2JICA

High resolution structure of xylanase-ii from one micron beam experiment
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
189
structure length
189
Chain Sequence
TIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein Crystallography with a Micrometre-Sized Synchrotron-Radiation Beam.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords XYLANASE-II
total genus 55
structure length 189
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2007-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2jicA00
2C1FA 3VHPA 4S2HA 1XYNA 4HK8A 3VGIA 1F5JA 2VG9A 1OA2A 1H4HA 3VL8A 3VZJA 1PVXA 5K9YA 1BVVA 2DFCA 2D98A 3WT3A 3AKRA 3B7MA 1HIXA 1REDA 3LGRA 3WR0A 1REFA 2Z79A 2JICA 3WP5A 3AKPA 3VZMA 1OLRA 4HKLA 2DFBA 1BK1A 1QH6A 3WP6A 3VL9A 1KS5A 1REEA 1BCXA 1ENXA 3WY6A 3M4FA 3LB9A 3WP3A 1XNBA 2BWAA 3AMNA 4S2DA 1W2UA 1C5IA 1UU4A 1YNAA 4H7MA 5EJ3A 5HXVA 1UU6A 4HK9A 4XQWA 3RI9A 3WQ7A 3AKSA 2B46X 3EXUA 3WQ1A 3AMMA 4S2FA 2VGDA 1XNDA 2QZ2A 2NLRA 1TE1B 1OLQA 4S2GA 3AKQA 3VZKA 2DCKA 3VLBB 4HKOA 3ZSEA 3RI8A 1HV1A 1NLRA 3MFAA 2QZ3A 3VZOA 1T6GC 3WQ0A 3AKTA 2B45X 2NQYA 1XXNA 1UU5A 2DCYA 3MFCA 2F6BA 3HD8B 2DCJA 1H1AA 2BWCA 2VUJA 1C5HA 1XNKA 1H0BA 3WX5A 2BVVA 3VZLA 1OA3A 2D97A 4XQ4A 3VHOA 2B42B 1XYPA 2JENA 3MF9A 3WXPA 3AMPA 4XPVA 1H4GA 3O7OA 1AXKA 2VULA 2BW8A 4IXLA 1KS4A 3B5LB 3MF6A 1XYOA 1UKRA 3AMQA 3WP4A 1OA4A 1XNCA 4NPRA 5K7PA 1HV0A 4XQDA 3VHNA 3AMHA 2DCZA 4HKWA 3VZNA 1IGOA 1H8VA 2JEMA 1QH7A 1M4WA
chains in the Genus database with same CATH superfamily
3SH4A 4PLOA 4S2HA 1NA1B 3GALA 1AR63 1DDLA 1RYYA 2E6VA 1UAIA 2F4PA 2XB6C 5FYTA 4B29A 1OLMA 3MGUA 4AI0A 3FHAA 3JCIA 2ET1A 3NSTA 3SXWA 4Q4Y2 2DYCA 4DS0A 1JTZX 5FQ0A 3O1UA 1XPWA 1AR62 1XNTA 1SZBA 3MLLA 4YW1A 3POGA 5JWPA 2X10A 1OOPB 1PO13 3AYAA 3ILFA 4H2AA 4IE6A 1S2KA 4B8EA 2VZQA 1ZBE3 2W1UA 3VBHB 5FK7A 1W3XA 4LBQA 1QOSA 1X36A 2W92A 1ZRRA 2ID4A 3GJBA 4KL1A 5FUNA 3AP5A 3BKZA 5DUXA 3DXTA 1DHKB 2JD9A 5A33A 4FI9A 1U5ZA 4F83A 3CJIB 5JMOA 1IKPA 4R9DA 5G04L 4IV1A 1IZ3A 4UF0A 3O14A 4QX8A 1RUC2 4CCOA 3N9PA 1DQ6A 1R093 1WMFA 2HYKA 4PF1A 4S2FA 5LY2A 4XF4A 3WF3A 1JBCA 1GANA 2C9KA 2Y38A 1O4ZA 3FHIB 2ZEZA 3T4VA 1VRH2 2W08A 3USUA 2VQTA 1V00A 3AVRA 4CEYC 2DU1A 5T50A 5EPAA 4AQ2A 3N9NA 4X6RB 4LPLA 5IAVA 3MYXA 1OFNA 3VLBB 3ZSEA 1CQ9A 4AZZA 4BH9A 4DXZA 1ZBA2 3D5OA 1DIWA 1ULEA 2HWB3 2R062 2CL2A 1LJ7A 2R32A 2W2IA 1GU3A 2E31A 4BK4A 1QDCA 5LA0A 1JYNA 4DEQA 1OOPA 2VQAA 4ZXKA 1GR3A 3E5UA 3M1HA 2FMDA 4LTAA 4LBKA 1RUG2 3LA3A 2EALA 1R081 4YVSB 3ZYFA 3ZYGA 3TAYA 2BUKA 2A5ZA 2WZR3 2DCJA 1H1AA 2VZSA 4AHZA 3MW2A 1COV3 1FAYA 3NJYA 4JDMA 1PGW1 5E1RA 2VW2A 4RHV1 3DUIA 1GNHA 1NA1A 4HVQA 4NN0A 2XQRA 4NAMA 1X82A 4XIKA 2VOTA 3LOBA 5DABA 1J3QA 1DZTA 2WQ4A 2VMDA 2GZWA 2A7AA 2OPWA 1E5IA 4FPCA 4M00A 5E8AA 2XJRA 1GKBA 4EN0A 2GNBA 4Q1PA 1WLTA 2A6YA 5C7GA 4DY5A 3T0DA 2Q5TA 1D2QA 4PBPA 2W39A 4BISA 2Y0IA 1WW6A 5ANQA 4CDWB 4LJHA 4MGZE 1NZIA 3ZXGA 4CEYB 4LIVA 1GWKA 4W4ZA 3L2HA 4CVUA 4GA9A 3WHTA 2CSGA 1CPNA 3FUOA 4K21A 5KHJA 4WM8C 1JZ4A 4CYDA 2ZGMA 1LU2A 2EAKA 1BEV2 2GU9A 3ZFEC 2BNMA 4IE0A 3LCPA 1PX3A 3KGLA 4DEVA 1NG0A 1SFPA 2EIGA 4NRMA 1GQHA 3POEA 4XFBA 1NE6A 2R0FA 2Y26A 3IDBB 3OGGA 4LUKA 5B4NA 3NV4A 2GDFA 2ORXA 3N9OA 1VMHA 4HK8A 4K8RB 1LESA 3IM0A 3USUB 3IZOA 2D44A 2WNVC 1ODNA 1BMV1 1OXCA 1J83A 5FZOA 5LWBA 3O1TA 1RUD1 2OQ6A 2A3YA 3WV6A 1W2TA 5GJ6A 1IQDC 3AXEA 4IEOA 2GN3A 4DQAA 3PVBB 3U0ZA 1QDOA 2JB4A 3AXDA 5J48A 1FOD1 4U2AA 3ZPYA 5FOBB 4XAAA 1O4TA 2VOWA 1WKYA 2JG9B 3FLRA 3F2ZA 3JB8A 3KV4A 4COVA 1S0IA 3SCFA 4RA0A 1OMIA 3J8F2 2DBIA 4S2DA 4NRPA 4YVWB 4BA6A 3OGSA 1F9KA 2VZ1A 3RJRA 3LEIA 4ISRA 3ZVXA 4CP9A 1VBB1 1EAH1 4WVMB 1NY71 3H50A 3DF0A 3BPSA 4PJYA 4YGDA 2PLV1 4XC9A 1GP6A 3KCCA 3IDCB 3KVBA 1RB8G 4BMEA 2Y6JA 3VBHC 1WCSA 3P6BA 1YO8A 3B00A 5IVCA 1ULFA 3V0BB 1PIV3 3PLQA 4B1LA 1OD3A 4L8QA 5FPXA 2VJXA 4TN7A 5GZFA 5CG9A 1LOGA 3RZJA 5E89A 2ZMLA 4JGZB 3POWA 4Y20A 3NJXA 3U4SA 5JMCA 1AR83 1QJX3 1ODMA 3VKNA 4N43C 1MQTA 3GHMA 1VE0A 4N53B 2BP6A 3T4HB 3ZFGB 1IS4A 2P34A 2XH6A 1NA1C 1UIKA 2ZOEB 1WCDJ 1DLCA 2CDPA 1UOBA 3FMGA 1L7LA 1HXS2 3DN7A 4M3CE 2OT7A 5IUQA 2B8MA 3I2KA 2WA3A 2YBSA 2ADEA 3M3CA 4ARXA 1JZ2A 2UU8A 5IWFA 3ZXEA 4A42A 4B4RA 1HB2A 3HMYA 3VZLA 2R061 3IAQA 3HNBM 5H9RA 3AP4A 5FOJB 2RDNA 3PU3A 3LIGA 3SEEA 2ARCA 1YJKA 3TB0A 2BBVA 2WO3A 2ZXQA 5FJKA 1OQDA 2RR11 2D3SA 2YU1A 3K4ZA 4B4PA 4XHBA 5BNOA 4D7YA 1PGL1 4M01A 3ABZA 3AJYA 1W2AX 2A3XA 2O0OA 4NIDA 3AVSA 3W9AA 3W5NA 2GALA 1VBB2 4IXLA 3BTZA 2SBAA 1KGYA 4YVSA 2IC1A 2XJPA 1ASJ1 2PA7A 3H3ZA 5HV4A 2ZX4A 5FWEA 2WYSA 4IEZA 1H30A 1XNCA 4UF0B 3DPRB 4MHRA 4UW5A 2GC0A 1UY4A 1OPMA 1X7NA 4QT6A 1US2A 5BNPC 1MEC3 3N36A 1AX2A 1U0AA 1ZVFA 4PLNA 1G9BA 2WSVA 3TEWA 5T5PA 2ZGTA 3AZVA 4MSVA 1PIV2 1XSQA 1PVC1 1O3RA 2Y64A 5CVRA 3OB8A 3ZFFC 3O0WA 3U14A 3WCSA 2WBKA 3AYEA 2CWSA 2HEVF 1GNYA 3C2UA 4Y22A 1ULCA 1V0AA 1AYM1 3KCXA 3KD4A 4GD4A 5IVBA 1WCUA 5F3IA 1DYOA 5FZBA 3RPQA 2UY8A 1LU1A 1UX7A 2WZPP 1CJDA 3GJAA 2N7GA 1HXS3 2LTNA 4AVAA 1YI7A 2QJVA 3AZWA 4MGQA 2DFBA 2RMU3 4GMP3 4WM8A 4Q8KA 5CADA 4WM7B 3PVOA 1BEV1 3NKTA 2VZ3A 4YARA 2Z69A 3HNMA 4RFRB 