA 1SBQA 3H3FA 4NONA 3WIUA 4E31A 5JNTA 1ZZEA 1E6MA 3EG9B 4NCNA 1O87A 4O4LB 4RPCA 4RY9A 1PS0A 1UBLS 2HF9A 1VKZA 1JEAA 1L6IA 1A0OA 1AQUA 4OHWA 5K8CA 1VPTA 1R2QA 3THOA 4LVUA 2D1QA 2DFLA 1U9JA 4PYRA 5BR8B 2OFWA 1V71A 1Q92A 4YWJA 4RMIA 4BMYA 3DYBA 2BHSA 2ZAMA 1VMAA 4HGYA 4YP5A 3ZKAA 4F1KA 5B6JA 5F76A 1TF2A 3GHHA 4RZXA 5C3MA 4M38A 5C5CA 2PH7A 2QVZX 1DUSA 1X92A 3H9CA 4AJKA 4B3DA 2NTEA 1X8LA 4GD3Q 1SOMA 4QDKA 3WO1A 2Z5GA 1UZMA 3D1VA 3K2QA 4MMXB 3SR3A 3STWA 1NHGA 4EUFA 1ZJ4A 1VJ0A 1XTKA 2BFFA 2QSYA 4O1HA 3B9RA 4HDOB 3UYKA 4BKOA 4G09A 1T3ZA 4OOEA 2CL6X 3AXSA 4MR8B 1IWPB 3EC2A 2C5SA 2OESA 2P9GA 2WTNA 4LSMA 4KGVA 4PRKA 4BDTA 1A9PA 1B0AA 1PK9A 3D54D 3JSAA 5A3JA 5LMZA 3PHBE 2AXPA 3AY3A 2I4MA 2XITA 2CVHA 2M2IA 3GLTA 2C54A 2AQHA 2BRUC 1OXVA 2V98A 4B3HA 2WEKA 1E2EA 4KCGA 4Q3DA 1KC3A 2BI7A 2FMXA 2GEUA 2I4LA 3H1FA 5DM2A 4AJIA 2NU8A 5JNSA 4O4JA 1WCYA 5B3KA 4ZQEA 4I36A 3TXXA 2G9UA 5COQA 1OYOA 4DNQA 1JLKA 1OH7A 2YNMA 1ZCJA 1EESA 3SKVA 4Q4DA 2FHPA 3ETEA 5D1NA 3U7IA 3C1UA 4W1PA 4GX2A 1LZKA 3DCYA 3NKLA 4RF4A 5D6OA 1ZHHA 4U7TB 2Z2YA 4J6FA 2FX3A 4YMUA 5MN5A 1CETA 4R1OA 2OA0A 1Q0RA 3JWIA 1DWOA 2FG5A 4K87A 1NM5C 1CERA 3OIYA 1JB1A 1N8SA 3AR8A 1TEHA 3R40A 1BS1A 4PLCA 1JFLA 4Q9AA 3OSZA 3COVA 2X0NA 1TM3E 4G5FA 3DH0A 4O33A 3EFBA 3BDIA 3USZA 3LLSA 1S6YA 3R9WA 4MP6A 1E6UA 1JSZA 4ARZA 4H7KA 4PNHA 1WXWA 4R9NA 3T4UA 3MT0A 4O3MA 4JC8A 4ZZ1A 4XX0A 2JHFA 2F1HA 3Q72A 1D2CA 4IDCA 4GC9A 2ADFA 1AGPA 1GPYA 3ILSA 1J2RA 4HDKB 3TQFA 1DS6A 2I33A 3H3JA 4OJKA 5DP1A 5KNDH 3H11A 4MVJF 4XB1A 4BTLA 5M7EA 3U49A 3TPFA 4WOBA 5BSWA 2ZJ4A 5LD2C 5DLEA 5L51A 5JAHA 2E4VA