2JI4A

Human phosphoribosylpyrophosphate synthetase - associated protein 41 (pap41)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
350
structure length
302
Chain Sequence
GLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQSIVSKLLASMMCKAGLTHLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDYRNAVIVAKSPASAKRAQSFAERLRLGIAVIHPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHGLLSSDAPRRIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human Phosphoribosylpyrophosphate Synthetase -Associated Protein 41 (Pap41)
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PHOSPHORIBOSYL PYROPHOSPHATE SYNTHETASE-ASSOCIATED PROTEIN 2
total genus 95
structure length 302
sequence length 350
ec nomenclature
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ji4A01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ji4A02
4P84A 1A95A 4LYGA 4IJQA 4P3KA 1IBSA 1I0LA 4RHUA 1QK3A 4WN3A 5JV5A 1WD5A 1L1RA 5KAPA 1BD3A 5BSKA 2H08A 4RHXA 3EFHA 4X44A 1ZN9A 4RACA 3S5JA 4ZFNA 2JKZA 4JLSA 4LZNA 1NULA 1OPRA 1OREA 1GRVA 2VFAA 1TC2A 1QB8A 3OHPA 5ESWA 3HVUA 1D6NA 3QW4B 1A98A 1QCCA 5JSQA 1VDMA 4P83A 3DMPA 3OZFA 4RAQA 1J7JA 1U9YA 1P4AA 1P17A 1PZMA 3GGJA 2AEEA 3ACBA 2EHJA 1G9SA 2HCRA 2P1ZA 1DKUA 5HKLA 1BZYA 3DAHA 3O7MA 1XTTA 5E38A 1W30A 3ACCA 1A3CA 5K51A 4M0UA 1Y0BA 1I14A 3GEPA 3H83A 4P80A 1ECGA 2WNSA 2PS1A 1LH0A 1DQPA 3NAGA 1STOA 4LZAA 1V9SA 4MB6A 4OHCA 4KN6A 4M0PA 2FXVA 1A97A 4TWBA 1FSGA 1P18A 4RQBA 1ZN8A 1ECBA 1DBRA 5IAOA 3M3HA 2JKYA 4QRIA 4M0KA 4FYMA 1QK5A 1ECCA 4P82A 1UFRA 2PRZA 4RAOA 2C4KA 4RHTA 1ECJA 1JLSA 1QCDA 1OROA 1VSTA 1QK4A 1Z7GA 2H07A 1A4XA 2DY0A 3DEZA 4RANA 1UPUA 2YZKA 3ACDA 5BRNA 1BD4A 1G2QA 1NONA 1XTVA 1YFZA 4Z1OA 3LRTA 4PAWA 2PRYA 3G6WA 4LYYA 2JBHA 1TC1A 5ESXA 1I0IA 1XZ8A 1G9TA 4PFQA 1A96A 4RV4A 3GGCA 1I5EA 2IGBA 5IPFA 5KAMA 1G2PA 4QYIA 5BQOA 1HMPA 4RHYA 1QB7A 1U9ZA 1DQNA 3OZGA 1AO0A 1O57A 1P19A 1UPFA 3KB8A 4P86A 3LPNA 3MBIA 1ECFA 1O5OA 4RQAA 1XTUA 4QYIB 1JLRA 1XZNA 2JI4A 2XBUA 3MJDA 4RADA 4X45A 5BQPA 4F8EA 2H06A 4LZOA 1GPH1 4S2UA 1DKRA 4RABA 3N2LA 5HIAA 1MZVA 4JITA 2GEBA 4P81A 1L1QA 1R3UA 5EUCA 4WMLA 1VCHA 1I13A 1ZN7A 1CJBA 1HGXA 2E55A
chains in the Genus database with same CATH superfamily
4PG4A 2O8BA 3LWBA 1Y4UA 1GZ4A 3ZG6A 3N87A 1J9GA 1PFWA 3WLHA 3FCAA 5DHRA 2C96A 3OIWA 5U9CA 2R1VA 3JPYA 4F97A 2G17A 1CDDA 4C21A 4Q1DA 1YWGO 2GCOB 3BE5A 1PFYA 1WF6A 5K1ZA 2FWPA 1CP2A 2E4VA 3COSA 2O2ZA 4PU0A 1AQNA 3QKTA 4B35A 1SURA 5ANRB 3E8MA 5G4LA 1V7ZA 1ZNQO 2GARA 3R4VA 3E3AA 5JNVA 1DLIA 1TT7A 3FCSB 4NJMB 4PGAA 4S0ZA 1GCIA 3GARA 3GEMA 1HDCA 5LB2A 4C4AA 2OGZA 3NATA 5DM2A 2FWJA 4M8NE 3T7AA 3UXYA 3OKAA 1SVIA 1U8ZA 5C8YA 3JY6A 3WJ1A 2WJJA 1T1SA 2YWJA 4BLPA 2W83A 1NVEA 3AR7A 4RGBA 4WZAE 4CL3A 4DARA 2PYIA 4TSRA 4MVJF 9LDBA 2DLCX 4YTEA 4MKZA 3AIOA 1SD5A 5I7SA 1JIJA 1NA5A 3ROQA 1JR3E 1SB9A 3LA8A 3DE5X 4B2PA 1YBMA 5DM0A 2VCEA 4EFNA 5EL0A 4L50A 5LQKA 2WIJA 3ZXXA 3T5PA 2MYUA 4JYCA 2ZSFA 3DT9A 2IXEA 2GF9A 4FMDB 2VF5X 4G5GA 5EIWA 4C4ZA 1X1EA 3IBCA 3RS8A 3UQYS 3ZWQA 4D4IA 2WJ3A 3AJRA 3V9AA 4D98A 1TX4B 4CR7A 3GLIB 4V1CB 5EE1A 1I7NA 5G2OA 4W4TA 1P29A 2O3RA 1Y5IA 2TS1A 1KDVA 2HHHB 1C1DB 1NZFA 4ZEMA 1ZOIA 5KOYA 1YKGA 2ECQA 5JVDB 1H2EA 4UQPA 2X40A 3JYPA 3MELA 1Y1PA 4M60A 2X4LA 2JJ1D 1BOOA 4DR7B 4DLAA 1R50A 2AZMA 2HF7A 3IB3A 3KL2A 3WP0A 1TO2E 2PO7A 2GK4A 4OXKA 4BZWA 4CNBA 3K70D 4CVNA 3D1VA 3VZSA 3W4IA 4CCWA 2QV7A 1W1WA 3RVLA 3BTOA 3T4PA 2DLDA 1OXBB 3VH2A 4EA7A 3ZGVA 1KJWA 1HURA 2FNAA 5DLYA 1PT7A 3D6HA 4KR6A 1J49A 5TARA 5JD4A 2B34A 5HJ7A 4KFRA 3QLJA 4PO8A 1Y8RB 2HI0A 2XYHA 1GTMA 1K7CA 4L4XA 4QUDA 5MDHA 1II8B 1VRVA 2FCAA 4HRAA 5KVSA 4K9PA 4GICA 3O0TA 3M4YA 4KB5A 4YRBA 4AY5A 3QBEA 2Q3JA 3K8QA 3C8DA 3PPVA 4F9GA 3K20A 4BNXA 5IJ0A 3D8TA 3MRVA 2OPHA 4C3OB 4MEAA 5DNAA 1ST2A 1VXOA 1AO0A 1WZEA 2OMKA 1Q7EA 4QGFA 1UDXA 3ZHSA 1C29B 4FZJA 1ORDA 3OLQA 4RPHA 4F46A 4URZR 1FLNA 3UJ3X 2BMVA 4FYIA 4OOFA 1TM1E 4TVBA 5CJ2A 2LE0A 2Y93A 3PRYA 4RHCA 1NVVR 1H0KA 4AFNA 1NLZA 3HY6A 3ITKA 3JQGB 3LHKA 3IUMA 1E9FA 4KX5A 2FETA 3TBKA 2NYRA 1W9HA 2XMPA 5FO1A 4TOIA 1E3DA 5FKJA 5PGMA 3KCNA 4KQ6A 3W5BA 3PIDA 2H1RA 3IOBA 5A4MS 2X0RA 3DAYA 1ZJYA 2YASA 2WHQA 2CK3D 3DPIA 2QX6A 1H1LA 4BKUA 1L5QA 2FR0A 3ASVA 5K0NA 1OXTA 3G2HA 2JRCA 2OG2A 4JYZA 1F12A 4PLYA 3UMGA 1IU9A 4MYSA 1QRAA 3B1WA 4A16A 1YSCA 5E7MA 1P44A 3QUAA 5IARA 1TVCA 3IV6A 3GPIA 4QDXA 3NTRA 5KYTA 1R6DA 2OC9A 8LDHA 4BCCA 2MYTA 1QDUA 3T5CA 3A1CA 5HCIA 3E82A 3RLFA 5IUNC 2Q1YA 1MO4A 2I6XA 2ID4A 5AP9A 3X1XA 1PK7A 5HYVA 1V35A 4JS0A 2IXTA 3DLIA 4CMEA 1H6BA 1RWMA 3IJRA 2OO5C 3LOUA 3H1EA 1SA0B 4LWOA 4UUOA 4F4DA 5JVDF 4B3SB 4X0EA 5TS2A 3ZS9A 3AI3A 4JOQA 1BNCA 2P9YA 3D7MA 3JVVA 2ZRGA 2PFGA 1GKIA 4HATA 5T41A 1P31A 1QWOA 2P2LA 2WTXA 3C3EA 4GO1A 1AMNA 2IL1A 8MHTA 1KVTA 4DLRA 2AG0A 1VG0B 2O59A 1MX9A 1VMKA 1U5BB 1ZWKA 1L8XA 4V24A 2D2FA 1P1JA 1MO5A 3ENKA 4ZOEA 4CEJB 1CR0A 1PVDA 1E7RA 4FGJA 1EX1A 5G3ZA 4NEQA 2PR7A 4PYOA 1DCKA 1ZRNA 4IIUA 4B6SA 1PWZA 1E99A 5BN5B 3AX6A 1KDYA 1RBZA 4Q02A 4Q24A 3D7RA 5JBNA 4KLCA 5IDQA 1OYVA 2V6JA 3N0XA 3VXKA 4K6CA 4G24A 4R9RA 2JIBA 1JR3A 2X5JO 3TSYA 5AUOB 2YFHA 3TPZA 