2JIXD

Crystal structure of abt-007 fab fragment with the soluble domain of epo receptor
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
216
structure length
216
Chain Sequence
QVQLQESGPGLVKPSETLSLTCTVSGASISSYYWSWIRQPPGKGLEWIGYIGGEGSTNYNPSLKSRVTISVDTSKNQFSLKLRSVTAADTAVYYCARERLGIGDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Potent Erythropoietin-Mimicking Human Antibody Interacts Through a Novel Binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Receptor/immune system
molecule keywords ABT-007 FAB FRAGMENT
total genus 37
structure length 216
sequence length 216
chains with identical sequence F, H
ec nomenclature
pdb deposition date 2007-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jixD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jixD01
5CZKA 1JI2A 4RGNC 4N1EA 4OM0H 1IC4L 1Y18B 1XGTA 4LCYA 3L1OL 2LV4A 1U93B 2A6KA 3BUYA 4H8WH 3O3BB 4MXWL 3QXAA 2Y07L 2BY0A 3NCYS 2V17L 5GS1A 1YECH 1M05A 5I8OH 4NT6B 2WBJA 5C08D 1UACL 5FECA 5I74B 3VJ6B 3GSNA 4TTDC 3RJQB 3BGMB 1TZGH 4NNYA 4F15B 3TZVB 1MCPL 1BZ9A 1CLZH 1YEKL 3I9GH 5F9OL 3V6FA 4XVSH 1C5DA 4XNUH 3BW9A 2CD0A 1MCFA 5DEZA 3ULVD 5TF1L 3WIHA 3NN8A 3HI1B 2O61B 1CCZA 4KTYA 4WI3A 3T65B 3ELAT 1EAJA 3CDFA 2N4IA 4NCC1 3K80A 4WTXA 2RAMA 1SYVB 3DYPA 3GGWB 1S7VA 1U3YA 4YHLL 2IEPA 4JPKH 5J12C 2ICCA 2HT3D 4FZEL 5F7NC 1VGKA 5ITFB 3WUWA 3VFMB 2AXJA 3VXRE 3CX5J 3Q0HA 3WIIL 1B0GA 2CR3A 2X4PA 4F9PC 4KPHH 1MFBL 3ALXA 2D31B 3QIWA 5FYJD 2XZAH 4JPWH 4J4PA 3NGBB 3LN4B 3SDCB 4ODXA 1YJDL 3PWLB 2DIAA 2AI0L 5D1XC 3O45A 3QIBA 3VXSB 3DPBA 4IOIB 4XVTL 3NZHH 1JGLH 2V7NB 3OB0H 5GGRA 3NGBC 4EIGB 1QYGL 4D3CL 5H2BA 1OAKL 1RVFL 1QFUH 3HR5B 2ID5A 5AUMB 4NRYA 4LASH 3VA2C 1NKRA 2DWDB 1BIHA 2YD1A 2CK0H 1KELH 5HHOD 3CUPA 1K2DB 2W59A 3L3DB 5SWZB 3WIHL 4LSVL 2VXQL 3V6BR 5CGMA 4RBPH 4JPVL 4XPGL 3B9KB 4JFDD 2FECI 4FXGB 3QRFM 1HXYA 3VGAC 1H5BB 1Y6KR 3S98A 2VB5A 3KG5A 2NX5B 1HHIA 4JAMB 2OJZL 4IRSC 