4DOUA 1GZWA 1L7RA 1BKZA 1XNBA 2FCTA 4M0HA 1VAMA 2ZHLA 4INDA 1FPN3 3AMNA 2A3WA 4HPKB 2ORZA 5FP7A 3AP9A 3FJSA 3WZ1A 4CDXC 4COYA 4DUWA 5FYHA 5JZGC 3PVEA 4O7XA 4CUCA 3AKSA 3SH3A 1UNBA 1D4M2 4J25A 3B9IA 2CWMA 1J59A 3EO6A 3NNLA 1RHI3 2WABA 1JH5A 2YG0A 3GZTB 3I59A 5BPXA 2RS12 3UKNA 3R05A 3JD73 2Y6KA 4CDXA 5F5CA 5JPMB 4DNYA 4V1PA 4FFFA 2C5DA 5JUVA 4YGEA 4MGTA 1R083 2IZWA 1NLRA 4URAA 5FZ3A 4Q4W3 4Q0UA 2VUDA 4NR1A 3RYPA 2AACA 3O12A 2J1VA 1IQAA 1OKOA 1CIYA 1PVC3 2IXJA 2AEYA 1NQDA 2PAEA 2XJUA 2GC2A 4X8NA 1EPZA 4R9CA 5IK5A 1CAVB 3T1LA 4J1WA 4LQRA 2Q30A 1LOCA 4LORA 2VOKA 1OURA 2YV8A 5F5QA 3N7KA 1S4CA 3OGRA 4W6XA 1QJZA 1AR91 4IEUA 3SLIA 4ZU7A 3I8TA 2FZ1A 3CBNA 3CJIA 1YQCA 3BGAA 3NNJA 3SKVA 1POV1 3EYPA 3VBOC 1OSGA 4MLOA 3N3HA 5F32A 5GALA 2VXJA 4CA9A 2BV4A 5FY1A 1F5FA 5CAZA 3MLKA 1RINA 2VD7A 1ZM1A 1DP0A 2RJKA 2BQPA 2XBO1 3EJKA 4FP3A 5L73A 3WF2A 5A1AA 2OKXA 4CDUB 4AFCA 3I59B 3ZFGC 4CCMA 4EYUA 2QFEA 4UFLA 2ENRA 2O14A 1UXZA 5C5TA 5FMBA 3IMMA 4CU6A 4XF9A 3OD4A 5KHGA 1UXXX 3MLJA 1JZ8A 2TNFA 2JWPA 1S0DA 4BQ5A 3KS7A 4YW6A 4CDQB 1FOD2 1LKNA 2XLFA 5D2AA 3GXUA 3NAPC 4HFSA 3GGLA 4AEDC 4JQTA 1RUE3 2P3YA 1GNZA 3K48A 3NJZA 1WW5A 3TNPB 4NJ4A 1UZVA 4Y1UA 1RHI1 3KV5A 3S7EA 3J7HA 1S0GA 1XC6A 2VVDA 3NWKA 5L7OC 1IPJA 4XCBA 5FKCA 4B3NA 4LKEA 3LKJA 1OVPA 5FZ6A 5FZGA 4QMAA 2ZAHA 4AEDA 1JMUB 2WNVB 4Z07A 1W8WA 2AEZA 1VPHA 4UOJA 1PMJX 1AYM3 4RQPA 3LPFA 2JDYA 1DBNA 4GWIA 5AFEA 2FCUA 1R092 1Y9MA 5GKAC 4QQHA 5CKNA 4CXYA 3CDZB 5K9YA 1S0EA 1V6JA 2ATFA 4OVEA 3ZN6A 1XBFA 3NL1A 1W8UA 2R043 5FY7A 1HXS1 4YRDA 3H7YA 5CYYA 5DN2A 3OEBA 1HIXA 1YQ6A 3GBGA 3DYMA 1AYN3 2RMU1 3MV11 4E8CA 5B2GB 4LLFA 5FV3A 1MQTC 3HVDA 3VD5A 1AR93 2P3IA 3O1SA 3H8UA 1JYWA 5LEKA 1RUJ3 2ZEYA 1CAWB 4C1WA 5FO8B 1Q43A 2BGOA 2BGCA 1IS6A 1ALYA 4PDWB 4Q4Y1 3WP3A 2BPA2 4CP0A 2J1AA 1CD3G 4O9EA 3Q8FA 1RJ8A 2IFRA 4RL7A 1DQ0A 3NO8A 5F3EA 4G3YC 1FNYA 2ZBJA 3ILRA 4U36A 4NUBA 4YLZA 5IVFA 1APNA 1ULGA 3DXUA 4YNIA 3VBFA 3D6EA 4CSWA 4YVWA 1B35C 2VGDA 4NIIA 2XKPA 3ZM8A 1ZRDA 4AFBA 4LBOA 3LQCA 2W95A 4BQ2A 5BNOB 4P00B 1GFF2 4XJUA 1LHOA 1RUE1 2A6VA 1ND3A 4P14A 2IXKA 2P6CA 1HV1A 1EY2A 2PMWB 2IWGB 4QGLA 1EPWA 2PQQA 2I74A 1K45A 3QBQA 5BV6A 4AHYA 1F4HA 1I5PA 2DDUA 3WW4A 4UBGA 3RGBA 2DUOA 4NHMA 4H14A 3IN9A 2XG3A 3FE5A 1Q5OA 1V70A 4P9GA 3HD8B 2DU0A 4NROA 3A0KA 1MQTB 2JECA 4FPEA 2JDMA 2WNVA 1GOFA 1VRH1 3POYA 4O61A 1VBD1 3WX5A 2VNVA 2RJ2A 5FZCA 4CDQC 4DPNA 4Y5Z0 3THCA 4DFSA 2JKBA 4XUQA 1I3HA 1WZXA 4UW6A 4UFJA 2DF7A 4OI0A 5FP8A 4XILA 3I3MA 2YZ4A 2ZS6B 5A32A 2K2SA 1LECA 1DGWA 3GNEA 1IPSA 4I3PA 1QY4A 5GLTA 5T54A 4EWDA 2VZTA 3S0MA 4FAHA 1H1IA 2XLAA 5T5OA 4E2SA 2RVAA 3WINE 2B9VA 2C9AA 1XU2A 1MZ6A 3KSCA 5DAPA 4QD2A 4A6OA 4CP1A 5FYUA 2EIBA 1LULA 3DKQA 4IQPA 1URXA 1RUH3 4EE2A 4NPRA 1RVF2 4Q29A 4LKFA 1YXWA 4DUXA 2NN8A 5FZHA 2UYAA 4FPGA 1ZZ8A 4D6RA 3TN92 3VZNA 1RUD2 2VMEA 2JE8A 4I0WB 4BZ4A 3H8OA 5F37A 4RS5C 5C3SA 5BNPA 4LBJA 1BBT1 1SLLA 2EA7A 2XBO2 4JGYA 5IW0A 3BPZA 1ENQA 4R4XA 5J1XA 2HWC2 1HRI2 3VGIA 2P3JA 4EROA 3PUSA 3MIGA 1MS1A 1SHWB 2UWAA 2KR2A 2GNTA 2ERFA 4QKFA 5KBFA 1WW4A 2YPJA 3POSA 4DUVA 1BEV3 1QQP2 2E33A 2JDAA 2VOVA 3LDRA 4HONA 5DDJ3 1TNRA 5FCCA 2RV9A 1Q8VA 1QH6A 4RR3A 4KH9A 1OUXA 1VBD3 4UFIA 3UGHA 1JN2P 1SLAA 4KI5M 5IJRA 4FTSA 3WY6A 2AENA 1Q8SA 3ZSKA 4D7SA 1LGBA 3AL5A 2VBDA 2F17A 3IT8A 3W20A 1LB2A 4M4PA 3CKHA 4P08A 4A3ZA 3ZXLA 4LHLA 4RGKA 2J1SA 1W2UA 3WNNA 3RI9A 1JYCA 5C8CA 4R52A 3WQ7A 4QHOA 2EAAA 1D2SA 4GAZA 4HSLA 3AYDA 3B69A 1PM7A 3LIHA 3AMMA 3UJQA 3ZXDA 2VBPA 5FZ8A 1A8DA 1J3RA 3MPPG 4FAGA 4GMP0 1BYHA 2WWJA 3F95A 2UYBA 3H42B 1HRV1 2CGNA 4EJRA 3Q8AA 4TTGA 1RUH2 1IG3A 3JD72 3THPA 2G4IA 5FYMA 3TWIA 3WG3A 3ORJA 3WUDA 4IEYA 4AXOA 5FDBA 2D3PA 2OPKA 1CN1A 3LFIA 3VZOA 3ATGA 1ZZBA 2WN2A 4NHXA 3C7GA 1UOGA 4FXKB 4CCNA 1U5XA 2ZKLA 3OYWB 4A4AA 5JPNB 3OYWA 5FZ9A 2O8OA 4PIXA 4XFGA 4YGBA 4AYUA 4EZHA 3RYRA 4XFFA 4ZZ5A 3WUCA 2YU2A 1LENA 3N7JA 3HBKA 5FPVA 5I0TA 4I2OA 4QM9A 2AZ5A 3A4UA 2HBUA 1PZ9A 1OA3A 4XCAA 1KEXA 5APAA 2DCTA 2W1SA 1RGSA 1NZCA 2FMYA 3WG1A 4K40A 5FIXA 3FBMA 5C3PA 3TN91 4TSVA 4Y1ZA 5C8CC 4FPYA 2XJVA 4RSUA 4K3UA 4IEVA 4Q0SA 4XIOA 3A22A 3U78A 5CEHA 5FO9B 1TMF1 2ZGRA 3WNMA 3ZO0B 3DGTA 4ISQA 2VMIA 1IPKA 2BW8A 3HT2A 1KS4A 1E5HA 2DUQA 4GH4B 5KXBA 3M3QA 4DIQA 5A1FA 2HWB1 1H1MA 3BYWA 4OHXA 2JB8A 4OQ9A 1TEIA 4E8DA 4BQ1A 3MIDA 5ERLA 2W5FA 3NNGA 3GZUC 3RDIA 5BNNA 2KM2A 1DF0A 2WUHA 3B94A 3C7HA 2G9GA 3AMHA 3TEXA 4K20A 4AF9A 5A7WB 4FBFA 1VALA 5A70A 2D43A 5C4WB 4AI2A 2XVLA 5F9TA 1GQGA 3HAGA 1ZRIA 1ND2C 2D40A 2RS32 4P02B 3JBG3 3VHPA 1GSLA 1UYYA 4GB31 4XOGA 1KFXL 1D0GA 3KQ4B 3QD6A 4AGRA 4YFZA 3K3OA 5L19A 2MNGA 4MX3A 1TG7A 3K77A 1HQLA 3RZLA 3RWKX 4URTA 1C3HA 3SH5A 2ZGPA 1A6CA 2D98A 2E63A 3KHCA 2BOIA 3AKRA 4QQPA 5DAQA 3C7EA 2WFPA 3BU0A 4AWDA 3PJYA 1SPPA 3ZDSA 4GB32 1QOOA 1CGPA 1QKQA 3SNMA 4D6SA 1COV2 1J1LA 1QJU1 2Q8OA 3VB9A 1AJOA 4P9WA 4Y5TA 3ZMNA 3GYDA 3LD8A 4AI3A 4P9LA 5FZEA 3T2TA 4QPIA 1QXJA 1IKQA 5BNQA 4XHXA 3ZFEB 2BWAA 4IGOA 4WVVA 1LHWA 5SV8A 1LR5A 4AI1A 1JU4A 1D0HA 1HN0A 4I0AA 5ACA3 1UU6A 2WJSA 4FPOB 4MXWB 1CAXA 4AAXA 2RHPA 2BRTA 2VVFA 1VRBA 2PLV2 1XQNA 3DYOA 