1PEAA 2I29A 2JRLA 3FPJA 2G6TA 4JOSA 3RTEA 4R83A 2WU1A 4RQBA 2RGDA 2CL0X 3PKIA 3WMGA 1XZBA 4PBSA 4HHEA 4RA9A 4A7PA 4GPEA 1TAHA 3LUKA 4PNPA 2CXOA 4MWCA 2VHEA 1W4BA 3EQ7A 4OA5A 3HYRA 1ND5A 3KIPA 1RRKA 2ZRDA 4IJKA 1P0FA 1TJPB 4LWQA 4QBKA 3EAQA 3VPDA 4DILA 3WDKA 1M0SA 2P9FA 5LIPA 2WW8A 3H19A 3PF9A 4FU0A 2X4DA 3ILSA 4ZGWA 1E20A 4MS1B 4BNGA 2JFGA 6PFKA 1VE3A 1L4EA 2XUKA 2ATEA 1L8QA 3DOEA 3ZGZA 1R4ZA 3THWB 2HJHA 2CZQA 1B2LA 1PFGA 4XYMA 3I28A 2XMCA 2YIJA 1RI2A 2ZFUA 4U7FA 1YRWA 1QB7A 3G49A 4BO7A 2A2ZA 3ITEA 3OZGA 1IUKA 1VE6A 3K2EA 3K0FB 4BMVA 1BMDA 3PDIB 5C5EA 2FPLA 4URWR 1KDRA 2WB4A 1L9KA 3VR4D 2R44A 3GUCA 2FZVA 4Z4EA 1MAUA 4RYLA 3VNUA 3Q3HA 5F1YA 1U1CA 2FWIA 1KAGA 1MKYA 4KSBA 4UCQA 1Z2DA 4XLLA 1LLQA 1ECPA 4L4RA 2M6KA 2W70A 3WGTA 2D6FA 3RH0A 2V9ZA 3NUQA 2HQRA 2JJ8A 4C7KA 4N76A 2FSIA 3UJ9A 4V02A 9ABPA 1RJDA 2Y68A 3U1TA 3KUDA 2W9XA 4ND6A 3NJ8A 1OUMA 4Q7JB 2FP3A 4UE3S 3NS7A 3ROXA 3ZW8A 3LWDA 2I6FA 1E3WB 1JTFA 3SU8A 4RHUA 1UJCA 1HGXA 3I4FA 1RBYA 1Y6ZA 3INGA 3MINA 3R5HA 1MAVA 3D6VA 2RC5A 3Q1LA 2FK8A 3EPPA 4KYTA 3E3LA 1XPUA 1IZZA 3D3QA 3D2BA 7AT1A 1G7SA 5JMTA 1L6IA 1ZI6A 2O8VA 2W8ZA 3LJKA 3OJXA 4MVWA 1GKYA 5FI0B 5A9SB 3SWWA 2QL5A 1E0SA 2O8FB 5GJBA 2PT7A 2XCUA 1NATA 4K88A 2OC4A 3EDQA 4P31A 1NM5A 3ICVA 2PL3A 4RU1A 4TTJA 1BX0A 1KO4A 1P4GA 1QB8A 4EVSA 2I6SA 4TWRA 1X7XA 1FDOA 3BWDD 4B3FX 3R3HA 1GPLA 4KKVA 2XKBA 4U9IS 4C5CA 5CPBA 1DRVA 2XVXA 3AOEA 3LD9A 4XVRA 3RFUA 1R9GA 2FQQA 1SD2A 2Z56A 1HY3A 5SZKB 1KZ9A 4B6JA 1N5MA 1T2VA 5FIUA 2C9BA 3R7DA 1G18A 1J09A 2J32A 4FCCA 3DFUA 5COAA 1PHRA 1SCUA 4B6QA 4S1VA 1GD1O 4QNMA 1NF3A 4AY4A 4DXDA 3FGOA 2HIMA 3C8HA 4RTJA 3IIEA 3KLNA 3EF0A 4DDVA 3KYDA 2OHGA 3M6XA 1ENZA 2Y92A 4NBKA 3OJEA 4I5IA 3LTEA 3R7FA 1LUAA 3SIWA 1RWWA 1W5TA 3AFOA 3WLNA 3J81k 2BMEA 4W1PA 1HE1C 4OGGA 2QLLA 4RVHA 3TX6A 1ORVA 4KUEA 1Z5VA 3BFXA 3MSCA 3PRKE 2WUDA 3WNQA 1CETA 3CZAA 1EUYA 2QD2A 3LXUX 1I4TD 1Y3FE 2ZGVA 1G4UR 4QRIA 1Z73A 3MHPA 3A37A 1BQEA 3ZQJA 4YONB 3E27A 3U19A 1KZYC 1SA0A 4ZCRA 1GYQA 1KH1A 1WHTB 4HWOA 4LSMA 4ACBA 4ZI7F 4Z4HA 1DP4A 5KNCH 3EIQA 3GMSA 3UPUA 3I45A 1OTXA 1ZIOA 2B20A 4P3XA 3TBHA 2AJCA 5CB4B 4RY9A 4TTSA 4EX7A 1BCRA 1GN8A 5IN4A 1L4MA 1BMFA 2C77A 3D6AA 4PAWA 5P8WA 2PGOA 1FIUA 3V6LA 5KB3A 3B7WA 5H80A 4IF6A 4ZMSA 2FUNB 1W36C 3STTA 1ODSA 3LF1A 4LSZA 2GVNA 1DQRA 4NH0A 1KSGA 3S70A 2O57A 2JATA 4LJLA 3U7IA 2YZNA 3P52A 5ALHA 1IB6A 3EIEA 3ASZA 4IJVA 5I4BA 4O3MA 3AB8A 3I6BA 3IEPA 1DEHA 2HTFA 2XVAA 3KWMA 4R1SA 2I7TA 1UQUA 3I5AA 4GE0A 2BGJA 1SZDA 2IH4A 3UAWA 4FQ8A 1KSHA 1PS9A 2FGKA 4RTMA 1CVIA 4HDCA 2Q2QA 1SIUA 1JIQA 4KK4A 1M6WA 3V1YA 5FEUA 4HOYA 1RAGA 1W52X 2XOKA 4AWAA 2ZT7A 1JLRA 3ORHA 4AMGA 2DM6A 1IBKB 5FV4A 1S8NA 3LDHA 4JEIA 1XPRA 2JLRA 2IDJA 4COKA 2ORWA 3BFJA 4TT3A 4YAUA 3NP7A 5KC9A 1E6MA 2VZ8A 1IM2A 3JQFA 1NR1A 2GK3A 4BNFA 4FNOA 4GOLD 4CW7A 3HB0A 5EMMA 3MMNA 1M1YE 2EGHA 3MT7A 3UHOA 1DQSA 2PKEA 4G1VA 5TQVA 4F3YA 1C2YA 1QFSA 1XEXA 4E2XA 3FROA 1DO2A 3D7KA 3DOJA 1RJ9B 1Y89A 3IJ5A 3KKOA 4LYGA 3OFSA 4G4SP 4CTKA 3NEYA 5EEHA 1D4ZA 3QEJA 4CEIB 1VJ1A 2GO1A 3U4QA 2QORA 2Q5EA 3DFMA 1KYZA 2ONCA 3JPWA 4AW9A 2JKZA 2PDAA 1RRCA 4L7VA 4P4GA 5JQGF 3A06A 2ADFA 1TMGE 3UMRA 2X9QA 2J0EA 3B20A 2XVMA 5KI6A 2R5FA 2HDNB 1TI7A 4CMHA 2O3SA 4CQMB 4CQLA 3SHVA 3HK2A 1P17A 4M88A 1GTZA 4QFCA 1DOZA 1TCVA 3KALA 3LX8A 4N5DA 1O08A 4R81A 3MTEA 1E59A 2C42A 4FHDA 4MGYR 3HB1A 5AI4A 3H0CA 5AQ1A 5FX2A 5KWVA 2I4MA 3GMTA 1OFUA 3WWZA 4QAJA 1PIWA 1S6YA 1H93A 1TD1A 2M1ZA 3JR7A 1QUFA 1ONOA 2MINB 3HFRA 3KJEA 2I34A 3P9PA 5AO9A 5LA6F 3H83A 2H5IA 3I04M 5BN4A 1ODLA 2CHGA 4JHXA 2C97A 4JSRA 3BK1A 1MB3A 3C1TA 2XMGA 4KJXA 2QT9A 4UTPA 4XWGA 5LU9A 3KBOA 2AT1A 4Y2HA 2MYNA 4OM8A 5CB0A 4KUHA 3EXG1 3PQ6A 3WICA 5JLJA 1CRPA 1F2UA 1KYIA 2AK3A 2WJWA 4K40A 4RK1A 1ILWA 5TXGA 3I58A 2ZYTX 5I7AA 2JEYA 3PDUA 2HB6A 1AKMA 5F3DA 3PT9A 4YQEA 3W8NA 3IIMA 3AUSA 1OB2A 1O87A 1G291 5TGDA 5E4TA 4QUAA 3VU9B 2DY0A 1T6BY 2JHFA 3VSBA 2BCGY 1HLDA 1G1MA 1UBMS 1DDOA 2OVFA 3CF4G 3KDSE 5T7BA 5AM4A 2G5PA 2BDEA 4FFLA 5I7FA 4ITRC 3AL0C 3T4XA 1DKPA 1HNZB 3FHJA 4KI0A 4OU5A 2P9TA 1YB7A 4NDNE 1P9OA 4H77A 5JCJA 5JJ5A 1AUVA 1LRJA 4HNUA 1Q11A 5KNCA 4EVRA 1RVDA 2DFVA 3AF4A 3G2PA 1QHGA 2FFRA 3CZPA 1Z29A 2P6OA 2IHJA 3HQ4O 4TS9A 3AHEA 2YXNA 1W87A 3FMIA 3KT3A 4EPYA 3OLVA 3WB1A 2NGRA 2X8BA 2JLVA 4MZDA 3GW8A 3T7IA 1OC4A 5AJTA 3BJZA 4KQEA 4PYKA 2X13A 3DFIA 4N41A 1WD7A 5JH7B 5K3OA 4W7HA 1Z17A 1XMIA 2VJCA 4LCBA 5AT1A 1M54A 3UK2A 3QRWA 2XWQA 3N58A 4NX2A 4J1SA 3FOZA 2H7XA 1L5ZA 4WHMA 1N3LA 4F86A 3KOOA 3DZKA 2FX5A 2OXTA 3H5RA 5FBHA 5HBRA 5M34A 3W8RA 2HNKA 1GNSA 4C4YA 5LYJF 1QO7A 4R3NA 1TYDE 4DSZA 5K05A 1T2UA 1VHQA 2FW6A 2IITA 5E1BA 2AXQA 4JJFA 1C30A 3FCUB 1GTVA 2D4AA 5BYJA 1X38A 3WI7A 2QUZA 4EG5A 5BP7A 3TH5A 1U7UA 2UXDB 2XCLA 2PNJA 4BVEA 1YS7A 4TMKA 2JBWA 3AR8A 1ZXXA 1S0UA 3GZNB 3RLIA 2VDOB 1JVBA 1ZMTA 2PU7A 2OOKA 2W8BA 4LJ9A 4PGHA 3T5DA 3UWDA 4DLWA 4TVKA 4TSFD 4WN3A 4XH9B 4KLRA 1ORTA 1YS1X 1H6DA 1I3MA 1T8PA 3MRSA 2VHVA 4PYIA 5KYGA 4GLJA 4D82A 1M8JA 1GRRA 1BQ4A 1XWWA 2GTIA 1WVMA 3H6GA 3AXTA 4LIPD 1FUUA 4BJ5A 4KQCA 1NULA 4S1PA 4KRGA 2Y99A 2XJ9A 1YL6A 3LU1A 3F5FA 2W6ZA 3L8MA 4JEUA 4OI1A 