2V2WA 3M1BA 3T3PE 1CL7I 3VJ6A 2Z4QA 1I7TB 1TNMA 3LSOA 3BOVA 1TCMA 4FABH 4LPWA 3BP4A 3EKCA 5GRJL 3VG0H 3OQ3B 1U41A 2C26A 2YWZA 4PB9L 4R97B 5DWUH 3RNQB 2P49B 1NCCH 2VJXA 3QSKB 4P4KA 5KOMC 1U8MA 5I17A 4G8GD 3MRMB 4JHWH 5HYJB 1RZ7L 2NY2B 4ONHB 4BFIA 4HJJL 1T3FA 5EBLA 2WBKA 1WTLA 1IGMH 2CPCA 1U95A 4LMQE 3PV7A 4L4TB 5DEGB 4OGZA 4ZUWB 3E6HA 3KYNA 1INDL 4L4JA 2NXZD 3EOYG 2P5EE 5EU4A 1H3GA 3CU1A 2EICA 1G7JB 5ADOL 5E08H 2AERT 2ED7A 3PABA 5FOBB 1R3JB 5GPRA 3VXRA 1KIUA 5JQ6H 1NGZB 3KDMA 5L2JA 4AMKH 1O7SA 2W38A 1CLOL 4QRQA 2PO6A 1PEZA 4C83B 2H3NA 3WO4C 1KIRA 2GYSA 4PJEF 4S11A 1J1PL 1J18A 3LKSB 4DN4H 4U6YA 15C8H 1FRGL 4NRZA 4KJYB 3G6JA 2HRPL 2PR4H 1TZHA 2IQAB 5I30H 5H35A 4PRAA 3Q1SL 2F19H 5ISZE 2WLYA 1DL7H 5D1XD 4LU5H 3S4SG 1N59B 2ZSWB 2R8SH 3C5ZB 4M4PA 4URTB 4DN4L 4K23L 3U1SH 3MRFB 1JUFB 4EKXA 4CW1B 1B4RA 3MR9A 1WWAX 3C8KB 1TPXB 4X4XB 1ONQB 1OQXA 3QEQA 2CKBL 1FVEB 1FZJB 3QP3A 1IGCH 3O2WH 2IPKB 3OGOE 4ZUUB 2XQBL 4Z7WF 1M7IB 2A38A 4R4FH 4C54A 2IJ0C 3DARA 4RIRA 4Y5VA 3B83A 3AFLA 3L6FA 3TCXA 1FFOA 1I4FB 1X5GA 3MGTA 5DUML 3PWNB 1U8QA 3H7BA 4LRIC 2YD3A 1J05B 4M1GL 5DRXB 1JF6A 2CIIA 3O2VH 4L8CA 1I9IL 4EUPA 1WV7T 2FHFA 2I07B 5IEKA 2R0LH 5ID1B 3NIGE 1MJ8H 1AD0A 3EFFB 3QCTH 1ZXQA 2QQQA 4ZUVB 1DVFC 4WJ5A 1A6VL 1BWWA 4Z8FL 1KEMH 3QDMB 5J1SC 5HYJE 3QPXL 4P5TD 4RQQB 3CLEL 1XZ0A 1LMKA 1QSFB 2AJSH 4L3ED 4M9OA 3LMJH 4ZS7H 4H0HB 5TPWH 5DC0A 1HSBA 2YBRA 1LO2H 1MIML 4XPGH 4KDWA 4JPVH 4F37K 1CU4L 2UVFA 2Q8AL 3TO2B 5TQ2H 1R3HA 2X9WA 4X0KB 5DC4B 2SEBA 1K8DA 2NY5L 2ATKA 2BSTB 1F4HA 1ZT7A 4QO1A 1IAOA 3OV6A 1FYHB 3FB7A 4LCUB 3T04D 3H2WA 3MLWH 2YD8A 4OFYA 1ZMYA 2HKHL 1K6QH 5E2WH 5HHNA 1WIPA 4HFWA 1SJVA 4ODHH 2FJHA 3QYCA 3RUGA 4LPXA 3OXSA 4M7LL 4DJMA 2X1XR 5C70A 1CICD 3DJ9A 3S88H 1KCRH 1BHGA 4GRWB 4P2YA 4ZFFB 4JY4B 5L2KE 3TBWB 4UDTA 1OAUH 3UBXG 1A1NA 4OF3A 5EU3A 4P46C 2XKUA 5E7FA 4ZXBD 5CKGA 1GGIL 2HJKB 5AYQA 1OW0A 2ARJB 4DKDC 5FA3B 4JFEA 1R0AL 3DSFH 3HC3H 1N5YL 1IAKA 