2DV9A 4J1XA 3VBFC 5C3RA 1MS0A 1QHDA 3J8F1 3MW3A 4CDQA 5L7OA 1TME3 4MO3M 2R16A 4PI0A 3T2OA 4LBQD 1AL23 4XBLA 2CNAA 3MFAA 3TRSB 1YQ5A 2IVJA 5ABJB 5LBEA 4AVSA 1UY1A 1GICA 4Z8BA 4DMIA 4YZ1A 4EWEA 2P3KA 2ZEXA 5FYCA 2VO5A 3PMSA 2B4KA 4CPBA 1ND3B 1NXMA 1R1ZA 2VNRA 3I2GA 3OGJA 2B45X 1JODA 5BXXA 4NWVA 1XXNA 3TBDA 2QQJA 3MEPA 3T0AA 1ZA7A 2AC1A 5T3NA 2ZTNA 1FMD3 2TUNA 5FYBA 1ULOA 1ND3C 3KLSA 1W2OA 4Y33A 2G19A 2QUOA 3PNAA 4A44A 4GWMA 3RQ0A 3LDKA 5EQUA 1QEXA 3U1XA 3VBOA 2X09A 5J7MA 4XMAA 2HWD1 4MOAA 4A41A 4BQWA 4XFCA 4ATFA 3MF9A 4I3GA 1EAH3 3DV8A 1UMHA 4H7LA 4MH0E 4SBVA 1OOPC 2GNDA 1W6MA 4OHZA 4JHTA 1GQPA 1S1AA 2D6PA 3PIJA 4LLOA 3JU9A 4CEWB 2YBPA 5JOZA 3LF7A 1W8ZA 2D93A 2BVBA 3VKFC 5I0SA 2VOXA 1TNFA 4YW4A 4FFGA 1YI9A 3D82A 2XQXA 3CL1A 3WNPA 4E9KA 5KHIA 1MZEA 5FZAA 3HWJA 4AW7A 4WZCA 1H2MA 3K46A 1JI6A 3MW4A 3RYKA 2DVBA 4K1YA 1WBLA 1C8M3 3ACIA 3N7LA 3EMRA 4UFMA 1GLHA 2ZX2A 3VHNA 4IERA 4J6GA 3KZ4C 2RDSA 4QB1A 5FYYA 1TME2 1YLLA 1R1A2 2R071 2WWSA 3B9CA 4FOVA 3UKVA 3ZLIA 5DAVA 2PN5A 5HPOA 5JSOA 4QXCA 1L7QA 2VNGA 3POJA 1QJU2 2JIGA 4BU2A 2BFUS 4XURA 4RQPC 3HPNA 1G9FA 4GH4C 3HR9A 5IHRA 4KGGA 2A6WA 3PTYA 2FDGA 3FFZA 4HXCA 1SPPB 4IGPA 3WF0A 5IYYA 2XDVA 1B09A 2VG9A 3OPTA 3VZJA 1ZBE1 2YPDA 3E5QA 1BVVA 3JQWA 4YZ5A 3RZMA 3ASIA 2R0HA 2VE1A 4OI2A 5FPZA 4D69A 1T2XA 2GN7A 3HQXA 4D7TA 2O8QA 4AL9A 4EN8B 3OTFA 4AI8A 1PNFA 3AC0A 2VZOA 3WP5A 4IL7A 3AKPA 1O3SA 1A3KA 4XJZA 5FYZA 5FXVA 1ASJ3 1AZDA 1REEA 3J7LA 2OQ7A 1ENXA 2BEOA 2HBTA 1PO12 5F2WA 1XE7A 2RM22 3SISA 4FQ4A 5ABJC 1QJFA 4HBNA 1O3QA 1RMU2 3NV2A 3C7FA 4Q4V1 5L9RA 4H7MA 3TOJA 1RUJ1 2A1XA 4IEQA 5FPAA 3IDAA 3FLTA 5CFCA 4IE4A 1MR5A 2D5FA 4QX3A 1UMZA 5CFCB 5FPLA 3CZUA 4LIUA 5L9BA 3J7NA 3O0XA 3GDBA 2W68A 5EWSA 3M70A 3KV6A 2V4AA 1OI6A 3I3DA 5C3OA 3BTYA 2GP3A 4NVPA 3ON7A 1LHVA 4Y20B 3WW2A 3ZSJA 3H9AA 2WAAA 2ZMKA 2NMNA 4R9BA 1XSRA 1E5SA 3R0RA 4AVBA 4YVSC 2KXLA 1EV13 1Q8PA 4K9SA 4Y1VA 5FPBA 3U4XA 1YFXA 4KG0A 2BERA 1FMD1 3NV3A 1AX0A 3GZEA 1GP5A 3C7OA 3ZX7A 2DCYA 1PGL2 5BNOC 3WNLA 5JIAA 2PHXA 2LUWA 3OF1A 4F7ZA 5BNNC 2RM21 4WVMA 3WDYA 3IIIA 3VBRB 2C0ZA 1UO9A 2HWD3 4QQOA 1QJEA 1QNWA 4QHBA 1AL0G 5C8CB 3RZHA 2DVAA 3M3OA 5H9PA 2E7TA 3AK0A 5A3OA 4F8AA 4YYOA 4EWAA 3ZFFA 1O6UA 4FFHA 4QU2A 2I07B 4TYSA 3CLPA 2VW0A 1HB4A 1U5IA 1WLDA 1NCRC 2WT0A 3OY8A 2NMOA 1HRV2 1TQ5A 1VB2A 1TMF2 3H1MA 5LZ6A 4GIQA 1OQEA 2XL7A 2OUHA 5EYYA 1OKQA 4AVTA 1VJ2A 1O8PA 3BALA 2WS92 3GCXA 4HVRA 2AUYA 2X8KA 2HYXA 1RJ7A 4HMZA 2Q1MA 4O65A 4K1ZA 4LO6B 4UT5A 3ZXFA 3BOPA 4QKNA 3ACLA 1S0CA 5FFOC 1IG0A 2JDPA 2Q8EA 2YGMA 4HKWA 4XUOA 4LO8A 5DUWA 4A45A 1W04A 2D6KA 5JR2A 1HLCA 3AJZA 4CUGA 1XE0A 3IIAA 3UJOA 4CCCA 3PMEA 3RZZA 1FMD2 1LHUA 1HN1A 5L7OB 2FDJA 2ZX0A 1XYNA 1WBFA 2RS33 2XJTA 4MGIE 1OVSA 4UFKA 4BCUA 4BQXA 1XE8A 3UETA 1YJLA 1JOJA 1ZZ6A 2ZHKA 3UV9A 4AEJA 1MS5A 2E53A 2VZRA 4JDNA 3T3YA 5HI0A 3T09A 2WINB 4HVOA 1NYWA 3ZFGA 5IK8A 2BU9A 2DBNA 4Q2FA 3BN6A 3NRUA 1FI2A 2JICA 5KHHA 4DO0A 4HLTA 2BNOA 1R091 2HWD2 3VZMA 3WDXA 3O5SA 4K8FA 1QF3A 1QMJA 2HWB2 2R063 2VUCA 1QXPA 2PHUA 5FRAA 3ZYRA 5IK7A 3IB3A 3UL2A 1R1A1 2HWE2 3LSEA 3UGGA 2FDHA 4IEXA 1PO23 4OQ8A 1MS8A 3KMHA 1LOBA 3V0BA 4C8DA 4FOYA 5F5AA 4PCRA 3H1WA 1TZOA 1ULPA 3IPVA 3MICA 3D4KA 4HK9A 4XQWA 5HCAA 2HWE1 2PXJA 1C8M2 2CU5A 2VTXJ 3LAGA 1KD7A 5A3UA 2Y8KA 4HN1A 4RD7A 4UFHA 4A7ZA 1EYBA 4BXFA 1O91A 5A32B 4Y5SA 3P1IA 1GZTA 2WKKA 2R49A 2WZ8A 3BIWE 3K3NA 1ZNPA 1WUVA 2WO2A 1RTVA 4JGZC 3OD0A 2PHRA 3JB4C 2XMLA 4AEMA 1S0JA 1XOYA 2HWF3 3P3NA 1JZ3A 3LEGA 2EVXA 5EZWA 2QZ3A 2D6NA 2E7AA 4WVWA 4UWDA 1U5YA 4UW3A 2Y6HA 4AR2A 1W0PA 2C26A 3E5XA 3MO4A 5K4LA 3IKWA 2WNUB 1AYM2 1ZREA 4ITCA 4V2VA 3JXSA 2W1WA 3JZVA 4QX5A 3POFA 5D8AA 1CX1A 3W21A 5FZOB 3AZYA 2KA3A 4K6BA 4JKLA 1ZBA3 1W8HA 4QGMA 3VHOA 5C71A 4JGZA 4UW4A 5FAXA 2HWC1 4AFMA 1ZZ9A 2P5BA 2V4VA 2NYYA 2R6QA 3FC0A 1AYN1 2LALA 3C3VA 5EYXA 1H6YA 1H8TB 4WM8B 3AMPA 1DFQA 3RMXA 2YGLA 2CAVA 4LO5B 5GZCA 4KMQA 4PT6A 4MGYE 2GMPA 3WNOA 5FY5A 4Q26A 1PZ8A 3O7OA 5HV0A 1UPSA 4XJWA 1PK6C 5IAXA 2WFF2 2C4XA 3CJXA 3QACA 1FATA 2ZGSA 4Y4YA 4FFIA 5CBLA 1YUDA 1ZA4A 3FN9A 2FDKA 4RN5A 3S6PA 5FQ0B 3NW4A 3IAPA 1YCIA 4MXWA 1BXHA 1W8FA 4Y26A 1GWLA 3ALQA 1VBE3 1XYOA 4YGCA 1UWWA 3VV1A 3OOXA 5JXJA 3K2OA 5FLHA 4TLFA 2WLPA 2PLV3 4D0QA 2HEYF 1JOBA 3MHZA 3V64A 3WG2A 4ZU5A 1H8VA 4QPGB 2EF6A 3AP7A 3ZFFB 3ZSMA 4CDXB 2J1RA 3AM2A 1NT0A 4YW2A 1QXRA 1OD5A 2VUAA 3U10A 2OS2A 1FX5A 5DUVA 1WD4A 2W94A 2JDZA 3M7AA 4LUMA 3W5MA 3DPRA 2YUEA 1GMMA 1OA2A 2ARAA 3PL0A 1W9SA 1V6MA 3SHRA 3VL8A 5JAXA 4ES9A 1EP0A 2JG8B 2DVGA 2AREA 4AFDA 1SDWA 4MZUA 5F39A 1US3A 1CAVA 5JOXA 1LEDA 4FO9A 3TN93 2Z79A 3ZMOA 1SLBA 5DUUA 4C91A 4FTEA 4BWOA 4NIGA 5FBJA 1DGRN 2VECA 1WWYA 3DECA 3LSDA 4FOWA 1O59A 4UXAA 2YHJA 1BK1A 1CJPA 3UYJA 4DINB 1JW6A 1KS5A 4ES8A 2AGSA 1JS9A 3BVCA 3AX4A 3ME2A 2JG9A 2P37A 2RDQA 3LB9A 4W50A 3UGFA 4K7JA 3U75A 2XL9A 3IWZA 4QM8A 4W8JA 2PAMA 4A3XA 4ORFA 5FZFA 2BTVC 5IT6A 3H1YA 3I4IA 1CIWA 1NCQA 3WQ1A 2YMZA 2A75A 4FP2A 5JI9A 1VBC3 5AC91 3HQRA 5DDJ2 3ZN6B 3VD4A 1NAEA 1D4M3 2WYFA 3GBFA 3MUZ1 3OPWA 2B7YA 5AVPA 2JDUA 4H55A 1WA4A 5CIRA 3FWEA 2VL4A 4W65A 4BK5A 3ZXKA 