3T7TA 3WKEA 2C99A 3WS7A 1IN5A 3HVRA 4P5PA 2ZRBA 5I9IA 4I4CA 1C3OA 4FVTA 1T4MA 2H8GA 4KNYA 1YI8A 4E0BA 2VL7A 2I2AA 2BCEA 1JG2A 2C94A 3S2FA 4DQDA 4CV0A 1VJ0A 4REQA 3IAEA 3DL7A 4G0OA 4PVDA 3B1YA 4KR9A 3ZW7A 3BM5A 2BYTA 4E94A 1MHPA 4JROA 2V6IA 1W19A 1T1GA 1P91A 1PX0A 5T4FA 4RZUA 4GC5A 3F96A 1VIMA 4QHTA 2Q46A 3NWBA 3T06B 5DSZA 4E88A 2XCSB 4LRSB 3E0QA 5ALFA 5I48A 1FTWA 1M5RA 4HUQA 3ZQ6A 2VH2A 1Y3AA 4ZARA 4DADA 1GNRA 1AURA 2N75A 3PX7A 2JKVA 4ZMRA 4U0KA 3O8QA 3H86A 4L51A 5HCNA 2W2OA 3D8NA 3SYMA 3VPAA 1JMYA 1PV1A 4A3SA 4D81A 2WINI 3K4HA 3QU2A 1A50B 2WOJA 1FFDA 2IBTA 4AP5A 1S3GA 1Q16A 4G1CA 3S99A 3EBPA 3WWDA 5JUWA 3MWJA 2PX5A 3CUKA 4BOYA 3Q7PA 5E3JA 4AN4A 1UKYA 1XZLA 3ZOKA 1VG1A 1S2DA 2V9PA 2QP9X 2QMQA 4OB8A 3RAPR 3WVNA 4W5TA 5E9AA 5BUQA 2PUFA 3DT8A 2QUJA 4IH9A 3FFXA 4J75A 4K9MA 4KO2S 5E6SA 4ZANA 1RVV1 1A2BA 2X9GA 5JBIA 4YDHB 1N57A 4ER5A 1BX1A 2FG7C 3LW7A 4MQMA 2VK4A 3UFBA 3STWA 3MFYA 1U0GA 3UB2A 3CUTA 3FPEA 3U9TA 3ZY3A 1N9GB 5LZ4A 1O4VA 2WSLA 3D6TB 4A03A 3FOEC 1T6NA 4CMGA 3IH5A 2PHZA 1QIDA 2FUEA 3IBYA 4FCVA 4V0OA 3VV2A 4B3BA 4R7GA 2GN9A 5HDBB 5JSZA 3BF8A 4GIBA 3OPQA 2VCYA 1QHEA 1ZM9A 4KNVA 4MS4A 3TLXA 4TS1A 4XM1A 2ZJ8A 4QRDA 3N2KB 3AF6A 5BR4A 2KX7A 4QBIA 3SC3A 3LF2A 3W5DA 2CB9A 1PNVA 1JLMA 1R1DA 1TGVA 3KEMA 4MMXB 1W5AA 3CPEA 4QHSA 5TJHA 4G1FA 4MUNA 4KPYA 3PEYA 3HKBA 2PMBA 4JUIA 1KPHA 1XD8A 4GLOA 1VPLA 5LQDA 1EUDB 4LY0A 4B6PA 3G1TA 1ZAKA 5IH7A 2X7XA 5LJLA 1GXSB 1DJLA 2E4XA 2O07A 2ZTLA 2O50A 3A10A 2ZBDA 3FYCA 1I51A 1PNOA 1SXJD 3WBBA 2G5CA 4EHDA 1UC9A 3LXMA 1Q22A 3QFCA 2V59A 5JXHA 3A4NA 2XNDD 1MVNA 4NATA 3PC6A 4PCLA 3L4BA 2XSZA 1ZEMA 2CUNA 3AP1A 3OE4A 1NTOA 4XDGA 5KOJB 1XDSA 5FWXB 4OHPA 2HPVA 5CM9C 1R0XA 4PQFA 2PG3A 3KOYA 5FUYA 1Q7GA 2OV4A 1PUXA 4NH4A 4W5RA 1U0JA 1ZGAA 2XIQA 4FGZA 2AUNA 3PIRA 5DP2A 3RV3A 1Z8NA 3LQKA 2ZUVA 4IHAA 4ZYLA 5DTEA 1HL7A 1DC4A 4X6UA 3PCXA 1EB8A 5EVCA 3BKWA 1Z16A 5BOSB 5HPYB 3OH8A 3S55A 4U8GA 3SJ7A 1G4HA 1OFTA 2V7VA 1ZUNB 1JHUA 4J0KA 1BE1A 2G7ZA 1CR4A 3GEBA 4MCIA 4MQ5A 4LA4A 1U4OA 4DV4B 2XUQA 2C2HA 1PG5A 2KHZA 1REQB 2HIGA 2R8ZA 2WFLB 4IUBS 2E9SA 4KPUA 4NY1A 4QBGB 1RDFA 4JN6B 5CNKA 5B7NA 3FFAA 3IHLA 3AEQB 4O4LA 1LSJA 4KKXB 3D6UA 4BMYA 2XVYA 1DIRA 2VZEA 3MWLA 5FYDA 4UDOA 2AKYA 3Q1KA 4YRSA 2W42A 2EYQA 4KXFB 3ZXSA 3HTXA 1VI6A 3DGEC 3T5BA 1UP6A 2SICE 2IHTA 3AGQA 2LKCA 3HY3A 4G0QA 4IOKA 1ZZGA 4O1MA 3TIVA 5KSWB 1GDHA 3RO7A 1NIPA 2FMIA 5KHAA 1A4IA 1I9GA 3PC2A 1A1SA 1QS0B 4AQDA 1Z0ZA 2AW3A 4RL6A 1UEXC 4U63A 2WSMA 1STOA 3NAZA 4TXHA 3O5AA 3QY9A 4YJ2B 1RRGA 2ATCA 5CYGA 2O0LA 4WOBA 3VU1A 4D8VA 3NKLA 4TQ9A 3FGNA 3GFSA 1EXWA 1HTWA 5EMKA 1TCAA 4CV2A 3K9FC 5AUNB 5GONB 1ZIDA 4AD8A 1BCSB 4QUEA 5KQPA 1MEOA 3C97A 1PDOA 3LVBA 1LNZA 4ONEA 1GT91 1YS2X 4LUCA 3AF0A 4BYMA 4HNSA 1LWOA 4LFAB 1C4KA 4V0RA 4E1AA 3U7QA 1GGJA 1JFFA 1VLVA 1N36B 4NCBA 4LX0A 2LZ0A 2QVCA 4MGZR 3TW6A 1IN6A 2IYLD 1C4WA 1UBUS 3RREA 5HX7A 3RKSA 2EF1A 4XX1A 4J2OA 3EEOA 1GVNB 3FNQA 2YZGA 2FWBA 3GAFA 4PX9A 5K8VA 4TXNA 5IWAB 2HREA 1ZOPA 2OLJA 2YXLA 3CHYA 4C4PA 1XXLA 3QBVA 1AZLA 3GHHA 4QSHA 5DK6A 1GTSA 4F3TA 3HCAA 3QGMA 2ZSKA 4G37A 4PYNA 2CHQA 1WV1A 3DR3A 4FYXA 4BFXA 2JAWA 4TRNA 3ER6A 1TYEB 3VO2A 4B74A 2P0AA 2RBEA 4IIFA 3CG0A 4TQUS 1IZ7A 1E2IA 3UM9A 4TS3A 2IZ0A 2IP1A 3UJBA 4UD6A 4I1IA 3BWVA 4QJ3A 1YS9A 4DV7B 1B41A 1W5FA 2OG1A 4GZ3A 4B7UA 5J4HA 1KP9A 1X74A 4JSYA 3U61B 3NNSA 2GCGA 4Z4QA 3G1UA 4RSRA 2G63A 1CC1S 1YB4A 3MB8A 2DPXA 2FRDC 5BV7A 2YFKA 3NTOA 2D2VA 3TIFA 2CMGA 3SHWA 3EGDB 3O9MA 1VBMA 1D2GA 1Z3IX 3PR1A 1L1QA 4LISA 3BMNB 3PR2B 5CDGA 2WKSA 4YUWA 1VCHA 2BL4A 2Z9BA 4I14A 3PL1A 3A2NA 3U7EB 3OZFA 4ZYVA 3T1TA 4CTOA 4RTRA 1J8YF 2D1QA 3V8NA 4NU0A 3VI4B 3WK5A 1II9A 4DZZA 2EP5A 5C8ZA 4ZEOA 2C4HA 1KZ7B 2GKGA 3H97A 3GFVA 2X8JA 1RU3A 1F4PA 3BQMB 1B0AA 4DDHA 2J5XA 2VP3A 1E1QD 1BWRA 1NU6A 1OXUA 4JR1A 3UAOA 2HLPA 3C3WA 2ALJA 4FONA 4RK0A 1G42A 2Q8NA 4G97A 4A27A 1PL6A 5LOVB 2CC2A 3CCBA 3RHSA 2H4ZA 3KO8A 4J94A 4L57A 1E1YA 2QU7A 3QHQA 3WLPA 1PNRA 3KG2A 2Q3LA 4F4UA 1YA8A 4OXNA 4OAOA 4CN9A 3A9CA 1JE1A 4FFVA 2NYAA 4UHCA 1UMKA 2HJWA 4NULA 4B79A 4EB3A 4JI4B 1C1HA 2OBFA 2FLVA 2OD2A 3I1YA 3N28A 4IOJA 5LPNA 1NBMA 2JCGA 2W0SA 4MR8B 3ZTTA 5AIBA 2XHEA 3LBIA 2CLLB 2GN6A 4XUEA 4UM8B 1LSUA 4BZQA 2O6LA 1JBQA 3UJCA 4MKXA 1NLYA 4TUYA 2Q9AA 1WXIA 2CXXA 3ZHQA 3WK8A 3RF6A 2HC9A 2PA0A 3GZTB 3L06A 2B1RA 2BFEB 4NF2A 3AI1A 4J9VA 5NLLA 5TQ0B 3O1LA 4JI0B 3HZRA 3SHTA 2IV7A 1C14A 4F8YA 3K72B 1YVUA 2BFWA 2NNWB 3ENNA 1E0KA 5LUAA 4W1SA 3ZVKA 3NG1A 5IRCD 3ZKWA 5A06A 2WIFA 3R6WA 3ISVA 1UFRA 4UDNA 3NHJA 3SSNA 4ARCA 3RVKA 3ITDA 3NDPA 1YRAA 1O9BA 2HLDA 1OA1A 2VC2B 2KQUA 1O4WA 1G21B 1P8AA 2ZZNA 2AG8A 3HDTA 5FA6A 1IL0A 2B0CA 2QZZA 3W06A 3LBNA 2BOVA 1QGOA 1OLXA 3QE3A 4IJ6A 4V03A 2J9FA 3WJAA 4DR1B 2BGGA 4OJQA 2HA2A 4JLKA 1OZAA 1I30A 5HQJA 2CLHB 4MRNA 4ML3A 3PFHA 4X95A 4EH1A 1NM5C 3NT2A 4RX1A 1W4LA 1A96A 4ARAA 1ZWLA 4JLWA 1OV6A 2I55A 1RJWA 1CY6A 3MJCA 3PGMA 4JJKA 3EGCA 2H9YA 1E1MA 1JX6A 3FR8A 4MQ6A 5E2AA 1I3KA 5JLAA 4LF9B 4BVGA 1XA4A 1P9NA 3SOZA 5IXJA 1XU4A 1A4RA 1FF9A 1QQTA 1YJCA 1GAXA 1R0SA 2YC2C 4F1KA 3PX2A 4DAOA 4V0ME 5IKPA 5LOVF 4LXGA 3A3PA 4L8GA 4ZQCB 1N2CA 3OMLA 