4UU9B 5CLWA 1BZ7B 4YHMH 4PRPB 2BSRA 1SBBA 2JB6B 4ZD3L 4KRLB 4H25A 3NZ8B 4X5WB 2K9UA 3INUL 2CRMA 2MMXA 5F7WC 4G8FB 2VDLH 5I1GH 1JPTL 3V2AR 4EXKA 4Y2DA 4YXHH 3LV3B 2DQTH 1MUJA 3FT3B 5I8EA 1UXSA 4Q9QL 1V3LA 4MQSB 3QAZC 4NO5A 3O3DA 3ARFD 4HLJA 1GGBL 2KKQA 5SWSB 4XNUL 3FAWA 43C9A 5IVXB 2HFFB 2B0SL 4JM2C 4ZQKA 5ENWB 4PBWD 1HN1A 3CSGA 4XXCA 4K3DH 1QO3A 3MRIA 5EPMA 1ZHLA 4HUUA 4QXGH 4RMTA 4XP1L 3RGHA 3QJHB 3ROOA 1GH7A 2F74B 4PJ8A 4JFEB 4PBVC 4JPIA 1AGCA 3FQTA 3PWPB 2E6PA 2OP4L 3OKKA 2VISB 32C2B 1DVFD 4LCWB 3G5XB 1VGKB 1IC5L 5TDNA 4Q6IC 3UC0L 4CVWA 3D6GA 1WBXB 4GAYB 4X6FB 2R15A 2MNUA 3EDDA 2I24N 2P43B 1KJMA 1VADA 4JRXB 4KMTH 1UCTA 2VABB 1Q38A 2AJVH 5ILTL 1YC7A 5JNYA 3BO8A 3QUXD 2FX8L 4U2YA 1PX4A 1RIUH 3V95A 5I1HL 4OTXH 1UJ3A 1AHWC 1CDIA 1HHKA 1MF2L 4X4ZA 2DL2A 1XR9A 1UZ8B 1IKFH 3P9MA 5HYJD 4OZHA 5CJXC 3A6OA 5J0BA 2W0FA 5E6IC 2FZ3B 5AYUH 4POYA 1HHJA 3QQ9C 5KS9A 2JCCB 2NY3B 4KTEH 1CICC 4NGHL 1WIUA 4P2OD 5L9DH 1WITA 3FZUD 1Q0YH 4YNYA 4L4VE 2ARJA 3U7WH 3F7YB 1Q0XL 5C0BA 2Z91B 3QR2A 1NBYB 2OL3H 2R1WA 5EU3B 1RZIA 1J5OL 2MCG1 3OSKA 3EYQC 2XN9A 3VH8A 4LSQH 1CBVL 5CZVH 3DI2B 4LF3A 4JB9L 1I7UB 2WSKA 3P40A 5IW1B 4KJQC 5DMGD 2XN9D 1ZEAH 4QRPA 5ID0A 3CDYA 2V7NA 5GGRB 3O6FD 1EH9A 4PJCA 1A7RH 4OQTL 3TT1H 2Z9TA 3VXTB 1JCKA 2Z0BA 1BBJB 3ARFC 1NCWH 2EC9U 5C0EB 3NACH 4APQB 1C8PA 1RUML 1C08A 2AGJH 3C60C 3EDFA 5TDOB 2YD9A 3EJJX 3BH8B 1HDMB 1B0GB 2C1PB 4HEPG 1KCVH 3ARGA 4XZUB 1K5NB 1AXSB 2ICWA 1I8KA 4APQC 1EJOH 4MZ3A 4F3FB 4Z7UA 3MA9L 3IAGC 3U79A 3GO1L 2YUXA 4L5FL 4Z77A 1NMCC 4WFFD 2OL3B 2AV1A 5DD0L 1WFOA 1H3XA 2GTWB 2DTML 3IDXL 1FBIL 1OAYH 4M7ZB 4NM4L 4AQ1B 2X09A 3SDYL 1QQDA 1R6VA 5DHVB 2EKJA 4N1CA 1I85A 1LEIA 2DLIA 1FLRH 3ZDZF 2PN5A 1PSKL 3RBSA 3QUXC 1FC1A 2H26B 5GXBB 4LLMB 1XEDA 4BFGA 5EU4B 4KWUA 5E4EB 3BZDA 1D5XB 3MRMA 2A6IB 4MB4A 2VH5L 4NNXB 5EC2B 1MF2H 1QRND 5EO1B 3MYJB 5HJ3B 4R96A 4HX1B 4MJ5A 3BI9X 1D5ZA 5A43C 1BX2A 1DEDA 1E4JA 3L7EB 5HPMB 5I1CH 