1RHI2 5JXHA 5K8SA 4GQ7A 1K3IA 2YY1A 4KWJA 2JG9C 4QXKA 3HJRA 3JQXA 1YEWA 2E7QA 5JVVA 4RR3C 3UKTA 3VBHA 1H2LA 4AGGA 5ACA2 5K0UB 1NY72 2MEV1 3ZR6A 4I09A 1JZ5A 3M3IA 4OULA 4Y4RA 3HNYM 2CHHA 5A7SA 5BNNB 3ILNA 3WDTA 1DQ4A 1W8TA 1CZVA 3OBRA 5DZFA 3VBSA 1ND2B 5J96B 5EXOA 3WW1A 5FR3A 3NNFA 1JHJA 4LULA 5F1RA 4OHWA 5A7NA 1MVEA 4BLJA 3WLUA 4DY3A 4AI9A 4CEYA 2Q1FA 5FKBA 3VBUB 1RUF1 2VUJA 5A3PA 4Z92B 1GOGA 1V9U3 1N1VA 1BK0A 4XF3A 4WM7C 1BMV2 3SEPA 1ZX5A 2VNOA 2ZJCA 3QH7A 5FZIA 2QBXA 1G8WA 4JKKA 4NO4A 1D7PM 1OLME 3Q9OA 2WSUA 3WSOA 4TLGA 3W58A 5AFBA 3RG0A 1RUI3 3I97A 4XBQA 5HXMA 1KRIA 1UYZA 2QTWB 1IS5A 4BLIA 2V73A 4R8HA 1QNYA 2FHRA 5CFCC 3WF1A 1POV0 1S2EA 5DPNA 1DU3D 4HETA 3ZPOA 2XWBB 5JOYA 3E6DA 3MF6A 4I02A 2RDRA 1DGWX 5J98B 4WV8A 5IFPA 3U37A 1VBA3 4L97A 2H0BA 3NJVA 4Q1RA 1PNGA 4QPWA 2P1BA 3APBA 1SBEA 5L36A 3V0AB 4OZOA 1IGOA 3NV1A 3QH6A 4IE5A 4MV2A 4C0HA 4BIFA 3ZXJA 5J37A 3LDBA 4YVWC 1BZWA 4BE3A 2ZMNA 3WCRA 1R64A 3CMGA 1DQ5A 1XRUA 4Y1XA 5FLJA 4Q4W1 5CFDA 4JGYC 5FLIA 1KXGA 5ANNA 4LO4B 1EUTA 1MZ5A 2UWBA 3ZIWA 5GZEA 4CP9B 2XLGA 1POQA 4RS5A 4NHLA 4JTNA 3B7MA 5JZGB 2Y6GA 3HBZA 1R1A3 3EHKA 4L99A 2JJ6A 4OUSA 1UOFA 3ZYBA 3B3QE 2NPIA 5I0RA 4YW5A 1OPOA 1FYUA 5KC5A 1RUC3 3LZZA 2QQUA 4B4QA 1LAJA 2FD8A 1OLRA 4JV4A 3WOGA 1BJQA 1KDMA 1YIFA 3FBYA 3G6JB 1VRH3 2EIEA 4OLLA 3JBG2 3M4FA 3ZIXA 1AR61 1PVC2 4HG6B 5JSPA 4EZ4A 3AB0A 4D8MA 3V0AA 2ZGLA 4BJ0A 2YFZA 4AE2A 5DAXA 2WA4A 3H3LA 1DQ2A 2GC3A 2P4EA 5EJ3A 4ZHNA 4E4ZA 1G7YA 1G9AA 2QKDA 1LCLA 3ACHA 2R073 3N9QA 3CIHA 3OUHA 4ET7A 4JHZA 4R4ZA 5EP9A 1S0BA 2B5HA 2NLRA 3UNPA 1FXZA 4UAPA 1QQP1 1Y3TA 4B1MA 2FQPA 3ZKYA 5LW9A 3V56A 1W6QA 2VY0A 4DB5A 1ULDA 2XPJA 3FL7A 4HT1T 5FP9A 3PU8A 5C6CA 1QJY3 1A34A 2X5IB 2WQ8A 5I8YA 4CTEA 4L0PA 4XDQA 3RRDA 5HBAA 1PGW2 5FMOS 5FXXA 3HT1A 4CP2A 5FZDA 3WQ0A 2LS6A 4XDOA 4GULA 4HSJA 1AXYA 4EN9B 4JZRA 2OIIA 2ARXA 4YW7A 1FPN2 5FBZA 2WO1A 2BWCA 3HOBA 4LHKA 3D0SA 2DVDA 3LFMA 4RHV3 4N9HA 2BVVA 2OXBA 2QDNA 3E6BA 4COUA 3IPVB 2ZGKA 1DCSA 1YYNA 4OUMA 1DG6A 2AYHA 2RJLA 5GM0A 1DLLA 5LK7B 5A3NA 3WXPA 3O1OA 3A7QA 4CE8A 1AR82 1HW5A 1QJX2 1W6MB 3N9LA 3RNSA 4E2GA 2DTWA 3KGZA 3KT1A 4NRQA 1TVGA 2FZ2A 3O0VA 3L2YA 4IV3B 4LA2A 4ZONA 3WNKA 1K5MA 4BXSV 4RGAA 3VDDB 1Z7S2 4XXAA 2JG8C 1W0OA 1QOTA 2RR12 3NAPA 5LBFA 2ZGOA 4A7KA 3VBFB 1W90A 2JE7A 4LO7A 4N90A 4NIAA 3RVHA 1BHGA 1UZWA 4OUEA 3IMNA 4ARYA 4JAAA 4Z1VA 5GLZA 2HKXA 1UKRA 2QQMA 3AMQA 1NCQB 5LBBA 1W28A 1CR7A 4MXVA 2GH2A 4PI2A 3GZAA 1C57A 1RUJ2 1HRV3 3M3EA 4OCTA 4NE9A 2DVFA 1SDDB 3J8F3 2J7MA 1J58A 5FZ0A 2CGOA 3OCPA 4F3JA 2WS93 3FFQA 5LRSA 2EIDA 5IATA 5BY5A 3D3AA 4UBHA 1YIPA 4P5HA 2I2SA 2YXSA 1GBGA 1AX1A 2ZAAA 1NKGA 4NPMA 5EV7A 3QOPA 5FY8A 4OFGA 4A2UA 4TZDA 1LOEA 4Q4Y3 5FP3A 1JU3A 1V9U2 2VZPA 1GV9A 1AR71 1PVXA 3HQUA 1RXFA 1CAUB 2BZDA 3KM5A 4L9BA 4PQ9A 4QX7A 5FZKA 2JD4A 3ZYHA 1ND2A 4AHWA 5A33B 1WGPA 1YFWA 3VDDA 1K5JA 1KJRA 1HB1A 2GAUA 4FPJA 3ST7A 1MS4A 5FY9A 5CZKA 4E4HA 5H9SA 4GJYA 1N3PA 1NUKA 5LRRA 2ARBA 2PHTA 5A3TA 1BCXA 1WCKA 4EV0A 1UN1A 1Z78A 4FT8A 4CZSA 5T5JA 5J09A 3WVJA 1Z7S1 4LT5A 2WWUA 3POBA 4XTPA 2YC2A 4Z2WA 2FDFA 1T6BX 4QQ2A 1C5IA 1UU4A 5HXVA 3VBUC 1OHFA 3CO2A 2EXHA 3DEMA 1HJGA 4O9GA 1J84A 2JKXA 2VQ0A 4YW3A 5T52A 1QGLA 3MZHA 4QHZA 1MS3A 4GJZA 2PQSA 1FT9A 3D8CA 4GWJA 4P9YA 4BQ4A 2P6HA 1JYVA 4ZZ8A 4D3WA 1AR92 1Q56A 1YFYA 2MHFA 3WG4A 2RMU2 1QJY1 1RUH1 1XB9A 3I54A 1DZQA 4WVZA 4ZS3A 5C9AB 5CU1A 5K0UC 1PGSA 5CG8A 3AKQA 1C28A 4XF0A 1O4YA 2Y0OA 4WM7A 2QVSB 4XFAA 1VLNA 1PHMA 1UCXA 5G05L 1JHNA 5F5IA 3BUCA 5C4WA 2QQPA 1C4RA 1CVNA 3A21A 2P17A 2IUWA 3T30A 2QNKA 1UU5A 5A6QA 4D6QA 2PELA 1RUG1 4XE9A 5D8AB 4CUBA 2DWRA 4N8MA 2VU9A 2CAUA 4M0NA 2Q8CA 1UZ0A 5LB6A 1P8JA 1X33A 1VIWB 1XNKA 1ZYBA 3I2JA 5BYNA 4NHKA 3PUIA 5F3GA 4NWWA 3TNQA 5FJHA 3CNAA 1F15A 1GUIA 1NLQA 2CV6A 1ENRA 2J1EA 3CHXA 1OQ1A 3HEIA 4NAOA 2GMEA 2V5DA 5FMCA 5FYSA 2WZR1 2IXHA 5D1IA 3MDPA 2D3RA 1H4GA 1MEC2 4XMIA 4XAEA 3PDQA 2VM9A 4LA3A 4CRQA 3KB5A 1F31A 2ILMA 3OBZA 3B93A 1EUUA 3Q8EA 4FQZA 4IE7A 3S5QA 3QCWA 5C5UA 1VR3A 2VCMA 1F4AA 2MEV2 1BBT2 2D6OX 1W39A 3PVNA 1OA4A 4I30A 2IXIA 1OH3A 3BODA 4DZGA 2ETEA 2F4LA 5FMOL 3S30A 3SQOA 4GXLA 4UI9L 2A6ZA 1FV2A 2GC1A 2YYOA 4BOWA 5ISLA 1B35B 3VKMA 3MIBA 1K5MC 4IDZA 4W6YA 4CCJA 5GLWA 4AQTA 2BFUL 4CCLA 4KBBA 1W6QB 1GP4A 1S55A 2WFF3 2WO7A 4LOSA 4I0BA 4OI1A 4ONUA 1W6NB 1D4VB 1AR81 1QJX1 2GNMA 3ITQA 4IW3A 1UY2A 4A6SA 5A1LA 5A3MA 3TEYA 3E97A 3RMYA 1AR73 2D6LX 4AFAA 1NX9A 1F5JA 3SMHA 1RL3A 4RHV2 3A23A 1RMU1 4PQQA 3I3EA 3GBWA 1UW8A 4CCEA 1HB3A 1ZRFA 4LKSA 3U11A 1C8NA 3LEKA 4KG8A 3I2HA 3ZKUA 4KNCA 4TWTA 3WF4A 2VBBA 2LRPA 3OEAA 4HZFA 3VKLA 3ES1A 1UL9A 3MIFA 3OG2A 5DDJ1 3AYCA 4XYXA 3WP6A 3GF6A 3VN4A 1H2KA 3OSDA 5CB7A 2R1BA 1Q3EA 2H6BA 3MPBA 3T08A 4ZS2A 2XR4A 1FPN1 4Q4X1 3H8XA 4YPJA 1DYPA 1WLWA 2V09A 1WLCA 2XONA 3VDAA 2UURA 2C6SA 1LEMA 3BU7A 1TMF3 2ES3A 5CKQA 4CXWA 3SKJE 2R042 1VB4A 1PK6A 2B46X 1UQXA 2Y6FA 1W8OA 2WT2A 2BBAA 2ZGUA 5FPUA 2NZ9A 4OI4A 4LEJA 2XUMA 4SLIA 3PJQA 4FOQA 1VBD2 1UOJA 2B9UA 4QB6A 1TE1B 4IV3A 5CFDB 2W0XA 4XZPA 4I01A 2QQOA 4L11A 3K4AA 2Q4SA 2R041 4JCKA 4P9JA 4AQ6A 4DXTA 1PO22 1NOVA 