1RNLA 3TD6A 1XZNA 5KUTA 1NKTA 4HFMA 2P4QA 4ZOQI 3RC8A 4UUMA 1FFHA 3M33A 2ZR7A 3AVWA 4PHTA 3Q85A 4M7PA 5I9MA 4HB0A 2A3NA 2NIPA 2JK1A 1PYGA 2ZVJA 1EDZA 4PZZA 3FDIA 2IZ6A 1Z4MA 2V0NA 1JHXA 4MP6A 2G82A 2JI7A 1SVSA 4JODA 3TCKA 4PXSA 4ZEWA 2ZT5A 3V33A 3R75A 4Z0HO 4TKUB 1LPSA 1U0RA 5BUZA 4KMSA 2ISSD 4KCGA 4Z86A 4L73A 3HBFA 4JHLA 1WKCA 3I2YX 4KQJA 2E49A 4EUNA 1Q6ZA 3CJRA 1A95A 4ZDKA 3V8BA 2JHGA 1B42A 5KWJA 2F9FA 3UFXB 4FE3A 1US8A 1LW6E 5C8DA 3RUHA 4MEJA 4REMA 4L5AA 4CF4A 1FMLA 2VDRB 4IDPA 5KIAA 1TTTA 1XRQA 1C3EA 2V5VA 5FTKA 1J8MF 3B6KA 4PLFA 4RSGA 5EJ5A 5AFSA 3TRFA 2Q7OE 2XQKA 4DCPA 4ZP1A 3P20A 3CRNA 3ZCXA 4EDFA 2J5RA 4X1IB 5CVJA 3SS8A 1Z3CA 1JU9A 5FQOA 1NMZA 3V2UA 1XA3A 4TXMA 4AS3A 5HK8A 4KYIB 4X61A 4HAVA 1LK0A 4QPCA 4WINA 5CJJA 5FLXA 4H35A 3B70A 2ZRLA 4O4JA 1IXRC 3TUJC 1T0JB 2YUIA 5TX7A 5JD5A 2XOXA 3UJNA 1YDHA 5J1TB 1U28C 1DWOA 1WP4A 1VFPA 1OGIA 2ZR9A 4RIIA 4TYWA 2ZRIA 4O2BA 1KFBB 3ONDA 3PSAA 4EEKA 2PKWA 1KAQA 2PH3A 3TRKA 1UKBA 3IR5A 2G4LA 1JI0A 4TL7A 4BIIA 4ZI7A 6ADHA 1V25A 3L0SA 3O3OB 3Q0IA 3I37X 3M89A 5ADVA 5JS6A 1RZRD 3RG2A 3KZMA 4AKEA 1X9GA 2VWPA 2X41A 1YQXA 2WF9A 2NQ8A 4WXYB 3O1IC 5E95A 4PLPA 1V0JA 5EHQA 3RYHB 3URMA 4NV3A 5KYYB 1ECBA 1DNPA 4UE2A 2PZMA 3I9LA 4CLHA 1YOVA 2A94A 1CZNA 5K3CA 1VA4A 3I62A 4DIEA 1I6MA 1GNQA 2VTBB 4HYEA 1MT0A 1QO9A 3FD8A 3GA7A 4D4KA 4GP6A 2NSJA 4JBYA 3EC2A 1QGAA 4R2KA 5K3DA 3IQZA 4CUZA 1QV7A 2P78A 3MCVA 4RDHA 2H1IA 4BB9A 2JD0A 4J91A 4MUMA 3FYDA 3WMFA 1F60A 2C7GA 3MCWA 3ZU4A 4C3VA 1PL8A 5IKXA 1W7AA 2Z2IA 3SX4A 3C3KA 2C5GA 1GA1A 1KJQA 3ZE2B 4DV6B 1T8RA 4PC6A 5L53A 5BSRA 2JNWA 2VDWB 3G2JA 3T1QA 4BLRA 5K6AC 3W5IA 3PC4A 1DHRA 1RXSA 3PRHA 4C0JA 1AMUA 3IOYA 1FUKA 1OH8A 1Q50A 4J0GA 3KCQA 1MH9A 2ZIFA 4RL4A 4AQ7A 4EJFA 1TCUA 1LBHA 3DW1X 4KVGA 2XKJE 3H2HA 1TZMA 5CA1F 3BGIA 2W98A 3H11A 5AUQA 3UVEA 5IHXA 4H1HA 4MQLA 1TGYA 1P19A 2J48A 4Q48A 3UK1A 4BVAA 3PEVA 1P7WA 4QC2A 1WCXA 1VL5A 3AYXB 3O83A 5IP5A 5IKOA 3RJ5A 3K2QA 3V4VB 2COEA 2XVZA 3VR2D 5L8VA 1D1SA 1PJAA 4JU8A 2XXAB 5HS4A 1LK5A 4X45A 2ZUWA 3UWPA 3ELWA 3PX3A 2ISQA 4B3TB 5AVJA 4TS4A 3KFLA 3MC1A 1DX6A 2JBAA 3EZFA 4WVFA 4O4HA 1U80A 5JJKA 1OE0A 1S89A 2X2OA 3HL0A 3WYGA 3JQAA 1R8JA 2Q4RA 4WNAA 2IYZA 2QTFA 5CFRA 5DYYA 1NG9A 2WG2A 2BUBA 1LDMA 2EZTA 3VSAA 2G4VA 5EQFA 4JXKA 5DHQA 1W47A 1QIMA 3OCJA 1ZX1A 1CUFA 2XDQA 1SCJA 2ZTHA 3DDOA 1XUOA 3KLPX 4YRCA 2WYUA 2ZJ2A 5EJIA 2PS3A 5C37A 1P5ZB 3H1GA 4L6CA 1HFKA 3T15A 5AVZA 1A7JA 3RG8A 1YOVB 3PZBA 4JT4A 1IDOA 1YE8A 2ADMA 3GOQA 4Z54A 3KRTA 5D5PA 3R3UA 3WSVA 3ZVLA 4RA6B 2WTMA 3HB7A 3KAPA 2JIDA 2WUGA 4HKTA 4LYJA 4FGKA 5CMLA 4XTRA 1JNYA 1A9QA 1TFUA 1FLDA 4G0XA 4H4CA 4H6VA 2YICA 5DU2A 3FTEA 2BN4A 4EY5A 3GPBA 4TUYB 1PWEA 5TPZA 2L82A 2ZJ0A 5JXIA 2ZJYA 3DD5A 4YUZA 1RI4A 4FR0A 1NVDA 3IUSA 4FBMA 1CYDA 4TRJA 3N07A 5C52B 4RKFA 4G23A 4DCUA 3VKGA 3H6KA 4R9NA 1KKLA 1Z06A 2C20A 1Q17A 3P4XA 2A5DA 3ED5A 2QTBA 4M1ZA 5DNYB 1SRQA 1R4NA 1MGOA 2QNRA 3GGGA 4ISCA 4Z1MD 1Z63A 2NAFA 4PF1A 1YE5A 1MJGM 3OCYA 5TS3A 4XQEA 5KNDA 1I1HA 5E7QA 1T9DA 1A3CA 1LNQA 1RZ3A 2D74A 2XDAA 4FBLA 4MCAA 5B7PA 5J4YA 1RKXA 1QC5B 3I3SR 4KXLA 5CT9A 1BIFA 2LDXA 3DMFA 3ZHRA 4OUDA 1QCZA 1NR7A 1VLHA 2L19A 3N8KA 3OJOA 1Q0PA 2WA2A 5L3SB 3VHXA 1K5PA 3OWOA 2PUJA 4UBIA 1ZC4A 5LBTA 1I8TA 2AJ8A 4ESHA 1VIYA 4OKNA 4GWLA 4OXQA 3HP7A 2G40A 3A1WA 1ZD8A 4OK3A 3QE9Y 2GBPA 1SKUA 3C6KA 3GWGA 3PEFA 1UCFA 2C4KA 5FA5A 1B1CA 1CY0A 1E2QA 2V3CC 2PWAA 3KOWA 3LP5A 1XEWX 2AUMA 1DXQA 3Q11A 2EVWX 4Q4JA 2IYTA 3WK6A 3BERA 3Q6NA 5BRNA 4BQIA 2GK7A 2OP1A 1ZCZA 3B3GA 3TL2A 5DIFA 3WKCA 4L2IA 1J2YA 1U3GA 3R2JA 2CJXA 3ONWA 1KFJB 4HFNA 4Y2VA 4D44A 2RCYA 4TTVA 2EJUA 1EUQA 3QYJA 2FR8C 2Z43A 3OT5A 4LC9A 3A31A 4GYJA 4OPMA 5JR3A 1CZRA 3AY3A 4ESVA 3IHKA 2CLSA 4QGHA 3KVOA 3WYEA 4W5NA 1FFGA 1F2TA 3L8GA 4XTCS 5AJYA 1Y48E 2JH9A 2AOWA 2GJSA 2R25B 1ODFA 4GP7A 1WB5A 3HYNA 4KTVE 2E4UA 3E9EA 1UIMA 4R8SA 2BHTA 5F1PA 5JE8A 3WAJA 5EA2A 1KP3A 2Z08A 4KZKA 3QX8A 5E7IA 3WLIA 5KQRA 3D0RA 5JARA 1V96A 1AUOA 4GKBA 3KS9A 4Y98A 1VRCA 1AKTA 2WD9A 3LT5A 1TVMA 3L84A 1F9AA 2HY7A 1W9MA 2GN0A 1CSEE 4BP3A 2NO6A 2P8SA 1CUCA 3ISJA 3N2LA 2BF7A 3D3WB 1ZH0A 3HCNA 1N2BA 2YJ6A 4PTYA 3IVXA 1PVOA 4KE8A 3BDIA 3I9JA 4IHJF 5J5VA 3V1UA 2NVUA 4GWKA 4IDBA 4IILA 4RY2A 2RK3A 2GJ8A 3K0FA 3UXMA 2Q6KA 5EJ2A 4R1NA 2XBMA 1DQYA 1PG0A 1X1BA 1Q57A 1R12A 4IGFA 3PC3A 3DHYA 1I0LA 1X9HA 2HQ1A 4J4BA 3N3BC 1IBCA 1ZPDA 4PX5A 4QFMA 2DFKB 2J4CA 2QXUA 2R8RA 3S7TA 4OHYA 1NV8A 2CMHA 4IDFA 2Z5LA 1ADCA 1JQ3A 5AJWA 4HNTA 4BFWA 3T7KA 2JAUA 2VSFA 4QTZA 2NXNA 3OZBA 4R41A 1QG4A 4D4MA 3OHPA 4MW2A 3VR4H 2VRWA 1ABFA 2FPIB 1Y9AA 4FFPA 4WNCA 2XUOA 5ALEA 3LRXA 3RFFA 4IDOA 1VPTA 1QR6A 1YL7A 1EG7A 4O6VA 3GHYA 3KDAA 4JK3A 3AR4A 3SF8B 1Y1QA 4I0WB 4Y0AA 2AEEA 3WKBA 4CG0A 1FEZA 4X8HA 2NADA 3AB7A 3REGA 2PVSA 3BX1A 1DKUA 4LGMA 4MPRA 3Q40A 3RS5A 5IULC 4X6YA 3EISA 2JJ2A 3U31A 5EMNA 5F4ZA 3WYBA 1E1QA 1ZU4A 1WMAA 3D4LA 1JT9A 3MWYW 4H7KA 5BT8A 3TEMA 3FTDA 3LLVA 4YRMA 2BZGA 1TJNA 1XRSB 2F3TA 4XWOA 3ZDXB 1CZUA 3THYB 5A4FS 5KYUA 5JEEA 4IEEA 3MXOA 5IC6A 2PR2A 3QMMA 3FR7A 4R3UC 4AUNA 2V8OA 4PBTA 2QZ9A 5DW0A 4MUJA 2FSPA 2A9JA 2X9NA 1M1NA 4X1IA 1SULA 2PKYX 5D00A 