3NACL 3R0MA 5ETUB 1JPGB 4DGIH 1WCBA 4P2OC 4EI5A 1KEGH 4JKKA 1N0XL 3MA7A 2DQFB 4LARL 2HTKC 4OGYL 1KB5L 1I1AD 1GZPA 2BSSB 4GS7C 3F6IA 2C4XA 5F72S 5E9DE 3VDAA 4G8EA 1NUDA 3TP4A 4KTEL 1HYRC 1IL1A 4GO6B 3MYZA 3V5KB 2XRAH 4G42A 3QT2A 1S5IH 2CO7B 1BQUA 4PJIE 4KQ3L 4Z7OE 3DLQR 1ZT4A 4JRXD 2FD6L 1UM5H 1FVDA 4ZAKA 2RB8A 3DVFA 1IKFL 4KDVA 3QG6B 4I3RH 1A7OL 3MUGA 4JJHA 5CP3H 3TA3D 3H9HA 4ENED 3O6FC 3CDGA 3OAUL 3LH2H 4O2CB 1OSZA 4JANA 2AJVL 4EUPH 4YFDB 1AP2A 1KULA 3RUGF 4UBDC 5AZEL 3DVNB 3JWDC 1AGEB 5BS0D 5F9DC 4QXTB 3WSQH 2YC1A 5EZIL 3HHRB 1S9WA 2CDEA 3IU4H 1BP3B 1K4DB 3O6LL 3IJYB 2I60L 3K2MC 4FP8H 1IQWH 1NL0H 3CJJA 3GSVA 4FOMA 3D39D 2DMBA 2B1HH 2WK2A 2B8OT 3KR3L 1DQDH 1JBJA 2VMFA 5DZNA 1ZANL 2X4PB 5J3HC 2B20A 4O4YH 4LCCA 4KKCC 2X1QA 3ES6B 5BZDB 5IBTL 1MCDA 3QUMA 1OSPH 4HKJA 2UY7A 5HHVH 4E5XA 4U1MA 4FA8A 3GGWA 4HHAB 5D9SA 4ODWB 4RFEA 3UJIL 1SJEA 5C9KA 1SY6A 3HZYA 3WUWB 3EIFA 4MXVF 5DJYA 1KTLA 1V3JA 2E9JA 3MUHL 4PRIB 4J1UB 3QXVA 1QR1A 1GGYA 4KUCF 2VQUA 2BY2A 4MD0B 3WDHA 4PJBA 1RUKH 3G6AA 5FIEA 3CVHH 1K5NA 3HUJF 4Q0XH 3C09C 1FLTX 5C08E 4HBQA 1R5VB 2G2RB 2VLKE 1BFOB 2X1OA 5DFWH 3WNPA 5DRXA 1H0DB 4KVCH 3K8LA 1FQ9C 3QDME 1F3JB 4U1JB 3NCJH 4NQDE 3MFGB 4TVSa 3V7AG 1ZHKA 3EYVA 3MO1B 5ALCL 3MJ9L 5C0FB 3HNTL 3VXSA 4F7EA 1RK0B 1V5JA 2ESVE 3D85D 3HFML 3EJYC 4NPYA 2GTZA 2H8PB 3I75A 3BZFA 4A6YA 2IPUK 3QPXH 4D9RD 1CICA 2APVA 4DEPB 3R8BB 4NOFA 3REWB 4LLWB 4M7LH 3HAEH 1ZANH 2PYFA 2XZQH 3WV0A 3K2UH 2MQ0A 4X6DB 5E8DL 2HVKA 1O5DT 4HG4K 3M8OL 5GGVH 3EO9H 5EU5A 1FNHA 1J0YA 3RTQA 4S1RL 5L7XH 1H3TA 4JFHD 3WSQL 2NY1D 1P1ZA 4JY6A 4Y19E 5FM8A 1IT9L 5GGSB 4N8PA 3TA3C 4I1NB 4U1HB 4TSCH 1DN2A 3GM0A 1LQSR 1ZLSL 1NMAH 2WANA 4WRLA 3V5KA 4U0RB 2OQJA 3Q48A 4JKPL 4ESKA 3VWJD 2NMSA 4AEIL 4UBDD 5DQJA 3MOQA 1Y6MR 5M94B 3P9WB 5CP7A 5HDBE 3PJSA 5IW6A 3HPJA 4ORGB 4NKQB 5CCKH 1JNHB 5FO7A 1CXFA 4GW5B 5GS2D 1B0WA 4D9QD 3STZA 4IIQA 5C9JA 3U1SL 2J3SA 2ZOLA 3BO8B 4PRBB 4OD1H 2GQHA 1E6OL 