2VR4A 3Q8CA 3CF6E 1FNZA 3NNMA 1UF2C 3VUOA 1IHMA 1SFNA 1S0FA 4NHYA 5IVYA 1HQNA 3BB6A 2HLEA 2Q8DA 1VBC2 1NCRA 1Y9GA 2WFF1 3ZSLA 3ZYJB 3PIGA 1DYKA 3FLPA 1O7FA 2QQIA 3VBUA 3VD7A 1F8VA 4JVAA 2W52A 3AFGA 3WEZA 2XXZA 1RUOA 2EICA 3ETPA 5F7UA 1AJKA 4RFT0 4AAPA 1FOD3 4XQ4A 2V72A 4FPHA 4KU7A 4UYBA 1CZTA 1XYPA 2JENA 1XJAA 2UY9A 4LBQB 5CFDC 5JSRA 3NVCA 1H8TA 2VTXA 2WQZC 2ZGQA 3RS6A 3ZFEA 3RSJA 3T1MA 4PHZA 2Y33A 1VBB3 1LNSA 5A7WA 2Z4FA 2BJSA 2WNEA 4OHYA 5GZGA 3THDA 1UYXA 2Q0AA 1UY3A 1AYN2 3BI3A 3KVAA 4GB33 1A78A 1YWKA 5DMYA 3OJBA 3O1PA 1JXNA 1MVQA 1CAXB 2R7EB 3WP4A 2QQNA 1WW7A 3R6SA 1TME1 2R072 5T55A 4FSJA 2WZR2 4BMBA 3RFRA 4P9IA 3OPZA 4XUNA 5FMDA 4MGKE 1RVF1 2LM3A 4GKYA 1HDKA 4KBZA 3CU7A 4YM1A 4BQ3A 4GZ9A 3LOIA 2SLIA 1WD3A 2UWCA 1AXZA 5FY4A 2OZ6A 1QH7A 1XU1A 4KWUA 2C1FA 2IVIB 4ZKTB 1CZSA 1VMJA 4OHVA 5FWJA 4DRRA 4NPLA 5LK5A 2HWF1 2Z2SB 1FV3A 3MIEA 4CXXA 2ZX3A 1E57A 3ZYPA 1NQJA 1N1TA 2Q1ZB 3MIHA 1HRI1 4YFWA 4CEWC 1SBDA 1C1LA 5DG2A 2A6XA 3LEMA 1K5MB 2W46A 2XJQA 5JDBA 2B39A 3VDCA 3WDWA 3NQHA 3I3QA 4HOOA 4CU7A 2ZZJA 4HKLA 1OFSA 3VL9A 5LA1A 1O8SA 2G9FA 4ASKA 3OUJA 2XVGA 2W47A 4L92A 1Y43B 2WT1A 5FYVA 4Y1YA 1CAWA 1WA6X 5JXGA 5T5LA 5E16A 4CUAA 4IEPA 5E88A 1BBT3 4CDWA 1OF4A 1CONA 1NLSA 2TBVA 1IS3A 2NP0A 5FZ4A 2QE3A 2OYZA 5J36A 4L2NA 5JIUA 1LHNA 1UY0A 3G7DA 1HKDA 1L3JA 2QZ2A 2VMCA 2JDHA 2BNNA 4JRAA 1X8EA 4CDWC 1SQ4A 4GKXA 2RS11 2HH9A 2HEWF 4FPKA 4AG4A 4YM3A 5LASA 4BB3A 5F8PA 4LK6A 4ZU4A 4ZY9A 2ZACA 4XTMA 3PURA 5F6LB 1RUG3 1SBFA 4FPLA 1G6NA 2EXKA 3Q8BA 1U12A 4BYYA 4META 5CISA 4Y24A 1F2NA 5FZ1A 1DGLA 4BQYA 1UX6A 1AF9A 5F3CA 5IVVA 1H6XA 4GALA 1H2NA 1YQ8A 2F6BA 1MACA 2RS53 2VCCA 4HL0A 4IEWA 4MVTA 5A3WA 4CU8A 5JCTA 2A73B 2BOJA 4YG0A 2BDRA 4JTOA 4B7KA 2ZABA 4EQVA 4CEWA 4KGQA 1LGNA 2BYVE 1W6OB 1Z0HA 3DKWA 4LMFA 3USSA 4JKMA 4GMP1 2OX0A 1RUF3 3B01A 3K4DA 4YZ4A 4QPIB 3T0BA 2RG4A 1VAKA 4CDUC 3O1RA 1VBC1 4Z82A 4IV1C 2WZEA 2IXLA 3E6CC 4XZUG 1UIJA 1LODA 3BTAA 3WW3A 1AL22 1WMXA 2XWJB 3CZJA 4N53C 1RUD3 1SLIA 1VMFA 2W91A 4MYEA 4RYDA 3VD9A 5J3UA 4Q5OA 4CU9A 1W6PA 4AQSA 4QAWA 2JXAA 1CESA 4XBNA 3POIA 2WNUA 4COZA 5EIYB 2ZX1A 1PZ7A 3L9JT 1PIV1 4LBNA 4XXPA 5JR7B 5A7PA 4PIZA 3PUHA 1JZ7A 5A6ZA 3JD71 3EQEA 3OBAA 3S5AA 1DZRA 1W9FA 4Q4X2 1HV0A 2VQUA 5A3LA 3K75B 1PX4A 3FX3A 4B7EA 3MUY1 5AC93 3QLQA 3ACFA 1RUI2 5A6YA 2C24A 1RMU3 2Z5WA 1UD1A 4XUTA 2GP5A 4JC1A 1M4WA 1S2BA 2LW8A 4JDOA 4QU1A 3RWNA 1MPXA 1JYTA 1W9TA 2DUPA 4EN7B 5IK4A 4IGQA 4ZPIA 3VHRA 4GH4A 2XVKA 2E9QA 1AL21 3ELNA 1PO11 1GOHA 1SEFA 2ZHNA 1BVP1 4LBLA 4XDPA 4XJ8A 2XOMA 5SV5A 1W06A 3LGRA 2PHWA 2PAKA 5I0UA 1CPMA 5FTTC 3S7IA 1QJU3 2IXCA 2R30A 2D7FA 1G86A 2PHFA 4YSFA 2ZCWA 4EN6B 4RQPB 4COWA 5FUPA 2BGPA 4QPGA 4CDUA 3KWVA 4XF1A 2CTVA 1E5RA 2YBKA 1OC1A 2WDBA 1X50A 5C33A 3R4UA 1Q8QA 1OF3A 1VP6A 2D6MA 2OA2A 2FCVA 4C1XA 4HANA 4XVHA 4XJAA 1UPIA 3ZYIB 2WAOA 3GCWA 5F2SA 1NXD1 1B35A 1YNAA 1KJLA 1Y7BA 2VMHA 4ASMB 2QQVA 3JBG1 4IV3C 3ZN4A 4DXSA 3VBSC 3LPGA 4QKDA 3T2QA 4C90A 1CX4A 4QDRA 1I5ZA 1LGCA 4MHUA 4JX0A 4LHSA 4XUPA 1AHSA 2WL1A 3KHBA 1H9PA 1X8MA 4Y22B 3OUIA 1VBE1 1W6PB 1VBA2 4Q4V2 3VBRC 2Z42A 3EBRA 4NOTA 3WQBA 4JGYB 1WMDA 5FZ7A 1N1SA 2J42A 2J1TA 2VC9A 5BNPB 5EJZB 4BM8A 3JUUA 1JYIA 3HN3A 1M06G 1ENSA 2RS51 3EB7A 1WMEA 3DYPA 1LOAA 2GMMA 1N3OA 2ZGNA 4YZ2A 1K42A 5IVJA 4N43A 3WHUA 1MEC1 3GM8A 3RJ2X 3O1MA 4N43B 1C5HA 4XFHA 5AVAA 1N1YA 1SCRA 5C3QA 4RS5B 1X9PA 1H0BA 1ZBE2 5B4XA 3H8RA 4QKBA 4QQLA 4Q27A 2Y34A 1MS9A 4YM2A 2IFWA 1O5LA 3B02A 2FDIA 3NKGA 5DQ0A 3NMBA 5LA9A 1QWRA 3PUQA 4N7UA 4Z2AA 3WDVA 2X53S 2VZUA 3J9SA 2D5HA 1OBNA 4IETA 2DURA 3MBWA 3IDEA 3ETQA 3URFA 1F35A 1OUSA 2OW4A 4Q4W2 3B5LB 3R4SA 5EFUA 3DPRC 3OBTA 2PTMA 4KWKA 4RGGA 1AUYA 1PK6B 3LWCA 4LE4A 3I49A 2QQKA 5FP4A 1PMIA 2JDKA 2QCSB 4M3CA 4QPIC 5FZLA 3HN1A 4QX2A 4QXHA 1Y9QA 3VD3A 1D4M1 5K7PA 4OZXA 1VBE2 2ZPXA 1W2NA 4LBMA 2DCZA 4QX1A 3AFKA 1NCQC 5I8TA 3ZDVA 5DZEA 3U07A 1W03A 4NIHA 5JLVA 1W6NA 2JEMA 1GZWB 4Q4V3 5C9AC 4IESA 3CJIC 3VKOA 4E4SA 4KQ7A 1HRI3 2YC4A 2RS52 4LKDA 2X5IA 4XABA 4E4DX 2VVEA 2WC2A 1NE4A 2MEV3 1HX6A 4RR3B 4BIOA 1V6NA 4PDWC 1W9WA 3H7JA 4FXGB 3VBRA 1KITA 1SLCA 5LEJA 4BDVB 5FXZA 4QGNA 2DFCA 3E1F1 5LA2A 4DRVA 3DL3A 1RUF2 4LOTA 4Y3OA 4CCKA 1REDA 2DTYA 4QDSA 1SMVA 1SCSA 1QJY2 1REFA 3KV9A 5FREA 1Q8OA 4XFIA 3BTXA 2W1QA 4PF5A 3KF5A 5TSWA 3ZXAC 1H8TC 2GH8A 5GLVA 2VTFA 5HCBA 5LY1A 1K12A 2OZJA 3K51A 1C8M1 4LNVA 2CYFA 1V6KA 2HJIA 5FZMA 3HIFA 3I2DA 1G9CA 5FUIA 5KHKA 1YHFA 1QU0A 3AZXA 5HCHA 5KC6A 1RITA 3SC7X 1PO21 1SFYA 1UYPA 1JUHA 1GWMA 1RUNA 3N7MA 1HJFA 3I7DA 5D21A 1ZZ7A 3M2MA 4NMIA 5GZDA 2RR13 1RIRA 1WCQA 3V65A 1SG3A 2GSYA 3MI8A 5JZGA 1XNDA 4LK7A 5A7OA 4IV1B 4JQRA 2WLQA 3NAPB 3SCHA 2DCKA 4D94A 3C8XA 1I1EA 1A8MA 4AEDB 4OMDA 4LR4A 2E32A 5HCFA 1LOFA 2X05A 1O5UA 3RI8A 5ABJA 3BOWA 5I0DA 4MG2A 5FYIA 1QIQA 1JUIA 1V6LA 2WRAA 2WIIB 3OGVA 1T6GC 1GZCA 3ROUA 2H0VA 2P2KA 3GHNA 2G9ZA 1DQ1A 4AVCA 1EV11 4E27A 5C4WC 5JXIA 3AP6A 2NQYA 3KT4A 1JOPA 5GLUA 2JG8A 3ZOIA 5H9QA 3MFCA 3I2OA 1LOFC 2ZEWA 4Q0QA 3VDDC 1MZFA 2AR6A 2J22A 2VW1A 1KFUL 2WNOA 4X6QB 4YG6A 5FK8A 3WD5A 4PIYA 1POV3 4Q0PA 3ZN5A 4JRLA 4QDQA 1CAUA 