5J3JA 3GLQA 4ZIRA 2GZ3A 1JEQB 3R8CA 2HWYA 5L3SA 3E5RA 3ZWWA 3EC1A 2KWIA 2ZUFA 2ODAA 3ABSB 4ND1A 5BSTA 4CMJA 4QDKA 3VZBA 2NMVA 1VSTA 4BWGA 1DWUA 1H6AA 1SU6A 3K96A 2G71A 1Q21A 1X7XB 2WPDA 2X5KO 4Y1FA 5LA6B 4NHOA 3ISTA 2WJVA 1C8VB 4IIGA 4OHRA 3N1UA 3EGDA 3AR3A 3EK2A 4AL4A 5A6SA 2RAVA 2I3BA 2HFJA 2LWIA 1MP0A 1OU0A 2V7QD 4I55A 1VSVA 4RKRA 1NKSA 1NRIA 3E9MA 3RQIA 4C29A 4LNUA 3A9VA 4IZHA 3QPUA 3QX3A 5FA8A 2ZRNA 5LQAA 2GEFA 2QS9A 1L5NA 5JASA 4LBVA 1LJ8A 1ND6A 4I99A 4MUEA 4QYIA 3RE1A 3UO8B 1XVIA 1JKIA 4RJLA 3C39A 4OSEA 3VJKA 2FSVC 3R6TA 2JIZA 5DX0A 3T3HA 3UKOA 2FDCA 1T5IA 1YZHA 4KW7A 3V7YA 3VPCA 4HADA 2Q7DA 1LDNA 3B1KA 2ZZKA 4WBSA 5SZHB 3HVJA 1SG9A 2JGNA 2RHLA 1RHKA 4GYYA 3FPSA 5KPJA 1XTUA 2A5LA 4JLVA 1T13A 2NUAA 4MGHA 1VMIA 2PMKA 3NEJA 1PBNA 3BTVA 3P2JA 4EHNA 1AT1A 2XLCA 1TA4A 2Q28A 2YS6A 4WLEA 2PD4A 5CEEA 4P98A 4TT3D 2XE6A 3TLYA 2QGFA 1PV4A 2UXCB 3GNLA 3K6SA 3OIYA 3DLHA 2VQ3A 4QIHA 2F17A 4FFNA 5REQA 2IWHA 4C1BA 2CZGA 3VH1A 2N1BA 4LDQA 5AVYA 1W85A 1UOPA 1OSNA 3RW9A 4ITVA 2XWSA 4UQLA 3H2YA 4KITB 1SBTA 3ENVA 1YF3A 2YWCA 3COZA 3PUWA 2FEOA 1N2OA 1J42A 1GPJA 1H94A 1T6YA 2C7OA 3QBJA 4FR2A 1FX1A 1GWNA 1KP2A 2PRSA 4EM6A 1BMTA 4HB3A 1JB9A 3EQZA 1ORIA 2RGBA 3I0NA 1TT5A 1GP2A 4O33A 3D0QA 3OWHA 3QITA 4MQEA 2O20A 5J5AA 4E3ZA 4HI0E 3U44A 2GM5A 1QH8A 3I53A 4DUGA 2X86A 1GKKA 4KYUA 4CEHA 3RBAA 1XDZA 2GZRA 4NESA 4NYMR 3CXUA 2ZI6A 4GRIA 1BYIA 1MAAA 2BIFA 3VU3A 1DMSA 1IMJA 1P2VA 2FZWA 3P0IA 3ZZUA 2AWOA 2HRDA 3QTLA 5EHXA 3R7WA 3TOXA 3GWZA 3E5HA 4H1VA 1TADA 3CKYA 1ZKMA 3VSEA 1Y3CE 2W22A 1PTJC 1XMPA 2R8PA 3CEJA 5FNVA 3TJMA 6GPBA 2F1HA 4KR2A 3H75A 3IP9A 1SQSA 3U3XA 4EMUA 3Q0EA 3HDGA 3OA0A 3TVDA 3M1IA 2GOYA 2WJHA 3NAGA 5HIJA 5IJ9B 3PYLA 5JCOA 4MLCA 3HCOA 3Q9SA 3VTAA 4MEBA 2C0PA 1RCUA 3MF4A 4DRYA 4TLMB 3GFTA 4FXPA 3F98A 4J1TC 4RUKA 4WZBA 2VDUE 3UCEA 3WYCA 4ZOCA 3HCFA 3WGHA 2J3HA 3ABZA 3IBGA 3QVGA 3U9LA 1L5LA 3W5VA 4Z53A 3K6SB 5DBFA 1JXMA 2I4LA 3TN7A 4A2WA 3U7JA 3EG9B 4A5SA 2AZ4A 4G89A 3ZCUA 4W8GA 5JZVA 5J1SB 5C81A 2XUZA 5HKOA 3DXYA 4B45A 2RD2A 4EPRA 2AIRA 2XE8A 5AOCA 1K8QA 3R3WA 4LSWA 4IUYA 3RUAA 3O21A 3X3HA 1GG9A 4NCXA 1UPTA 4O4IB 3H6HA 1RBQA 4UHBA 4B5LA 3RYIA 3PC7A 3RS4A 3FWPA 2UZ1A 2QAIA 3ILVA 421PA 2RK4A 1W2HA 3DHNA 3B9RA 3EZGA 4I1UA 4N8DA 4LY6A 1ZMBA 1TUGA 1YZLA 4ERXA 1PGPA 5E4FA 2BEJA 3TDKA 1PWXA 2EKPA 2J41A 2W0MA 3HEBA 4XDYA 3TOCA 4E33A 4KE9A 3UV7A 5BYAA 2WG1A 1WDKA 3NU1A 4H4DA 2W6JA 2YH2A 4EJ2A 1WTCA 2Q5JA 2JJQA 2NU6A 5IYZF 5MGBA 3NGMA 4YRTA 2CV0A 2FKNA 3VJRA 4KFTA 4ZDIA 4EAAA 1YA4A 4KLAA 1UK6A 3B89A 3JS5A 2JHPA 4UTZA 2H06A 3O4FA 4JJ4A 4HQKA 1ITZA 4L8LA 1XVVA 4KR7A 4KSCA 5IAJA 1T0HB 4GM4A 1XV5A 3SEQA 3HADA 3QEKA 4DBLE 1T2DA 3TKAA 2Q0XA 3G8BA 5AJUA 1B14A 2CXUA 3KZCA 3MAJA 4PIVA 5IDWA 1EM8B 1E2DA 1HXHA 1HDGO 5A9TA 4ESEA 5ALIA 1U7TA 1Z35A 3AILA 3QEMA 2CJYA 1K7EB 2G9NA 1K3FA 4GKJB 4HDSB 4GVLA 4G01B 1WW2A 2P5UA 4UM7A 1CNMA 4JMPA 1IG0A 4WUVA 3EEQA 4C04A 1E8DA 4XWTA 3FUXA 1WG8A 5CD9A 3KD2A 1KOJA 1KU6A 1S2MA 4JEHA 5CT4A 3SCZA 5CEJA 4CMKA 3G2KA 3M70A 3R9IA 1YFJA 4WXPA 1F06A 2Q4TA 2ZI9A 3IMGA 4EW6A 3DKVA 3CO5A 4N4AA 4BO9A 2E6UX 3RIEA 3PQDA 1D5CA 2HTEA 3NPAA 4BRWA 3BXPA 1JIIA 4CKBB 2WTUA 2X0FA 4LF8B 5IM4A 2RH4A 2QM7A 2AJTA 2DWQA 3Q7TA 3DHVA 4KWCA 4N7RA 5JDCA 4MCHA 3EG5A 1KJ8A 4BNIA 4CXMA 3UMSA 1FFSA 1NXOA 1SRRA 3K53A 1N2JA 4G41A 4B85A 4PR3A 4ENPA 4Y6LA 4RVNA 2H0RA 2QG6A 5K8TA 1U0BB 3B9PA 3KYCB 3L8HA 2FQ1A 3HA2A 3O8QB 2A1TS 4XYEA 1DCTA 1B6GA 2PD6A 5CIYA 3HLYA 4QGGA 4HUQB 2XB8A 1DJPA 1OCEA 2OEPA 2ZUBA 4YP9A 2PU5A 2VOJA 3BB3A 4MLZA 2BUCA 1BS2A 1S8FA 4CKCA 1KQGA 1UMBB 2X7JA 1PZFA 1HDZA 3KOUA 3ON5A 1FZQA 5J5CA 4GLFA 1O95D 1E2EA 2C82A 1ZK0A 2YWRA 1EFDN 3GCZA 3P9YA 2WFLA 1DARA 3AI7A 2FJ0A 4NZZA 3HABA 4PFKA 4UCWA 4GMDA 2DVMA 1DUVG 2NVUB 1E0JA 3OECA 4GBJA 1J9EA 4I9GA 4M0KA 3V80A 1F2UB 1ZGBA 4RD3A 3RBXA 3SJAA 5GIPE 2G76A 2YZMA 3WKDA 3CEHA 3U16A 1TF5A 3L6OO 3RWOA 1P4RA 1GNPA 1YVEI 3FW1A 2D0DA 2ENUA 3OTGA 4G26A 1Y7IA 2WMYA 4O2AB 4WFIA 3C7CB 4WZBE 4L5CA 4EFMA 5K20A 1IHOA 2XEXA 4L4ZA 2GRAA 3AESA 1L5HA 4BUJA 1E5LA 4LCJA 5JC8A 1TW3A 1THGA 3LM8A 1LSOA 3NWJA 5CA0A 3OQMA 1TFRA 3I39X 3WKAA 3U7GA 4MUBA 2OZEA 4H16A 3IULA 4BWVA 1Z74A 4MW5A 3UT6A 2AJLI 4DA9A 1M6VB 1K75A 2Q5QA 3JQEA 4OYLA 3GJ8A 1KY3A 1H22A 3DBRB 3LVRE 3C48A 1IZ0A 5AH0A 5EJ4A 1JTEA 4WLUA 4C87A 2IVFA 1N9KA 3BL8A 3NOXA 4P58A 1XDGA 1MLDA 1SBNE 1C7QA 1VLJA 3PICA 4RA6A 2R6HA 2Y71A 2CFRA 2KBEA 1V3UA 2Q4EA 2YXDA 4RCZA 2RDMA 3MK31 3T9EA 3WLJA 3CRMA 4AS2A 3HU5A 3CCFA 5EJ8A 5IFKA 1ULBA 2B35A 1DC6A 2NZ2A 4BMXA 2AF3C 4C4XA 4ZGGA 3H0KA 1SK9A 4YT5A 1MOSA 4AZ3B 3CW8X 2H16A 4OIFA 3SM9A 3ZEIA 5LQMA 3K0SA 2XTNA 1GPH1 4AKTA 3IALA 3AETB 3JARA 4KVFA 1CF9A 5JY6A 1OIXA 1THTA 1Q2XA 1QP8A 5GMOA 5L40A 1JEDA 5E6RB 3PHHA 4CQJA 5CG2A 3AIIA 3RASA 5EZQA 3VJMA 4JT2A 5D1NA 1GAJA 4BX8A 5KOHA 1PZGA 3ESDA 4JBWA 3WQSB 3HSSA 3FA2A 3ULKA 2BZSA 4BDTA 4HWPA 4PANA 4TMFA 3I1IA 2EWMA 3LK7A 4QICA 1Z8FA 1E2FA 3DXZA 3AINA 3GGDA 3JALA 4QT0A 1WXQA 4ZAVA 1YZKA 4Q0MA 3AH8A 5TQ2B 3ZLTA 4P2BA 3GLFB 5ERYA 3RAFC 2HCTA 3VR6D 1D1QA 1BE0A 1L5SA 1ZW1A 2BM1A 4RS3A 4AMVA 2HD4A 3MGGA 4Y67A 4KPGA 1FNCA 1V43A 4D2IA 3IXMA 