2EDWA 4LSUH 1GGUA 4YO0A 4PJDE 5BS0A 4G9FE 1L7TH 4P48A 4KKCD 4JQXA 3WKML 2I25N 3U46A 1JTOA 3DGCR 1CXLA 2PR4L 1KPVB 3RWCA 5DEFA 4P59H 3AM8A 4FXKB 3D9AH 3DX6A 2YK1L 2X4UB 5A3ID 4HAGA 2Q76B 5JW3H 3HUJE 3FO1B 1J0KA 2DJSA 1YQVH 2PTUA 4IS6B 4DWHA 3BZEB 4PJFA 1INQB 4EDXB 3FN0L 4JAMA 2FX7H 4Y7MA 3MGOB 3LCYA 1WEJL 5SWSE 1G0YR 1HI6A 2CJUL 3U6RA 4R7DA 5FFLA 5FB8A 3FO0H 4IRZH 2XNAB 2VLJA 4U31A 1MJ7L 1Q9KA 3FOLB 1FHGA 1WGOA 3RVWD 3S4SA 4LRIA 4OZGB 5HD8D 5IB2B 3O41A 5I75B 1KJ3H 3DO3A 1ORSA 4PB9H 3VMOA 4PY8I 3IYLW 4OFDA 3QPQD 3UDWA 2H2PD 3F62A 5TE6L 2G5RA 3LKPB 5E6IA 2PO6D 1BMGA 2A83A 3HZVB 1JMXA 2J6EH 2GITB 4F33B 2O5YL 4G6FB 1QR4A 3O3EA 3ZYOA 5KSVB 2AJYL 3Q3GB 4WUUE 5F44A 3O6MH 4X4ME 5IR1B 1U8PB 2P48B 4Y19A 1RHHB 4JZNB 5C08B 2FEEI 4JZJA 4Z0BL 1BQHA 5I71B 2ZOKB 5I30L 1S9KC 4HV8A 1A6WL 3I6KA 1I7UA 3EOBA 4Q2ZA 3RUGE 4HJJH 4J3VA 1KV3A 4G8IB 3O4LA 3ARDD 5FYKD 5GGRY 5CEZL 2PTTB 2VO5A 4LCIH 1MQKH 2NW3B 3SPVB 2EZ0D 2IALA 3OXSB 5TGBA 2BRRL 4AJ0A 5DURD 2H32A 2DM7A 2EDOA 4X4YA 2J8UA 5DRWA 4RISH 5ICZA 4FQ1H 5BS0B 1FZOA 5MENB 3RZWA 3QIUA 2BMKA 2Q6WB 2XG4A 5BVPL 1NFDA 4HUWA 3H9SB 3MLYH 3KJ4C 3QJFB 3BESR 4YAQB 5FM5O 3HS0A 4NFDA 4F8TA 4Y4FA 1HSBB 4FQQA 5F3HB 2F53A 1LP9A 1NCCL 1G7LB 1L7TL 1MCNA 5E9DA 3TJEL 3BGMA 3TPUB 1D6VH 4JPWL 2ZG2A 4KJWC 1RJLB 4R9HA 5FECB 3SCMA 1CFTA 1MVUB 3MMEB 5EDXA 1I1AB 1XF5B 4M7KH 3D18B 3TT3L 3ARUA 3IJHA 1YDPB 5GGQL 2B5IC 5IESH 5I71C 1JYWA 5J6GB 3EFFA 2QQNL 3F6LA 2VQ1A 2XWTB 3EOTL 5HGAB 1D5MA 2A6JA 3MV8D 4EDWL 1JZ7A 5ANMB 2RJMA 3WHE1 4ZMAT 3X12B 3G5YA 4GAFB 2BC4A 3MGAA 4M3KB 5IJVB 3IDYB 3UBXA 1YY9D 1HYSD 4E0RB 1AQDB 5FYJL 4PJAA 1BFSA 4RNRA 2ESVA 4YHKL 3RX8A 4P46A 4XPBL 2BY3A 3IS1X 4RIRB 5EOTA 4UQ2B 5CBEA 3RWCB 2UZIH 5AAMA 5FYKU 3QPQC 1CD8A 1J1OH 4P5KA 2PO6C 3BAEL 4ZDHB 4OLYL 4GS7B 3N0PB 3IVKA 5F70A 3I3EA 3F7PC 5BZWA 3HZVA 2ZCKL 4YHNA 4OLWL 3FN9A 3KLSA 4C4KT 8FABB 1IC4H 2YR3A 1UXSB 4CVZB 4K71B 4LAQL 3QXDA 4HPYH 3MRDB 1Q94A 5E00A 