2QQWA 2EXIA 1C1FA 2X5IC 2V5YA 5D8AC 5LATA 2YB7A 3TYJA 4WBBA 5A6XA 1H9WA 1BLZA 2I45A 5C8WA 1RC6A 1RUC1 2QQLA 1LRHA 3ECQA 2JX9A 3J26N 2A71A 2VH9A 4LITA 1YRZA 5IVEA 3M8LA 3W59A 4KU8A 3CQOA 1I9RA 4BHPA 4HN0A 3P5BA 4XPVA 1Y4WA 2OUJA 2X29A 2PYTA 1DGRA 2ET7A 2TEPA 2JIJA 4OMCA 5C70A 1AXKA 4AK3A 4KWLA 2VAUA 2VCAA 5DAWA 3MV01 2G1MA 4M3CB 2QDRA 3SITA 1OT5A 1ZZCA 1O3TA 2MPFA 2RE9A 2ZA9A 2CDOA 1W05A 1YQ2A 1RXGA 2H6CA 4XJ9A 4CPBD 5LBCA 4XACA 2AH2A 4G9SB 2K9ZA 3N35A 5F6KA 4DXRA 2R1DA 2ZHMA 3KQRA 3FZ3A 2YDEA 4MUVA 5DG1A 4OYUA 2VMGA 5A80A 2RM23 2ZKNA 4M4RA 5EJ1B 4R9AA 2JDNA 2PFWA 1JZ6A 5I91A 1PM4A 3AL6A 4QWNA 5I8SA 1V6OA 1SLTA 3I2FA 4Q8LA 4PDWA 2YC0A 4LE3A 2VPVA 1EAH2 3ENRA 1ST8A 2HWE3 1BQPA 1LTEA 5BUVA 2VCBA 3P3PA 2RS31 3CEWA 4H3WA 1UKGA 2VXRA 3FHQA 5I93A 5C9AA 3O1VA 5CNAA 1ACCA 3R4DB 1H4HA 3IBMA 3WT3A 1ZRCA 3N9MA 1W0NA 1X9TA 4PLMA 5L9VA 3TEZA 1W99A 1ONAA 1UZZA 2YFUA 4QPGC 4YWAA 3WR0A 4FPFA 2J1UA 4BPZA 5IFTA 2NM1A 1W9YA 4AOCA 2KD7A 1NCRB 2FBEA 3ES4A 3I2IA 4N9IA 1SACA 5DXDA 1IOAA 2VMFA 4FVVA 4C0BA 3S57A 2VZVA 1YC61 4YG3A 3RZGA 1N47A 4X8PA 4QB2A 4Q0VA 1CWPA 4IUGA 3UESA 3D0JA 5LCWL 5JI7A 4GWNA 4YM0A 3VDBA 2W9XA 4YZ3A 3X29B 2XBO3 3EXUA 2YROA 3LA2A 5KWRA 5M0TA 1RVF3 4TXWA 1W3VA 5FXWA 2HWC3 3J4UH 1UMIA 1V6IA 1N3QA 2XUEA 3T2PA 3VBSB 2XKOA 1VBA1 1OLQA 4M3CF 4S2GA 1STMA 3DCQA 3RZKA 1JYXA 2E51A 4XW3A 3VZKA 4FCAA 4AGVA 2O1QA 4HKOA 5FO7B 3FUQA 1KDKA 2LROA 5K0UA 4FTBA 3LE0A 4QX0A 2A70A 4PBOA 3ZR5A 5AC92 3VBOB 1ASJ2 4W6WA 2WNUC 2Y6LA 3THTA 2Y60A 2ADDA 3KT7A 5KR7A 1VAVA 3AKTA 2WS91 4AHXA 5KXEA 4MGSA 1GYKA 2ZZQA 4A7YA 4AEKA 1AR72 1HQWA 4Q4X3 2W3JA 3WDUA 3BIEA 4ZXEA 3BCWA 3PUAA 4LXLA 1V9U1 2D97A 1COV1 1ZBA1 2HWF2 2XHNA 1J1TA 2B42B 3KF3A 4QXBA 3UT0A 4ATEA 3J7MA 4WZFA 2OVUA 2JE9A 1RUE2 4XETA 3KCYA 3LA7A 1J3PA 2L9LA 5ACA1 3N4MA 4N7IA 2XGXA 5FY0A 1R082 2W87A 1RUI1 2XHKA 3PTRB 1AVBA 5EHDA 2VULA 2EXJA 1XNAA 1YFUA 4G4FA 1EV12 4LHNA 3A0NA 5KXDA 1G9DA 1Z7S3 1OH4A 3H0OA 2RS13 2WN3A 3PHMA 5KXCA 5CA6A 2K46A 3SCGA 3UK9A 2K0GA 5DZGA 5CKMA 5JOWA 4QPYA 1I6XA 2PHLA 4XEZA 4E2QA 5E6HA 2CY6A 4AVVA 4V2WA 3H3UA 3OY8B 3AZZA 2XJSA 3ACGA 1UZYA 4HPKA 4N53A 1QQP3 4XQDA 4CCDA 2CGPA 5A7QA 1W8NA 4P5YA 4MADA 1KQRA 1PMHX 4P9XA 2PHDA 4ASLA 2E26A 2WR9A 1GZ9A 3WNXA 3I3BA 3INAA 1W6OA
chains in the Genus database with same CATH topology
3SH4A 4PLOA 4S2HA 1NA1B 3GALA 1AR63 1DDLA 2E6VA 2XB6C 1UAIA 2F4PA 4B29A 3MGUA 4AI0A 3JCIA 2ET1A 3NSTA 3SXWA 4Q4Y2 2DYCA 4DS0A 1JTZX 5FQ0A 1AR62 3MLLA 4YW1A 5JWPA 1OOPB 1PO13 3AYAA 3ILFA 1S2KA 4B8EA 1ZBE3 3VBHB 4LBQA 1QOSA 1X36A 1ZRRA 4KL1A 3AP5A 5DUXA 1DHKB 5A33A 1U5ZA 4F83A 3CJIB 1IKPA 4R9DA 4IV1A 1IZ3A 3O14A 1RUC2 1DQ6A 1R093 1WMFA 2HYKA 4S2FA 4XF4A 1JBCA 1GANA 2Y38A 1O4ZA 3FHIB 1VRH2 2W08A 3USUA 1V00A 4CEYC 2DU1A 5T50A 4AQ2A 4X6RB 3VLBB 3MYXA 1OFNA 3ZSEA 1CQ9A 4BH9A 4DXZA 1ZBA2 3D5OA 2R062 1DIWA 1ULEA 2HWB3 2CL2A 1LJ7A 2R32A 3MFAA 1QDCA 1OOPA 2VQAA 4ZXKA 1GR3A 3E5UA 3M1HA 2FMDA 4LTAA 4LBKA 1RUG2 3LA3A 2EALA 1R081 4YVSB 3ZYGA 3TAYA 2BUKA 2A5ZA 2WZR3 2DCJA 1H1AA 4AHZA 3MW2A 1COV3 1FAYA 4JDMA 1PGW1 5E1RA 2VW2A 4RHV1 3DUIA 1GNHA 1NA1A 4HVQA 4NN0A 1X82A 4XIKA 3LOBA 1J3QA 1DZTA 2WQ4A 2GZWA 2A7AA 4FPCA 4M00A 5E8AA 2XJRA 1GKBA 4EN0A 2GNBA 4Q1PA 1WLTA 2A6YA 4DY5A 2Q5TA 1D2QA 4PBPA 2W39A 2Y0IA 1WW6A 4CDWB 4MGZE 3ZXGA 4CEYB 3L2HA 4GA9A 3WHTA 1CPNA 3FUOA 4K21A 5KHJA 4WM8C 4CYDA 2ZGMA 1LU2A 2EAKA 1BEV2 2GU9A 3ZFEC 2BNMA 3LCPA 3KGLA 1NG0A 2EIGA 4XFBA 1GQHA 1NE6A 2R0FA 2Y26A 3IDBB 3OGGA 4LUKA 3NV4A 2GDFA 4HK8A 1LESA 3IM0A 3USUB 2D44A 2WNVC 1BMV1 1RUD1 2A3YA 3WV6A 5GJ6A 3AXEA 4IEOA 2GN3A 4DQAA 3PVBB 3U0ZA 1QDOA 3AXDA 5J48A 1FOD1 4U2AA 3ZPYA 5FOBB 1O4TA 2VOWA 2JG9B 3FLRA 4COVA 3JB8A 1S0IA 3SCFA 4RA0A 1OMIA 3J8F2 4S2DA 4YVWB 4BA6A 1F9KA 3RJRA 4ISRA 3ZVXA 1VBB1 1EAH1 4WVMB 1NY71 3H50A 3DF0A 4PJYA 4YGDA 2PLV1 3KCCA 3IDCB 1RB8G 4BMEA 3VBHC 1WCSA 1YO8A 3B00A 1ULFA 3V0BB 1PIV3 3PLQA 4L8QA 5FPXA 5GZFA 5CG9A 1LOGA 5E89A 2ZMLA 4JGZB 3POWA 4Y20A 5JMCA 1AR83 1QJX3 3VKNA 4N43C 1MQTA 3GHMA 4N53B 3ZFGB 1IS4A 2P34A 2XH6A 1NA1C 1UIKA 2ZOEB 1WCDJ 3FMGA 4M3CE 3DN7A 1HXS2 5IUQA 2B8MA 2WA3A 3M3CA 2UU8A 3ZXEA 4B4RA 3HMYA 3VZLA 2R061 5H9RA 3AP4A 1YJKA 3TB0A 2BBVA 1OQDA 2RR11 2D3SA 4B4PA 4XHBA 5BNOA 4D7YA 1PGL1 4M01A 3AJYA 2A3XA 2O0OA 3W9AA 2GALA 1VBB2 4IXLA 2SBAA 4YVSA 2IC1A 2XJPA 1ASJ1 2PA7A 3H3ZA 2ZX4A 4IEZA 1H30A 1XNCA 3DPRB 4UW5A 2GC0A 1OPMA 1X7NA 4QT6A 5BNPC 1MEC3 3N36A 1AX2A 1U0AA 1ZVFA 4PLNA 1G9BA 2WSVA 5T5PA 2ZGTA 3AZVA 4MSVA 1PIV2 1PVC1 1O3RA 5CVRA 3ZFFC 3O0WA 3WCSA 3AYEA 2CWSA 2HEVF 3C2UA 4Y22A 1ULCA 1AYM1 3KCXA 3KD4A 3RPQA 2UY8A 1LU1A 2WZPP 1CJDA 2N7GA 1HXS3 2LTNA 4AVAA 1YI7A 2QJVA 3AZWA 4Q8KA 2DFBA 2RMU3 4GMP3 4WM8A 5CADA 4WM7B 3PVOA 1BEV1 3NKTA 4YARA 2Z69A 4DOUA 1GZWA 1BKZA 1XNBA 4M0HA 1VAMA 2ZHLA 4INDA 1FPN3 3AMNA 2A3WA 4HPKB 4COYA 3AP9A 3FJSA 3WZ1A 4CDXC 5JZGC 3PVEA 3AKSA 3SH3A 1D4M2 3B9IA 2CWMA 1J59A 3EO6A 1RHI3 1JH5A 3GZTB 3I59A 5BPXA 2RS12 3UKNA 3R05A 3JD73 4CDXA 5JPMB 4DNYA 4V1PA 2C5DA 4YGEA 1R083 2IZWA 1NLRA 4Q4W3 4Q0UA 4NR1A 3RYPA 3O12A 1IQAA 1PVC3 2IXJA 1NQDA 2PAEA 2XJUA 2GC2A 4X8NA 1EPZA 