2BMJA 2BGRA 2ZU6A 2PX4A 3QHPA 4C2TA 4D26A 2H54A 5CUQA 3D3KA 5CNIA 2PM8A 1R0CA 4PC2A 4BFCA 5JISA 1IFXA 1PW5A 5K3FB 4CIBA 4U6SA 2ZWAA 3G0OA 2RKBA 3CZRA 3MSXA 4G9GA 4UUBA 3WQBA 3MILA 1KAMA 4YT8A 4GU5A 2X6TA 3WHKA 3H18A 4Y6QA 1Z5PA 1KBOA 1KSJA 3DD1A 3PC8C 1S1MA 3CMMA 4LVNA 5LQSA 5ITSA 5FUXA 3UTDA 2HR1A 1Z0JA 5FTMA 3N0VA 4KXUA 3WRYC 3AIMA 1QX3A 1ZMOA 2MIIA 3MWGA 2HUPA 3PQCA 4YJGA 2A84A 1WUIS 1FTGA 2FEWB 2AR0A 1RLMA 1KY4A 2ZI4A 5L7YA 5B4VA 1OFHA 1VSUA 3IBFA 4ETWA 1XZFA 3OZIA 2AV6A 2O48X 1UDAA 3FBGA 3TTVA 4L6IA 4BLSA 2CVQA 1BEZA 1LF5A 5C1BA 2ET6A 4Z51A 3QWHA 5F7JA 1DL5A 3R3VA 2KBFA 2XTMA 4ZVRA 4RE6A 4IQGA 2LIPA 3UAXA 1YT5A 4WGGA 4IFEA 4E5KA 4QSMA 1YJAA 1X92A 3HNPA 4CFZA 1OOEA 1EAMA 1T0PA 1TJ5A 3RS2A 1FNDA 4CKYA 1EFUA 3QVJA 3WLMA 3PBKA 3ICEA 3L05A 4D9MA 4IIVA 1AC5A 1E2HA 5ER9A 4B4UA 3GLTA 5KYVA 2RGYA 1RRFA 2RHHA 4EJSB 2ABWA 4XSVA 1RYYA 4CL0A 1FFYA 2OM2A 4Y2JA 1KTIA 1DDGA 3VYRB 1JU3A 3UHPA 3CF2A 4W5WA 3E53A 3FNHA 4RF4A 3SC2A 3WNDA 3H1TA 4MLDA 4TN1A 1Z9BA 3W05A 4CI9A 5JJBA 5KAMA 3O90A 4RV9A 3A1FA 3GBPA 5KOJA 4CM3A 3W1WA 2XRZA 3LUCA 4UJ3A 1JAZA 2EQBA 3LECA 3RWBA 1H85A 5BOVA 2RKOA 3OEHD 1GGKA 2PTHA 2JLYA 2JLZA 2KM1A 3ZWBA 3BSYA 3ETCA 1KZGB 3CKKA 4ZT6A 2GPYA 4MW7A 4US1R 3E3OA 3DT6A 4MI1A 3W2FA 1GDTA 2BTQA 2B2XA 4QATA 4S0XA 1MO6A 3WIBA 1VM6A 1J56A 2PSDA 2NUPA 2VNIA 3HM2A 3M82A 3P9KA 4ZU3A 3VGPA 3ZLBA 5KYXA 5EP1A 3M4ZA 4OF4A 1M2JA 2YCLA 4OQQA 4QL3A 3IP7A 4U1RA 1QONA 3HI6A 1H5NA 3U3OA 4C2AA 3F6YA 2M6RA 1H4VB 2QY6A 2QVYX 3RJMA 3TS1A 1U3CA 3CT6A 1M72A 3O0DA 3ZNOA 2X7HA 1N2CB 4YAIA 1WXEA 2RHRA 4C4OA 4WKBA 5A4DA 5KWSA 3T4EA 1KRWA 1G8YA 4PX3A 3TZ6A 5CURA 3TI7A 1HRKA 4JX9A 1P8JA 3N0WA 2OQIA 2PCJA 4TUYF 4ZIRB 5LQRA 1XF1A 4A15A 4YH1A 2JFWA 5J2TF 2OESA 1GQFA 1KEVA 1XJWA 1ZMRA 2VNHA 2YJ5A 4LPKA 5T57A 5KS2A 5IM4F 1L7XA 3WLSA 3K3PA 1CJUC 1I2AA 3CRRA 4FJ0A 1DJOA 2VLIA 5FBLB 1DT5A 1V5EA 1X0VA 2GTPA 3L43A 4URUR 4IHQA 4ARVA 3BZUA 2IYOA 4M9ZA 3PA6A 2AN4A 1CZHA 1L5OA 1V3VA 1FE8A 1JE0A 4C1NA 4YECA 2YVLA 2IP2A 4UHFA 3QJGA 4YB8A 1L7QA 3TIXB 3IUQA 3ZH9B 3KB6A 3AEKA 1U90A 5JY1A 1KXZA 2ZYHA 2ZP1A 4FR5A 4WN9A 4OCZA 4KDCA 4ZHQA 3GO4A 3FDJA 1JIXA 4MULA 2O8DA 1SC3A 1ECGA 1GFIA 1T36B 3N8IA 1ZBDA 1NQUA 2F2TA 1VMAA 2Q3DA 2UZ3A 3PNYA 3ZDZB 5B7GA 4WBNA 2BPOA 2R62A 5A4IS 1E1KA 1Y34E 4PIMA 3FTNA 1U7ZA 1KBZA 3UH1A 4ZHQF 3NTVA 3U5ZB 3JQAD 3VA7A 2PSEA 4IEIA 4WI1A 5LLDA 1U8TA 2B3TA 1BEUB 2GBFA 2J9YB 4RF3A 1UZMA 4CDRA 3ZDBA 3RVQA 1FMJA 1PJ4A 5A4AA 3F5DA 3P4YA 1N2HA 4M9XA 4CDMA 1X86B 3D4NA 4ETIA 1KOGA 2O8FA 4UARA 3L7AA 4XFKA 1GYRA 3W9SA 3G9ZA 3DE1X 1AHNA 2PZEA 3G0CA 4R54A 1Z2NX 1VGRA 1Z62A 2G09A 3BWBA 4PZLA 4WLVA 5KZMB 4OFXA 5JYBA 3DKIA 3GNQA 3KR0A 3LH5A 2AOTA 4IJWA 1CUEA 2PLNA 4TYQA 4P0PB 5DEOA 2OVBA 1ZKDA 4EMTA 4DLUA 2ZJZA 2XGOA 1O8BA 3QXHA 2CGEA 1PSDA 2XITA 4MRSA 3C87A 3GLHA 2QD1A 3D4OA 4OKIA 2O7RA 1IG3A 1VSQA 4WKGA 5A71A 1XRNA 5NULA 3ZHTA 3PDIA 4PN3A 1JJIA 4KFUA 4UUNA 5TE9A 1OX5A 2ZR8A 4NNPA 4Y6GB 2Q3FA 2CY0A 4J03A 3EPRA 4RZHA 1ECFA 2CVPA 3F47A 4TL6A 3PNLA 5H5JA 1Y9DA 3MUFA 2A9PA 1FNMA 3AFNA 3OUTA 1ZBQA 4X63A 3I2IA 2A5GA 4DWVA 1HFWA 4EG7A 4HNVA 1HQYE 1GFWA 2ES4A 2ZI7A 4QUHA 1XMSA 1X1AA 2HSEA 5A6VA 1P4JA 1SD1A 2QTVA 4PZUA 3TB6A 3UA3A 3JAWB 1US8B 3OPNA 2AMFA 3MJFA 4JOCA 4DBZA 1SCNE 1WEKA 2R4UA 3H9CA 1GLVA 1TCCA 2Y76A 3NGLA 4U2GA 2O23A 4GPTA 5F2NA 1OF1A 3EXG2 4MINA 1ZM3A 4RZ2A 3ZY4A 1KXJA 3E1GA 4O4HF 2Q1UA 3TXXA 2F8TA 3O4GA 3EVDA 4AMZA 1BMQA 3OU2A 3DZDA 4I4TF 4P3OA 2C5SA 2ZJAA 1MF7A 3EZLA 4FBGA 3GJTA 4TLDA 3BA1A 1A8HA 3SBEA 1HK7A 2ZYAA 1K68A 2PT9A 4NMHA 2ECPA 3MS2A 1QFXA 1E2LA 4HZGA 4MIKA 5DHSA 5DTQA 3UGTA 4RZXA 1V8ZA 4KBFA 3V8RA 3ZXIA 5LDGA 5C51B 3M9XA 4FFOA 1GGNA 1Z45A 2NNLD 3OKCA 4OQFA 3QUSA 4CU5A 1NMEA 2IEGA 4C3UA 3W5SA 1OBCA 3LCUA 1NIJA 3GA5A 3OF5A 3CLHA 5GGXA 1G8AA 3QPAA 1HA3A 4KH1A 1VDMA 1XALA 4E1VA 4EQ6B 2XB2A 1M6VA 1YQGA 1M9NA 3LDAA 1J8DA 3QY0A 1BDIA 2E0IA 2IODA 5TMEA 1B0UA 3GGJA 3A28A 1MEJA 4IIBA 2J3IA 2IDKA 5H3CA 3TZEA 4DY4A 1GZ3A 2INGX 4BCBA 4DA7A 5LZ9A 1C80A 3HGTA 2Q5LA 3WR5A 4A8JB 4A0QA 3HA5A 2NUTB 1UXGA 5TIIA 3GU3A 2FAXA 4BRUA 1G5RA 2GSDA 3S40A 4ND8B 4CLDA 2C07A 1H2HA 1SHJA 2QRHA 2ZR0A 3A3KA 4NBUA 3BH0A 4F3RA 4DJTA 1CEYA 1RQGA 2QENA 5KJCA 3RIMA 1JJAA 4P93A 4NS4A 5JBQA 2I8AA 3ADKA 1SC9A 2OFWA 2R9VA 3KV3O 2B21A 1F0KA 4FXOA 4HEJA 4TWBA 2R4TA 4UAJA 4CMEC 3F67A 5HIIA 4D57A 4NPHA 5JPCA 4LDJA 3WGKA 2XMDA 1DIAA 1RXEA 3NXKA 3OE7D 4HPJB 4HEA1 2PLAA 2E4YA 2UZ0A 5DK4A 4CDGA 2XRMA 3HUTA 5HZKA 4AKIA 4ARSA 4Y18A 4D02A 3K09A 5IXSA 3P9ZA 3PA8A 4GQIA 2ZSBA 3T5GA 4YCNA 3U40A 3H9GA 3PRJA 3QF4B 3TZKA 3ACDA 4TKUA 2N1MA 5BN1A 1GITA 2VDPB 2V45A 3IESA 4YDSA 5EHIA 4ZYWA 3RSOA 1DC7A 3LQRA 3QKIA 5ABPA 2J9GA 1UOQA 1KYWA 2NU9A 1FDTA 1C0LA 2DF8A 4MW1A 1H1TA 3R24A 4OFBA 4CDNA 3GLFE 3E5NA 2FJPA 3AP3A 2I0FA 1QAQA 2D00A 4KVAA 1NLFA 1ZCAA 4CKEA 1TF7A 1VTKA 1Y37A 4YAEA 1V4BA 5EEGA 5EIBC 3ESCA 3NBYC 2ON6A 4LWPA 5FOSA 1XI2A 1NVTA 5TMDA 1XMJA 3LCCA 3G9QA 3RBZA 1PSWA 1A4UA 3B5IA 4XYBA 5DI3A 2VBCA 3I9OA 4BL5A 4OY3A 5LP6C 3P9SA 4MUYA 1Y82A 3I6ZA 2JK0A 1E4OA 1VP3A 2GJ9A 1V26A 3OG9A 4FDUA 3OFKA 4NYIR 5EFZA 1GFSA 4WH0A 5AVOA 3ZNNA 4YXFA 3GD5A 3SGLA 