3ZMRA 3BPOB 2FEDC 3QEHB 4UNVA 3C6LD 3PDOB 4A2LA 3Q6FA 4P3CL 1RAMA 1CYGA 1OWWA 1ZT4B 1OD7A 3GMLA 1Z0MA 1S7UA 3RZCA 2WWKO 2WQ8A 1FZMA 1PAMA 5JR1L 5DR5L 2YOCA 1TITA 2JELL 5K9QG 2EZ0C 5LCVL 1MLBB 4FXLA 1MNUH 2MKWA 3QIWC 3D39A 4JRWA 4WI8A 4OJFH 5EU6D 1BD2D 4U05A 3UTQB 3LIZL 2IF7A 4MA8L 1JZ2A 5I8OL 2HJFA 5IK3B 4ETQB 4Z7UE 3O3UN 2Q86A 1M71A 1P53A 3TWCL 4UT6L 2MSPA 2HTLC 3L1OH 2X7LB 1JPGA 3GBLA 1GOGA 3QDGB 4HC1H 2JJSA 7FABH 4MSWA 2F8XC 4H0IA 2VLJD 1JGEA 5MEPB 3RNKB 4HKBB 3SJVA 4S0TD 1AO7E 3RNQA 5DUBB 1G1YA 3JV6A 4MVBD 3MBXL 3N1GC 1LO5B 2Z31D 3DRTA 3VGDA 4D94A 4WI5A 4AQOA 1OM3L 4ZO7A 3BSZH 1FL3B 1XAUA 3FFDB 3JXAA 3TIDB 1KB5B 3VD4A 1H3VA 1L7IH 4DKFL 1YYML 4H8WL 2H2SC 3KYKL 2IBZY 4HPOH 4KVNH 5CILH 5DQJB 4QYOA 1MY7A 5F3HA 3VI3F 3MLZL 1FORL 2ENSA 5DHVH 3DYOA 2VXTL 2HKHH 4PJEB 4NC2B 3TNNB 2Z31A 3BEWA 5C0IA 1J86A 2BOBB 2FEEL 1R3KA 5AAWA 5EA0L 1MRCH 3OB8A 4XBEL 1FJ1B 5EUKB 1IGJB 2QSQA 3QXWA 4ODVH 1HYSC 3SDAD 3BGFC 4FQHB 4Y4KA 5GGTL 5E99H 4KQ4H 1TJHH 3BUTA 1OL0A 4NM8H 1JGVH 3VU2A 4KI5F 2APTA 2Y1VA 4WFED 3K7UA 2HP4A 2VSCA 1BLNB 1ZHBA 4N0RA 1DE4B 2AJYH 1BM3L 1KOAA 4JFQB 3HE6B 1FE8H 1NEZG 4N90E 4F58L 3HE7D 4APQA 2XTJE 1N6VA 1DQJB 3B9KC 4N0YH 3P77A 3QUML 1RJZB 1WSST 3TJEH 2VE6B 4F9LA 1JNNL 3FT4A 4GG8A 4H1LA 1ZT1A 2FEDD 2EDJA 4DQOH 3RKDC 1JF1B 4QGYA 2AJXL 4KZDH 3MRFA 5H94A 1K4CB 5FKPA 4RCAA 4IIQC 3A6CL 5IB2A 2D9QB 4PYGA 4YDIL 1CR9L 5T1LA 2CLZB 3HNSL 2AV7A 2DL9A 4GG6F 3KPQB 1EFXD 1SEQH 4Q6YA 1CL7H 1QBMH 1RZ8A 3BP6B 2APBA 4MX7B 3S5LB 2WUCL 5I73B 3IDIA 4GRLB 3MPCA 4RWYH 3MGOA 4I0PD 3HPLB 5J1AB 1MLCA 2EXWC 1IQDB 1D5IL 4L3EB 3OXRB 2KZ1B 3OHXB 5F6IB 1KYOK 5DD5L 1H5BC 4MQ7B 4NHCH 4IOFC 1MHCB 2GSIB 3B9AA 3UX9B 4I77H 2H6PB 1KNOB 3DECA 2Z31C 5C7XH 1ZT1B 1T1YB 5F1NA 3BJLA 4ZXBB 5DD3H 3MJGX 2J6EL 5FHAH 5B8CB 5CGYC 5F7HA 4DUVA 4M7JH 4N8CH 2H2SD 5DTFA 3SHSA 3S3JA 4YX2H 1KB5A 3NA4A 1NGXB 3NCFB 1AHWA 1AQKH 4Y4HA 4GG6E 2PYED 2EDTA 3L7EA 3CFCH 3WN5C 1EUUA 1JWSB 2ZUQB 