4R9CA 5IK5A 1CAVB 3T1LA 4J1WA 2Q30A 1LOCA 2VOKA 2YV8A 5F5QA 3N7KA 4W6XA 1QJZA 1AR91 4IEUA 3SLIA 4ZU7A 3I8TA 2FZ1A 3CJIA 1POV1 3VBOC 1OSGA 4MLOA 3N3HA 5GALA 5CAZA 1F5FA 3MLKA 1RINA 4FP3A 1ZM1A 2RJKA 2XBO1 2BQPA 3EJKA 5L73A 4CDUB 4AFCA 3I59B 3ZFGC 2QFEA 2ENRA 4XF9A 3OD4A 5KHGA 3MLJA 2TNFA 1S0DA 3KS7A 4CDQB 1FOD2 1LKNA 2XLFA 3NAPC 4HFSA 4AEDC 1RUE3 1GNZA 3K48A 3NJZA 1WW5A 3TNPB 4Y1UA 1RHI1 3S7EA 1S0GA 2VVDA 3NWKA 5L7OC 1IPJA 4B3NA 3LKJA 4QMAA 2ZAHA 4AEDA 2WNVB 4Z07A 1AYM3 4RQPA 1DBNA 5AFEA 1R092 5GKAC 4QQHA 5K9YA 1S0EA 1V6JA 2ATFA 4OVEA 3ZN6A 3NL1A 2R043 1HXS1 4YRDA 3H7YA 1HIXA 3GBGA 1AYN3 2RMU1 5B2GB 4LLFA 1MQTC 1AR93 2P3IA 3H8UA 5LEKA 1RUJ3 5FO8B 1CAWB 4C1WA 1Q43A 2BGCA 1IS6A 1ALYA 4PDWB 4Q4Y1 3WP3A 2BPA2 4CP0A 1CD3G 4O9EA 1RJ8A 2IFRA 4RL7A 1DQ0A 3NO8A 4G3YC 1FNYA 2ZBJA 3ILRA 4U36A 4YLZA 1APNA 1ULGA 4YNIA 3VBFA 3D6EA 4YVWA 1B35C 2VGDA 2XKPA 1ZRDA 4AFBA 4LBOA 5BNOB 1GFF2 4XJUA 1LHOA 1RUE1 2A6VA 1ND3A 4P14A 2IXKA 1HV1A 1EY2A 2IWGB 4QGLA 1EPWA 2PQQA 2I74A 3QBQA 5BV6A 4AHYA 3WW4A 4UBGA 2DUOA 4NHMA 4H14A 3IN9A 2XG3A 3FE5A 1Q5OA 1V70A 4P9GA 3HD8B 2DU0A 3A0KA 1MQTB 2JECA 4FPEA 2WNVA 1VRH1 3POYA 1VBD1 3WX5A 4CDQC 4DPNA 4Y5Z0 4DFSA 2JKBA 1I3HA 4UW6A 2DF7A 4OI0A 4XILA 2YZ4A 2ZS6B 5A32A 2K2SA 1LECA 1DGWA 3GNEA 4I3PA 1QY4A 5GLTA 5T54A 4EWDA 3S0MA 4FAHA 1H1IA 2XLAA 5T5OA 4E2SA 3WINE 2C9AA 3KSCA 1XU2A 1MZ6A 4QD2A 4CP1A 1LULA 4IQPA 1URXA 1RUH3 4NPRA 1RVF2 4Q29A 1YXWA 2NN8A 2UYAA 4FPGA 1ZZ8A 3TN92 3VZNA 1RUD2 4I0WB 4BZ4A 4RS5C 5BNPA 4LBJA 1BBT1 1SLLA 2EA7A 2XBO2 4JGYA 3BPZA 1ENQA 4R4XA 2HWC2 1HRI2 3VGIA 2P3JA 4EROA 3MIGA 1MS1A 2UWAA 2GNTA 2ERFA 5KBFA 1WW4A 2YPJA 3POSA 1BEV3 1QQP2 2VOVA 5DDJ3 1TNRA 5FCCA 1Q8VA 1QH6A 4RR3A 4KH9A 1VBD3 1JN2P 1SLAA 4FTSA 3WY6A 2AENA 1Q8SA 3ZSKA 4D7SA 1LGBA 3IT8A 1LB2A 3ZXLA 4LHLA 1W2UA 3RI9A 1JYCA 5C8CA 4R52A 3WQ7A 2EAAA 1D2SA 4HSLA 3AYDA 3B69A 1PM7A 3UJQA 3AMMA 3ZXDA 1A8DA 1J3RA 3MPPG 4FAGA 4GMP0 1BYHA 2UYBA 1HRV1 2CGNA 4EJRA 1RUH2 3JD72 3THPA 2G4IA 3TWIA 3WG3A 3WUDA 4IEYA 4AXOA 5FDBA 2D3PA 2OPKA 1CN1A 3VZOA 3ATGA 1ZZBA 4FXKB 1U5XA 2ZKLA 3OYWB 5JPNB 3OYWA 4AYUA 2O8OA 4PIXA 4XFGA 4YGBA 3RYRA 4XFFA 3WUCA 4I2OA 1LENA 3N7JA 5I0TA 4QM9A 2AZ5A 3A4UA 1PZ9A 1OA3A 2DCTA 1RGSA 1NZCA 2FMYA 3WG1A 4K40A 3FBMA 3TN91 4TSVA 4Y1ZA 5C8CC 4FPYA 2XJVA 4RSUA 4K3UA 4IEVA 4Q0SA 4XIOA 5FO9B 1TMF1 2ZGRA 3ZO0B 3DGTA 4ISQA 2VMIA 1IPKA 2BW8A 3HT2A 1KS4A 2DUQA 4GH4B 5KXBA 3M3QA 2HWB1 1H1MA 4OHXA 1TEIA 4BQ1A 3MIDA 3GZUC 3RDIA 5BNNA 2KM2A 1DF0A 3B94A 2G9GA 3AMHA 4K20A 4AF9A 4FBFA 1VALA 2D43A 5C4WB 4AI2A 2XVLA 5F9TA 1GQGA 3HAGA 1ND2C 2D40A 2RS32 3JBG3 3VHPA 1GSLA 4GB31 4XOGA 1KFXL 1D0GA 3QD6A 4AGRA 4YFZA 5L19A 2MNGA 4MX3A 1HQLA 4URTA 1C3HA 3SH5A 2ZGPA 1A6CA 2D98A 2E63A 3AKRA 4QQPA 2WFPA 4AWDA 3PJYA 3ZDSA 4GB32 1QOOA 1CGPA 1QKQA 3SNMA 1COV2 1J1LA 1QJU1 2Q8OA 1AJOA 4P9WA 3ZMNA 3GYDA 4AI3A 4P9LA 3T2TA 4QPIA 1QXJA 1IKQA 5BNQA 4XHXA 3ZFEB 2BWAA 4WVVA 1LHWA 5SV8A 1LR5A 4AI1A 1D0HA 4I0AA 5ACA3 1UU6A 2WJSA 4FPOB 4MXWB 1CAXA 2RHPA 2VVFA 2PLV2 1XQNA 2DV9A 4J1XA 3VBFC 1MS0A 1QHDA 3J8F1 3MW3A 4CDQA 5L7OA 1TME3 2R16A 4LBQD 1AL23 4XBLA 2CNAA 3TRSB 5ABJB 4AVSA 1GICA 4Z8BA 4DMIA 4YZ1A 4EWEA 2P3KA 3PMSA 1ND3B 1NXMA 1R1ZA 2VNRA 3OGJA 2B45X 5BXXA 4NWVA 1XXNA 3TBDA 3MEPA 5T3NA 2ZTNA 1FMD3 2TUNA 1ND3C 3KLSA 2QUOA 3PNAA 4GWMA 3RQ0A 5J7MA 3VBOA 4XMAA 2HWD1 4XFCA 4ATFA 3MF9A 4I3GA 1EAH3 3DV8A 4H7LA 4MH0E 4SBVA 1OOPC 2GNDA 1W6MA 4OHZA 1S1AA 2D6PA 4LLOA 3JU9A 4CEWB 5JOZA 5I0SA 2D93A 2BVBA 3VKFC 2VOXA 1TNFA 4YW4A 1YI9A 3D82A 3CL1A 4E9KA 5KHIA 1MZEA 3HWJA 4AW7A 4WZCA 1H2MA 3MW4A 3RYKA 2DVBA 4K1YA 1WBLA 1C8M3 3N7LA 1GLHA 2ZX2A 3VHNA 4IERA 4J6GA 3KZ4C 2WWSA 1TME2 1R1A2 1YLLA 2R071 3B9CA 4FOVA 3UKVA 3MZHA 5JSOA 2PN5A 2VNGA 1QJU2 2BFUS 4RQPC 1G9FA 4GH4C 3HR9A 4KGGA 2A6WA 3PTYA 3FFZA 1B09A 2VG9A 3VZJA 1ZBE1 3E5QA 1BVVA 3JQWA 4YZ5A 3ASIA 2R0HA 5FPZA 4OI2A 4D69A 3HQXA 2GN7A 4D7TA 2O8QA 4EN8B 3OTFA 4AI8A 1PNFA 3WP5A 4IL7A 3AKPA 1O3SA 1A3KA 4XJZA 1ASJ3 1AZDA 1REEA 1ENXA 2BEOA 1PO12 1XE7A 2RM22 3SISA 4FQ4A 5ABJC 4HBNA 1O3QA 1RMU2 3NV2A 4Q4V1 4H7MA 3TOJA 1RUJ1 4IEQA 3FLTA 5CFCA 1MR5A 2D5FA 5CFCB 1UMZA 3O0XA 2W68A 5EWSA 3M70A 1OI6A 4NVPA 4Y20B 1LHVA 3WW2A 3ZSJA 3H9AA 2ZMKA 2NMNA 4R9BA 3R0RA 4AVBA 4YVSC 2KXLA 1EV13 1Q8PA 4K9SA 4Y1VA 3U4XA 1YFXA 4KG0A 1FMD1 3NV3A 1AX0A 3ZX7A 2DCYA 1PGL2 5BNOC 5JIAA 2PHXA 2LUWA 3OF1A 4F7ZA 5BNNC 2RM21 4WVMA 3WDYA 3VBRB 2C0ZA 2HWD3 4QQOA 1QNWA 4QHBA 1AL0G 5C8CB 2DVAA 3M3OA 5H9PA 2E7TA 3AK0A 4F8AA 4YYOA 4EWAA 3ZFFA 4QU2A 2I07B 4TYSA 3CLPA 2VW0A 1U5IA 1WLDA 1NCRC 2WT0A 3OY8A 2NMOA 1HRV2 1TQ5A 1VB2A 1TMF2 3H1MA 4GIQA 1OQEA 2XL7A 2OUHA 5EYYA 1OKQA 4AVTA 1VJ2A 3BALA 4HVRA 2WS92 2AUYA 2X8KA 1RJ7A 4HMZA 2Q1MA 4K1ZA 4LO6B 3ZXFA 3BOPA 3ACLA 1S0CA 5FFOC 2YGMA 4HKWA 4LO8A 5DUWA 2D6KA 1HLCA 3AJZA 3IIAA 3UJOA 3PMEA 3RZZA 1FMD2 1LHUA 5L7OB 2ZX0A 1XYNA 1WBFA 2RS33 2XJTA 4MGIE 4BCUA 1XE8A 1YJLA 1JOJA 1ZZ6A 2ZHKA 3UV9A 4AEJA 1MS5A 2E53A 4JDNA 5HI0A 2WINB 4HVOA 1NYWA 3ZFGA 5IK8A 4Q2FA 1FI2A 2JICA 5KHHA 4HLTA 2BNOA 1R091 2HWD2 3VZMA 3WDXA 3O5SA 4K8FA 1QF3A 1QMJA 2HWB2 2R063 1QXPA 