4Q1FA 2Y4OA 3UWKA 4L9AA 5IABA 4JYPA 4OXXA 3V6MA 5IEJA 2X1HA 3IUJA 1MGPA 3Q3VA 3PEUA 3TJZA 4CLRA 5JH7F 5FTLA 1OC2A 4A5OA 3A6FA 3C15C 2DBZA 2B61A 2KI5A 2OFOA 2VQSA 1K4KA 1Y5RA 3H1FA 3BE6A 3KKKA 4LHYA 1HDEA 3UATA 1FTSA 4AS1A 3KJQA 1RRMA 1NGSA 2C4TA 3EZNA 2JVJA 2ZSUA 4MGEA 2AI1A 4MQFB 1W4CA 4MHTA 4UHDA 1GPAA 4U2EA 3GRAA 3W04A 4C0LA 3Q10A 2YWFA 3D0OA 1JHYA 4I19A 2FSSA 2PSFA 1EFLA 2YIMA 4ZO8A 3VYSB 2WABA 3GT3A 4B87A 5BSKA 2ZUTA 3R76A 1SHTX 1WDLA 1LWNA 4URXR 4IV8A 1XCJA 2AWNA 1NX9A 4M0LA 1SQ5A 3RUDA 1Y6RA 3THXB 3GYBA 3GJ6A 3G0DA 4BAGA 1V3QE 1KETA 5ESDA 3DUFA 1F8UA 3QE0A 4PZYA 1EQAA 4U3JA 3ZWKA 2C8VA 5BR1A 5LP6F 3TF5A 1LX6A 1N92A 5KYYA 1CS0B 3CF6R 1ABBA 2UYCA 2AG5A 3D8UA 2G07A 3K2BA 2B9VA 4EHBA 1M74A 2PUGA 2NVWA 3W9YA 2QZSA 1W29A 1G8SA 1YHZA 1H4TA 4CG1A 1Q19A 3DJFA 3WDMA 4H60A 1G41A 1U0HC 2C9YA 4X7PA 1WDWB 3ES9A 2Q5HA 2ZROA 1BHQ1 2XB4A 3NHPA 5BWMA 2Q5CA 3Q3JB 1TMYA 2I65A 1ENPA 4HQNA 4KSYA 4MYDA 4DR5B 1TOAA 3BT7A 2YHIB 3H2BA 4M0MA 4JQZA 3OX2A 1G6HA 4IS2A 2J46A 5BSUA 4OK5A 5EJ7A 2IBSA 1F0YA 5AW7A 1RTTA 2QTLA 3IGFA 5I8WA 2VCHA 5AW5A 4TZTA 3MMXA 2V6GA 2X5OA 2A86A 2G1AA 2WKRA 5E2IA 1GZUA 1U9CA 3QXCA 2YYZA 4Q7QA 3W5JA 3HKCA 2XB9A 1J2EA 3R77A 2XWBF 2WHYA 3GR6A 2PRKA 3WWEA 3TUZC 2O0HA 2R79A 5IC4A 4YHBA 4GXTA 4MOWA 2HSJA 3PU6A 4BEWA 1LD3A 1WO8A 5T8KC 4DGSA 3ADDA 3MTIA 4HNAB 3CCCA 1ADYA 5J63A 1QNFA 1EESA 4MA4A 1U2SA 2EATA 3KSAC 3O9ZA 3KXLA 3G88A 4P4TA 3RSLA 2QT0A 2VUTA 5CDHA 5KNBA 2XXJA 3NHBA 2V7BA 2JHCA 1FS6A 1RXCA 5EQDA 4OQZA 4JCCA 4TMVA 3N8GA 1O3YA 2ZJFA 4DWOA 4E2FA 4F3CA 3OC0A 1QOQB 2CVHA 2FUG1 1ZJZA 1IY0A 1H8HA 1V1JA 3E7FA 2GXUA 2JAPA 3JSXA 4ZEVA 5A5EA 1SCKA 4UUQA 1XPJA 3GROA 4AJLA 3RRXA 1ZRHA 3BMOA 4LXIA 3SXUA 2NUPB 3SZRA 3TPCA 1RM4A 5E0KB 3QVUA 5D5HA 1U63A 3KT6A 3BMQA 3LHFA 5BQFA 1XU9A 2FB9A 3PD1A 3OE5A 2VDMB 2XUDA 4EKYA 3JQ8A 2R1TB 3ZZTA 3E7WA 3D3WA 3ONNA 3KNZA 5BOSA 4YMWA 1KMHA 4J0DA 2WQZA 2FTKE 4N3BA 1RQNA 4FB4A 2XEDA 3CNOA 1CQZA 4HTFA 1N6LA 4RVUA 3PXDA 2GPJA 3GG2A 1USVA 3L77A 4K6KA 5CDTA 4JXJA 3R0JA 3RAEC 3IP8A 5JHGB 1K9SA 2C9MA 3F5SA 1OPXA 4PPFA 3V4ZA 4C0AC 5A0TA 4YUAA 1NV9A 1WW8A 4BX3A 2QE7D 3GLSA 1MV5A 1XP5A 4FFBA 4OHKA 3CVXA 1F17A 1T5BA 4R0VA 1A8PA 3D3EA 1MU0A 1RPTA 1V8PA 4ZAXA 4OM7A 5JSYA 3DBLB 3MYRA 3BAZA 3CLRD 3T9BA 3PEWA 2XOEA 2ACKA 1PR3A 1QTNA 3Q15C 1QYVA 2OGWA 1IJBA 3AXSA 2XDYA 2YXBA 3DOHA 1M1ZA 4ZVNA 3WGNA 5T67A 1Y8QB 4RACA 1SBIA 1JA9A 1JKJA 4H6PA 1NY6A 3H87A 5IKEA 2HOQA 5F7ZA 2C59A 5FJJA 3LP8A 4DMLA 1E18A 1IZ8A 1HE3A 3DXFA 4DNPA 3B9QA 1YB5A 4Q9JA 4CF6A 3ZIUA 5HOEA 2Y1LA 1X2EA 2LUOA 2ZWOA 4Q4JB 3EEIA 1U9YA 4I3HA 2C7QA 4BASA 3OZ7A 4MZXA 1F9EA 1HQCA 4GW3A 3ZV4A 4BY9E 5D3MA 1GZ7A 1E3JA 2BI7A 1SOVA 4LDAA 4ME6A 4ND4A 2XWPA 1QH8B 1SZPA 3LPAA 2QLFA 3QNMA 4MPJA 1J90A 4FMBB 4TWZA 3HJGA 3TW8B 1GPWB 4MGIR 3W77A 2C84A 1Z2AA 2FH5B 1OWMA 3A4MA 3FYHA 3V4LA 5FHQA 2OV2A 3PHIA 1Q92A 2R5NA 3QU7A 3OQBA 4TN5A 4BO3A 2QROA 3AONB 4OHWA 3RSGA 1OGJA 4F4HA 1S4QA 1HUQA 3U4MA 1X7YA 5AIAA 1GKUB 2OORC 2P30A 3M0EA 4P4SA 4O1IA 2R6GA 3LLMA 4WOKA 1X8LA 2WVJA 3EGWA 4LYFA 1T5DX 2W7TA 2ATVA 4S1NA 4YRRA 4QQRA 2XYVA 1GQ2A 2LTAA 4KDFA 4KFSA 4OP3A 3MWDA 3PDCA 4MW4A 3T5MA 2JI9A 2PY6A 1R9JA 2I7DA 1YZ3A 4DLNA 1RKBA 3BFPA 3OOEA 4RELA 1DC8A 2EWVA 2H4HA 4G5XA 1P1FA 3O92A 4EZEA 4MRAA 2EKLA 4HWTA 2GD6A 1JBKA 5IG2A 1XTIA 3C3MA 4JA2A 4M86A 4NS1A 4XXHA 1GQRA 4PRYA 3ZY6A 4Z1OA 5KQGA 3B38A 3ZWOA 2DERA 2BMAA 3ONFA 4BXOB 1O94A 4N8SA 4AULA 3X2SA 2VIIA 1NE2A 4Z9BA 2AFVA 3UJ7A 4R01A 1Y63A 3M3DA 2FDXA 4QPDA 4LF6B 1KAHA 2JGIA 3EIUA 2PUVA 2XDWA 2Q1WA 3RRZA 1M33A 2O2EA 4BNMA 4BVFA 8ADHA 3M81A 3UBTA 2V0CA 3WZMA 4GXNA 4LDNA 2WAYA 4X3PA 1UBFA 5ADUS 4MS3B 1DQNA 1EHIA 4AJPA 5JH7A 4EUFA 2XDQB 1IMOA 3DQPA 2D2EA 4ALLA 5BSWA 4GZ6A 1I7DA 4BRSA 5F3WB 2BGIA 4FHFA 5FPQA 3QBTA 1O5OA 1YB1A 4RQAA 2WD8A 4EQZA 4IQ8A 4DWWA 3ETEA 3SHQA 2ZBFA 2LDBA 1AKNA 1MPTA 2CSXA 1BDBA 1W88B 1XQVA 1LFAA 2PAAA 3BIFA 4INOA 5DH9A 1R9NA 5EP2A 1PSZA 4DMUB 8ATCA 4IBOA 2CNWA 1YTUA 1E69A 1JQBA 1LTHR 1S3SA 2EGUA 3I9NA 1D0VA 4WV3A 2XZOA 1PLJA 4DV0B 4QOJA 4CLOA 1OWOA 2FVXA 1Q1QA 3ZUGA 3UK6A 2PQMA 4R9VA 1C5KA 2PMDA 2ZIWB 4G0NA 4NOJA 1C7IA 4UMEA 4G8BA 3MJEA 3WIUA 3GEHA 2ZM6B 3W2TA 5ENDA 3JCZA 5IYZB 4LXUA 4FDVA 2ZS7A 4BVJA 1QIKA 1O0CA 4FLMA 3I3OA 2N3ZA 2CHEA 4V0MA 4RPLA 3I5XA 1NJGA 3SICE 5CGZA 3MD9A 4O4JF 1DRUA 1EE1A 2SBTA 4UAGA 4YRIA 1EBFA 3GDFA 1JKXA 2O6HA 3P97A 3EY4A 4H7IA 3GI1A 4FN5A 3CO0S 3R3JA 5EKTA 2IYVA 1R6BX 3KWLA 4G86A 4J9UE 1XNHA 3KQWA 4OLHA 2Z1DA 5JO0A 3FNRA 3H2IA 1NPTO 3L1JA 3TG2A 1IQ0A 3AQ4A 1T15A 1VKZA 3UWOA 4KZPA 3WY9A 2RAFA 5I8PA 5IHPA 2EJVA 4LYHA 1JLLB 1DVRA 3MGBA 4U7DA 4RZSA 3LUGA 4GF5A 4WE3A 4ES6A 5E9QA 3K6KA 3MWKA 4JLBA 1QZXA 5CU7A 5JATA 1VG9B 4KQIA 4X71A 2YFQA 1V5GA 3R7NA 1V6CA 3HKDB 3I2KA 1NOIA 4Z8XA 4CL2A 5FL7A 2PS1A 3JQQA 3QPCA 4GBMA 4BV9A 3KQHA 3IKMB 4QEDA 3F8TA 3BPSA 1U3TA 4G63A 4E6EA 4EKDA 3STXA 4BP9A 1Y8QA 3OPXA 4BN5A 2FSVA 1QZ3A 3X1ZA 4ZI5A 3OZRA 5FBVB 4G0VA 3EDOA 3CGWA 2ZB8A 4OLAA 4QAQA 1NJ8A 5COQA 3I04A 2FWRA 1QVWA 3DEYX 4Q7MB 1NNEA 1QC5A 1DTWA 3E22B 4BGVA 3IPYA 3S8YA 1E6CA 2GPWA 2B7LA 2W8BB 2Z58A 5P21A 2WSSA 1VKOA 2Q0SA 2BWJA 5BNIA 4HNGA 