2Y36H 4R96B 1RZKC 2UYLA 5INCB 1TNNA 4LRNH 3MFFA 3MLVL 5BV7B 5BXFB 4WW2B 5FO9A 3LEVH 2P5WA 4G9DB 4ZUSB 4HMDA 1A7RL 4W81A 1HNFA 2HMIC 1MWAH 2J8OA 3V4PH 3MODL 3QQNA 4PJDA 1T0MA 3V52L 5BS0E 3B3IB 3UYPA 1UKQA 4HXBL 4HQQH 2EDXA 4HIXL 2DRUA 3PDDA 5FKAA 3ARYA 1S9XA 3H6JA 1G9NH 2VLKD 5FK9B 1RI8A 2E7HA 4MQ7A 2B39A 3EO9L 3KPRE 1BOGA 4LSQL 1CBVH 4OZFA 4QTHA 5E95B 3D0VA 2EYSB 1RZGA 3SO3C 2BOBA 2A9NL 3U4AA 3TYGH 1ZSDB 3HE7C 1JRHI 4HWZB 4QHKI 1GGCL 3B9KD 4JFDB 4ODUB 2F53E 4NSKA 3V6ZA 1NLBL 4JFFB 3P4NB 5DJ6A 3VDBA 1BWMA 2DQFA 3P0VH 5JOEA 5MERB 1KTKE 3NFNB 3L3HA 4TNWF 4OZ4B 4NJ9L 4JKMA 4U7MA 3RKDD 4Y19D 4WTWA 2H32H 1JV5A 3T3MF 2B2XL 1MVFA 4EI6A 4JRXA 2FCBA 5EOCH 5CBEB 4NZDA 2D7TL 3V4VH 3GK8H 1WFNA 4LP4A 3DRQA 1V3MA 3VI3E 3IU3B 2G75A 2GJ6B 4XB8A 2FSEA 1FZKB 2LE9A 5FYLL 1UJ3C 1EO5A 4PRDA 3BVNA 3U0TB 1A6TB 1KBGH 4I0PC 3C60A 3KAAA 1N64H 5I1IL 4GRWH 4R2GC 3WE6B 3BZ4B 4HUUB 1OWRM 3NH7L 4KK6C 4NHUA 1IC5H 4XVTH 4YBHA 5GZOC 4ODSH 3SGJA 4Z5RB 4L3EA 4IOFD 12E8L 3EZJB 4OCRL 5IKCB 1IEBB 1QR1B 4M7LT 4HUXB 5J6HB 2XZAL 3S5LA 1XGPB 2WW8A 5FGRA 4EXPX 5IIEA 1KLUB 3CXDL 4GQ9H 2V5SA 1NC4A 3O8XD 1F4YL 2CGRL 5BJTA 4ODWA 5I8KH 4ZO6A 5ACLA 1J8HA 1RY7B 5CGYD 4CJ1A 5HHOB 4YIQA 4PJXB 5HGBA 5BZDA 4G43B 3T2NL 4MQXD 3LPFA 1G6VK 3FB6B 3TIEA 2C3VA 1YN6A 5JHDE 3ZE2E 4BZ1H 1Z9MA 5JDSA 3P9MB 2IH1A 3FQWB 1AO7D 1F97A 5F88A 3VXSD 2HMID 2JJSC 2OS7A 2P7TA 3KS0H 2CQVA 1ZWIA 4KVCL 3TYFB 1AIFB 2IAND 3T1FA 3D3VA 4YHZH 3EO0A 1AP2B 5DRWB 4X5XA 4L8CB 4WO4C 3G5ZA 4LDLB 3WFCL 1S5IL 2AJZA 4W6WB 5EU5B 4LBEB 1IQWL 3FKUS 2HVJA 5LGJB 1BD2B 2W9DH 5FYKH 2AABH 2XN9B 2R2HA 4YC2B 2IQ9L 4JM2A 5C07A 3V5DB 5C0BB 3WDIA 1DQLL 1MOEA 1AKJD 1QUNA 2VZVA 5D5MF 1C1EL 4OUOA 4PJ5A 4KHXL 5D96B 2HA1A 4D2NA 1S7QA 1OTTD 3HE6D 3SO3B 4NQVB 4XXDB 4WWKD 3BZFB 4A6YB 2FBOJ 3H0TA 4XHQA 1T21A 1AGDA 3TVMA 5B3JE 4MA7L 5TQ0H 1MY5A 1OTSD 4ZG1A 4CADB 2Y06H 3VFOA 1DLFH 1C16A 2LTQC 1UCBH 2QJDA 4OFVA 2YN5A 1XF2A 3DOSA 2JJWA 4NUGH 