2PHUA 5FRAA 3ZYRA 3UL2A 1R1A1 2HWE2 3LSEA 4IEXA 1PO23 1MS8A 3KMHA 1LOBA 3V0BA 4FOYA 4PCRA 3H1WA 3IPVA 3MICA 3D4KA 4HK9A 4XQWA 5HCAA 2HWE1 1C8M2 3LAGA 1KD7A 4HN1A 4RD7A 4A7ZA 1EYBA 1O91A 5A32B 2WKKA 2R49A 3BIWE 1ZNPA 1WUVA 1RTVA 4JGZC 3OD0A 2PHRA 3JB4C 4AEMA 1S0JA 2HWF3 3P3NA 2EVXA 5EZWA 2QZ3A 2D6NA 2E7AA 4WVWA 1U5YA 4UW3A 1W0PA 3E5XA 3IKWA 2WNUB 1AYM2 1ZREA 4ITCA 3JZVA 4QX5A 5D8AA 3AZYA 2KA3A 4K6BA 1ZBA3 4QGMA 3VHOA 4JGZA 4UW4A 5FAXA 2HWC1 4AFMA 1ZZ9A 2NYYA 2R6QA 3FC0A 1AYN1 2LALA 3C3VA 5EYXA 4WM8B 1H8TB 3AMPA 1DFQA 3RMXA 2YGLA 2CAVA 4LO5B 5GZCA 4MGYE 2GMPA 4Q26A 1PZ8A 3O7OA 1UPSA 4XJWA 1PK6C 2WFF2 3CJXA 3QACA 4Y4YA 1FATA 2ZGSA 5CBLA 1YUDA 1ZA4A 3S6PA 5FQ0B 3NW4A 4MXWA 1YCIA 1BXHA 3VV1A 4Y26A 3ALQA 1VBE3 1XYOA 4YGCA 5FLHA 4TLFA 2WLPA 2PLV3 2HEYF 3V64A 3WG2A 4ZU5A 1H8VA 4QPGB 2EF6A 3AP7A 3ZFFB 3ZSMA 4CDXB 3AM2A 4YW2A 1QXRA 1OD5A 2VUAA 3U10A 1FX5A 5DUVA 1WD4A 2JDZA 3M7AA 4LUMA 3DPRA 2YUEA 3SHRA 1OA2A 3VL8A 1V6MA 5JAXA 4ES9A 1EP0A 2JG8B 2DVGA 2AREA 4AFDA 1SDWA 4MZUA 5JOXA 1CAVA 1LEDA 4FO9A 3TN93 2Z79A 3ZMOA 1SLBA 5DUUA 4C91A 4FTEA 4BWOA 1DGRN 2VECA 3LSDA 4FOWA 4UXAA 2YHJA 1BK1A 1CJPA 4DINB 1JW6A 1KS5A 4ES8A 2AGSA 3AX4A 3ME2A 2JG9A 2P37A 3LB9A 4K7JA 2XL9A 3IWZA 4QM8A 2PAMA 4A3XA 4ORFA 2BTVC 5IT6A 3H1YA 3I4IA 1CIWA 1NCQA 3WQ1A 2YMZA 2A75A 4FP2A 5JI9A 1VBC3 5AC91 3ZN6B 5DDJ2 1D4M3 3GBFA 2B7YA 5AVPA 4H55A 1WA4A 5CIRA 3FWEA 4W65A 3ZXKA 1RHI2 5K8SA 4GQ7A 4QXKA 2YY1A 4KWJA 2JG9C 3JQXA 2E7QA 5JVVA 4RR3C 3UKTA 3VBHA 1H2LA 4AGGA 5ACA2 5K0UB 1NY72 2MEV1 4I09A 3M3IA 4OULA 5BNNB 3ILNA 3WDTA 1DQ4A 3OBRA 5DZFA 3VBSA 5J96B 1ND2B 5EXOA 3WW1A 5F1RA 4LULA 4OHWA 1MVEA 4BLJA 3WLUA 4DY3A 4CEYA 3VBUB 1RUF1 2VUJA 4Z92B 1V9U3 1N1VA 4XF3A 4WM7C 1BMV2 1ZX5A 2VNOA 2ZJCA 3QH7A 1G8WA 4NO4A 3Q9OA 2WSUA 3W58A 5AFBA 3RG0A 1RUI3 4XBQA 1KRIA 1IS5A 4BLIA 2V73A 4R8HA 1QNYA 2FHRA 5CFCC 1POV0 1DU3D 4HETA 2XWBB 5JOYA 3E6DA 3MF6A 4I02A 1DGWX 5J98B 4WV8A 1VBA3 4L97A 2H0BA 4Q1RA 5L36A 1PNGA 3APBA 1SBEA 3V0AB 1IGOA 3NV1A 3QH6A 4MV2A 4C0HA 4BIFA 3ZXJA 5J37A 4YVWC 1BZWA 4BE3A 2ZMNA 3WCRA 4Y1XA 1DQ5A 1XRUA 5FLJA 4Q4W1 5CFDA 4JGYC 5FLIA 1KXGA 4LO4B 1MZ5A 2UWBA 3ZIWA 5GZEA 2XLGA 4RS5A 4NHLA 4JTNA 3B7MA 5JZGB 3HBZA 1R1A3 3EHKA 4L99A 2JJ6A 4OUSA 3B3QE 2NPIA 5I0RA 4YW5A 1OPOA 1FYUA 5KC5A 1RUC3 3LZZA 4B4QA 1OLRA 4JV4A 3WOGA 1BJQA 1KDMA 1YIFA 3FBYA 3G6JB 1VRH3 4OLLA 3JBG2 3M4FA 3ZIXA 1AR61 1PVC2 5JSPA 3AB0A 2ZGLA 4AE2A 2WA4A 1DQ2A 2GC3A 5EJ3A 4E4ZA 1G7YA 1G9AA 2QKDA 1LCLA 2R073 4R4ZA 1S0BA 2B5HA 2NLRA 1FXZA 1QQP1 1Y3TA 2FQPA 3V56A 1W6QA 2VY0A 4DB5A 1ULDA 2XPJA 4HT1T 5C6CA 1QJY3 2X5IB 5I8YA 4CTEA 4XDQA 3RRDA 5HBAA 1PGW2 5FMOS 4CP2A 3HT1A 3WQ0A 4GULA 4HSJA 1AXYA 4EN9B 2OIIA 2ARXA 1FPN2 5FBZA 2BWCA 4LHKA 3D0SA 2DVDA 4RHV3 4N9HA 2BVVA 2QDNA 3E6BA 4COUA 3IPVB 2ZGKA 4OUMA 1YYNA 5LK7B 1DG6A 2AYHA 2RJLA 5GM0A 1DLLA 3WXPA 1AR82 1HW5A 1QJX2 1W6MB 3RNSA 4E2GA 2DTWA 3KGZA 3KT1A 2FZ2A 3O0VA 3L2YA 4IV3B 4LA2A 1K5MA 4RGAA 3VDDB 1Z7S2 4XXAA 2JG8C 1W0OA 1QOTA 2RR12 3NAPA 4A7KA 2ZGOA 3VBFB 2JE7A 4LO7A 4N90A 3IMNA 4Z1VA 4JAAA 5GLZA 2HKXA 1UKRA 3AMQA 1NCQB 1CR7A 4MXVA 2GH2A 3GZAA 1C57A 1RUJ2 1HRV3 3M3EA 2DVFA 3J8F3 1J58A 2CGOA 3OCPA 4F3JA 2WS93 3FFQA 5LRSA 5BY5A 4UBHA 1YIPA 4P5HA 2I2SA 2YXSA 1GBGA 1AX1A 2ZAAA 5EV7A 4A2UA 4TZDA 3QOPA 4OFGA 1LOEA 4Q4Y3 1V9U2 1GV9A 1AR71 1PVXA 4L9BA 1CAUB 4PQ9A 3KM5A 2JD4A 1ND2A 4AHWA 5A33B 1WGPA 1YFWA 3VDDA 1KJRA 2GAUA 4FPJA 3ST7A 1MS4A 5H9SA 1N3PA 5LRRA 2ARBA 2PHTA 1BCXA 1WCKA 4EV0A 1UN1A 1Z78A 4FT8A 4CZSA 5T5JA 5J09A 3WVJA 1Z7S1 4LT5A 4XTPA 4Z2WA 4QQ2A 1C5IA 1UU4A 5HXVA 3VBUC 1OHFA 3CO2A 2EXHA 4O9GA 4YW3A 2VQ0A 5T52A 1QGLA 1MS3A 1FT9A 3D8CA 4P9YA 4D3WA 1AR92 1Q56A 1YFYA 2MHFA 3WG4A 2RMU2 1QJY1 1RUH1 3I54A 1DZQA 4WVZA 5C9AB 5CG8A 5CU1A 5K0UC 1PGSA 3AKQA 1C28A 4XF0A 1O4YA 2Y0OA 4WM7A 2QVSB 4XFAA 1VLNA 1PHMA 1UCXA 1JHNA 5C4WA 2QQPA 1C4RA 1CVNA 2P17A 2QNKA 1UU5A 2PELA 1RUG1 4XE9A 5D8AB 2DWRA 2VU9A 2CAUA 4M0NA 1X33A 1VIWB 1XNKA 1ZYBA 5BYNA 4NHKA 4NWWA 3TNQA 3CNAA 2CV6A 1ENRA 1OQ1A 2GMEA 2WZR1 2IXHA 5D1IA 3MDPA 2D3RA 1H4GA 1MEC2 4XMIA 4LA3A 4CRQA 3KB5A 1F31A 2ILMA 3B93A 4FQZA 3QCWA 1VR3A 2MEV2 1BBT2 2D6OX 1W39A 3PVNA 1OA4A 4I30A 2IXIA 3BODA 4DZGA 2ETEA 5FMOL 3S30A 4GXLA 4BOWA 2A6ZA 1FV2A 2GC1A 2YYOA 1B35B 3VKMA 3MIBA 1K5MC 4W6YA 5GLWA 4AQTA 2BFUL 4KBBA 1W6QB 1S55A 2WFF3 4OI1A 3V0AA 4I0BA 4ONUA 1W6NB 1D4VB 1AR81 1QJX1 2GNMA 5A3MA 3E97A 3RMYA 1AR73 2D6LX 4AFAA 1F5JA 3SMHA 1RL3A 4RHV2 1RMU1 3GBWA 1UW8A 1ZRFA 3U11A 1C8NA 4KG8A 4KNCA 4TWTA 3VKLA 4HZFA 3ES1A 1UL9A 3MIFA 5DDJ1 3AYCA 4XYXA 3WP6A 3GF6A 3VN4A 1H2KA 5CB7A 2R1BA 1Q3EA 2H6BA 3MPBA 1FPN1 4Q4X1 1DYPA 1WLWA 2V09A 1WLCA 2UURA 1LEMA 3BU7A 1TMF3 2ES3A 2R042 1VB4A 1PK6A 2B46X 2WT2A 2ZGUA 2NZ9A 4OI4A 4LEJA 2XUMA 4SLIA 3PJQA 4FOQA 1VBD2 2B9UA 5CFDB 1TE1B 4IV3A 2W0XA 4XZPA 4I01A 4L11A 2Q4SA 2R041 4JCKA 4P9JA 4AQ6A 1PO22 1NOVA 3CF6E 1FNZA 1UF2C 3VUOA 1IHMA 1SFNA 1S0FA 1HQNA 3BB6A 1VBC2 1NCRA 2WFF1 3ZSLA 3ZYJB 1DYKA 3FLPA 1O7FA 3VBUA 1F8VA 4JVAA 2W52A 3AFGA 1RUOA 1AJKA 4RFT0 1FOD3 4XQ4A 4FPHA 4KU7A 2JENA 1XYPA 4LBQB 2UY9A 5CFDC 5JSRA 3NVCA