2HJVA 4JUDX 1N5KA 2R97A 3ZJ5A 1E98A 2X3FA 3TLMA 4YPFA 4JA0A 3SKXA 1XL1A 4B3JA 2BM8A 1JDBC 2Z6VA 2G7MC 3BJIC 3LOQA 3HFGA 4OGKA 4Y2UA 3CINA 2X9VA 4FLEA 2CL5A 4IVPA 1A7KA 3LRPA 2ACEA 4DMHA 1BS9A 2X8JB 4ND2A 1KQOA 5AVSA 1PJ2A 2IYNA 2QWXA 1UBLS 1T1EA 1WULS 3EFEA 3B78A 5DP1A 2M98A 1BAPA 2YNMC 3UK7A 1JT2A 3WWYA 4EO7A 2XYPA 2XUIA 2XQJA 4EW3A 1PK8A 5C7YA 2GM9A 1FSPA 2ZDGA 4GNKA 4KEAA 5ITWA 3DMTC 3LIIA 2ODNA 4NVRA 2C5BA 4L0DA 5CYPA 3BMCA 1DC5A 5LQUA 1UJ6A 2NTVA 4J0IA 2GAFA 5FRDA 4O4IF 1MIOB 5CH8A 3IDAA 3VYVA 2XQVA 3MJDA 1YUMA 5CDFE 3ET5A 5KVVA 4DTCA 3KYJB 3TQTA 5LWHA 2Q2NA 2V54A 3JQFC 3ORFA 4ZZ2A 1EFPB 2PQ2A 4LZWA 1PJ3A 1V8BA 4NMXB 3T54A 1ZCJA 2WKQA 4Y6SA 3IRUA 4YMIA 3ZLVA 2X23A 1QNLA 3LY5A 4RFVA 1RJEA 3IEVA 2QVGA 2GPTA 2Z4TA 1A5TA 3OPVA 4BNJA 5DN6A 4MDHA 1EWQA 5D87A 3RAGA 3HJFA 3F1KA 4AVYA 3E9DA 2Y9MB 5K99A 3L8FA 1FFCA 2QAGA 3U5TA 3G0HA 2AMVA 3H5TA 2R3SA 1BXGA 1NY5A 1V1MB 1XYVA 2NSLA 4HQ6A 4KMRA 3SJUA 5CBKA 1Z4QA 1FYEA 3X0DA 2C95A 5H8WA 2WU8A 5BSFA 5AVQA 1Z6AA 4CM7A 3RVDA 1ZITA 3O03A 1LRKA 1TC2A 1Z75A 1Z39A 2H9AA 2I3DA 1Z37A 1AN9A 1GPNA 3LPMA 4JLOA 4KMOA 4MKFA 1A8SA 3G5MA 1VCIA 2G4CA 3Q7EA 4HR7A 4N47A 5BWBA 1RQRA 1N2GA 2P6PA 3VR4A 5H02A 2XGJA 2NYVA 4KX3A 1KAOA 5M3BA 5BW4A 1GZHB 3G82C 1IY1A 4KU4A 4PFSA 4GI5A 3RSCA 4B33A 2GYVA 2WSSD 3A6KA 4AI6A 2ASVA 1AHIA 2QW8A 2O0MA 1E2UA 2SCUA 3O84A 2PUTA 3CF0A 4Y2TA 3FYTA 3ICWA 3VVCA 1EUZA 5AJHA 2G08A 2IPOA 3KSZO 4C7JA 4E13A 4RGYA 3PWSA 2FX3A 4H18A 4BB6A 1PT9A 3P5BA 4DQVA 5A9SA 4WESA 2DBQA 3M9LA 3KQNA 3GAMA 4Y3UA 1QCYA 5C3UA 2YWBA 2HU5A 1HQDA 3KLMX 3I5YA 5LZ5A 3KZKA 3INYA 3LYLA 5DKFA 3A6DA 5LYYA 5DN6D 3COJA 2V7GA 4FSXA 4X9XA 4YCSA 2A88A 2ERYA 2ORIA 3NCHA 3I64A 3U3MA 4A0FA 2I22A 4GPD1 2WMNB 3DE3X 3REFA 4CM1A 3IMEA 5J4LA 3QPDA 1KC1A 4BE4A 1FP7A 5E4YA 3H8SA 4BBAA 1NUPA 5EG5A 1T3ZA 1Z4LA 3N39C 1A9RA 2AN5A 4IDCA 3RYCB 1G2QA 3P9RA 2UZAA 2HRQA 4N3AA 1XOIA 3N6RA 3RIYA 4HDSA 4A10A 4CF7A 4XA8A 1G55A 3IUPA 3I4CA 5ES3A 3KYIB 1L5GB 1KYVA 2VJQA 1UMDB 1YDEA 4H15A 2VBFA 3T3MB 3PR3A 3ROFA 3BBLA 4DMCA 1QRSA 1D6SA 1IM5A 3L7MA 4GUAA 4LZPA 4QOIA 1SWVA 1XZQA 2HV8A 1SG6A 3QWBA 4FILA 1ZM4A 4OUKX 3ZI4A 1MQ9A 4DJJA 3BWXA 3HVHA 1ESNA 2WC1A 3CEMA 1VL8A 5C2JB 5DW3A 4BO8A 5KTYA 3ZCQA 3VDRA 4J49A 5J23A 4HZUB 3RTCA 1N6RA 3AF3A 1AA9A 1F0PA 2GHQA 4CCSA 1RQ7A 4QFBA 4HG2A 3TGPA 3E61A 4PLHA 1RWOA 2AI3A 2EJWA 3AETA 3OZUA 4JL6A 5M5BA 4GL2A 3KTOA 1UPBA 2D5CA 5L4SA 2G36A 3KZVA 5FEMA 2ZEJA 3JTEA 4ZMBA 5IZ4A 5LXTA 3FOCA 3AI2A 2WD7A 3DE4X 4K9KA 3OA2A 4GOMD 3KR2A 5DV9A 4K9QA 1BCRB 3GP3A 3RJTA 3NUZA 4P81A 5YASA 1ILEA 3UJ8A 2J0UB 1KRXA 2D0PB 1H8EA 1B0PA 1YIDA 1ZGCA 4TRMA 1Y1RA 1CDZA 2X8AA 2ZS9A 5DLQC 3BEDA 3VQTA 4XDHA 2B8NA 5JSHA 1IXKA 4BLWA 1R2QA 4AMBA 1UKEA 2XTJA 3CGGA 4IP0A 1XZAA 3O4RA 4YLYA 2AC7A 1AY0A 1PHPA 3HB5X 4IW3B 4CQMD 1YR8A 2GBLA 3K8OE 4OMCA 4QARA 1U2QA 3EFHA 4YRFA 1SOWA 4XARA 3CS3A 4BC1A 5HQTA 1L7VC 3G6KA 5C4MA 2B78A 2VPIA 1VE5A 4I8XA 2I2DA 4HAIA 1JAYA 2Z9CA 1CIPA 1A98A 1P2GA 4Q34A 3WZ2A 2VYQA 4MRMB 4O63O 2IKSA 3PI7A 4TROA 5CXXA 3K09C 5KC8A 3L8EA 4D9IA 4RWEA 3FWNA 1KIFA 2A8YA 4I1OA 4NBRA 5ECDA 1JALA 1DBVO 1EDOA 2TMKA 2WICA 4GLBA 2WPDD 5EJ6A 1Q15A 5EIAA 2JG3A 4OLBA 1FRFS 3LY7A 1X7YB 4ND5A 4YACA 2FUG6 2B4KA 3FVRA 3IUNA 1I6WA 1GY8A 1TZJA 1JHOA 3Q6MA 4LQLA 4XD7D 4F8JA 2ZBRA 3NBUA 4GZMA 1AHHA 3O7MA 4R6XA 5EJMA 5KINB 1AG9A 3IDFA 3L4SO 4GMXA 4K28A 4EHIA 4XPIA 5ALXA 4UOEA 3DMNA 4Y2XA 4DIUA 4D3FA 2AK2A 1XZDA 4UZEA 5AHOA 5J2TB 4R98A 1V48A 3KB2A 4J1QA 4A6DA 4I50A 2WSIA 1LSSA 2EHDA 2HCFA 3IEXA 1GCUA 1UDBA 1K7XB 1UPCA 2IOHA 3MAGA 4HWGA 1ULUA 2Y8EA 1SBHA 3X2FA 4EF6A 3WC4A 2JAXA 2AC2A 4MUAA 4QLAA 2UVPB 2M1XA 4RV5A 3A7DA 1VBNA 3NVMB 3FKQA 2DP4E 4MVYA 3T3DA 3LGXA 4IO1A 4EI7A 4G4GA 1XJ5A 1YNOA 1VJRA 5ALZA 3KQMA 1U2ZA 4FYWA 2I4RA 4PG7A 3EQ9A 4J6EA 4NNJA 1PN3A 1N1MA 3L7CA 5THKA 3ZE0B 3TO5A 1E9DA 2V6BA 2QMYA 4FNGA 4F9TA 1J22A 4JXXA 1UAAA 1FSSA 3PQ3A 3QFFA 3M83A 3P32A 1O0SA 5I7RA 2P2GA 2JLBA 3G2IA 1YCGA 3PD0A 2P35A 4DVGA 1NXVA 1B4DA 3NH6A 3MQFA 2VZ0A 4OI2A 3SQWA 2QM0A 4RH3A 2ORYA 5KTOA 3P2YA 3RU2A 3PNQA 3S1AB 1CB0A 3I2JA 4C3ZA 1R5BA 2X0KA 4JB0A 3ZD9A 2O1WA 4N48A 1MB0A 3RRJA 4RWZA 4HGOA 1CQIA 2CBZA 3DEIA 4ZPJA 3FVVA 1ODTC 1TJ3A 5GJCA 1Y6FA 3Q12A 4NE7A 3JALB 3TRJA 5H4HA 4HDMA 2HA0A 4RESA 1U7PA 1KZHA 1THMA 3NNDA 1OR8A 4EJSA 5AI5A 2ODPA 3A14A 3E8SA 2DWOA 2D2XA 1TA0A 2QW1A 5JI3E 1XWIA 2ZIVB 3BB1A 3EVZA 3FIJA 3D54D 3WGJA 4DM4A 1GADO 2HKIA 1XMQB 4IMJB 1PYDA 3QTBA 1KJZA 4G1UC 1KSFX 3V42A 1NJ1A 1T9GR 5IWCA 3SQXA 2BGTA 4G1EB 1RACA 4JITA 1EYZA 3H5WA 4MKRA 4HDQB 4DIBA 5ICSA 2H0QA 3B2QA 3DZJA 1O89A 2XOKD 3I1FA 1X77A 3NTQA 1OTHA 3IDSA 4FE4A 1MJGA 1OXSC 2GGSA 2R6R1 3BG5A 3OIDA 3OEEA 3WL4A 2VF8A 2CLEB 2P3OA 3MBKA 2AS0A 4OIMA 2CUTA 2WMOB 2CLMB 5I7HA 3BXGA 3I52A 2QW0X 2LV8A 4QYMA 5BN3A 3GYGA 2WT4A 2Y0DA 1UWVA 1BROA 1ETHA 2CYCA 3PD7A 4J7UA 4M1SA 3U7FB 4YRAA 3VU8A 5HP4A 1YR7A 1X42A 2ZRMA 3OJCA 1KOLA 3RAJA 4BO0A 3R9KA 1BN7A 1PJZA 4JX8A 3R6DA 5M04A 1WPGA 5LQJA 3LT2A 2E6KA 2A0WA 4QBFA 4EHFA 3K0EA 3ROTA 2ZBQA 3E2PA 1I01A 1U1EA 3H4MA 2Q3CA 2RGGA 3AEKB 3UMCA 1OQAA 2G72A 1K3UB 3B3FA 3HMQA 3LZ6A 4PLTA 2O19A 2B4YA 1GAWA