1KACB 2VDRL 3AREA 3LZFH 3MLRH 4KQ3H 3ILQC 2DDQH 2CUMA 3TH3T 4LCWE 4FQXD 4LEXH 4JR9L 3JVGA 3CH8A 4V1DE 3GBMH 3ZYJA 4NQDB 5IKCA 4K7PY 2XI9A 2C3WA 3LH2L 5EU7E 3OX8B 4R2GD 3SKOB 5HPOA 4HS8H 1JI1A 1CDYA 1LP9E 4L8SC 4LLMA 2VDPH 4BKLB 2EYRA 2HJKA 1WAAF 5D7LD 4UIKH 1GVIA 4LQFL 4EZMA 3BZEA 3O8XC 3GFUA 4HWBA 5I8CA 1I9RH 3TBWA 5EIIA 4WFHE 5DD1H 2UWEE 4LSRL 1HHHA 3EDJA 1T04A 1UG9A 2FJHB 5IQ9B 3MACH 3B2VL 1CGSH 3P30L 5DS8A 3FT3A 5KVGL 5F9JA 3CFDA 3LQAL 2ZUWA 3KVQA 4GMSL 4EI5D 5KSBB 1LHZA 4NKDB 3CFCL 1QNZH 1UA6H 4DN3L 1ULVA 1PZUB 4Y5VC 1MCEA 4FABL 2D4FA 1G7IB 2ZPKH 4OIBA 1YEFL 4BQCA 3MRKB 1PKQA 3MRQB 1FGVH 3F58L 4PGJA 1TVBB 4PRID 4DZBA 3UTOA 3WKNA 1HWGB 1NFDF 3V8OA 2V5MA 3QAZB 3KPMB 1H3PL 2OJZH 1J5OH 5SX4I 3UZEA 4XXDA 1T21B 3F7RA 3SDYH 2MHAA 3H0TB 1JGVL 3LQMA 3GIVA 3E6FB 4ELKB 4UDTB 4QRRB 3UCRA 1N5AB 5F1OB 5F7EH 3VW3H 2FX9L 5ALBH 5EO0B 3MLTA 3T0AA 1H3PH 4J4PD 4MXQD 5CZXC 1KF9B 3TCLA 3GBML 1SEQL 5E0QA 1J0IA 1P69B 2L4OA 4ODTH 2Y5TB 5DD6B 3GJFB 3HG1B 4MJ5B 5ICYA 4U1IA 2AKRB 2BXZA 2A0LC 1MH5B 4FFVC 1CICB 1RIUL 5GRZA 1I1AA 5FUZH 4MWFB 4DQOL 5MEOB 3LQAH 1MAML 3LD8B 4S1QH 3QUXB 4M93C 1YJDH 5JDSB 5DVLA 1JUFA 1NC2A 4F15C 5HI3D 2D0HA 4Q9CA 1IGYA 1OF2B 5IFAL 3TF7C 2FL5A 1MRFL 4QRUB 4LSRH 3VMPA 1B6DA 5F3BA 1N3NB 3BP6A 4QNPF 1MLCB 2M26A 1U3HB 3RWEB 1KENH 2DWEB 1FV1A 5EBWA 2M1KA 3IJSB 4P2CG 5DHYA 1NMCB 1KN2H 4U1MB 4E41A 3TBSA 1U8QB 4HKJB 1H15B 4NCDA 3IRPX 2Z93A 4YUEH 3FFCE 3T2OA 3WLBB 3HZYB 5FO8B 5K59E 5FKPB 2CIIB 3OKKB 4RFEB 4PV8A 4GW1B 4G9FB 1FZKA 2JCCE 4WY7H 1ZOXA 3LDBC 3T8XA 2O26U 1JF1A 2R2EA 2COQA 1U9KA 5CS7A 4KMTL 2ZOKA 4L4TA 5DEGA 3T0EE 5F7LB 1JGUL 4F7CA 3ARVA 4CNIA 4LLUA 4GKSA 4YDLC 2DQIL 2XZCL 1XCQB 4Y8DC 4PG2C 5CEZD 5DURB 1ED3B 1JVKA 2D7MA 1JZ4A 1F3JA 3IF1A 2QEJA 3EO1B 1G6RB 4YHML 4LNRB 1FFPA 1RIVH 5C92A 4GQ9L 4O2CA 1N5YH 2Q3ZA 1YPZF 4N0UB 3GMPA 4H26B 1TZHB 3U36B 4G6MH 2ZNXA 2QR0B 1CLYL 4KJYA 2CMRH 3D2UA 3G08A 4GUPB 2YHGA 2DWEA 3CPLA 4UT6H 4KUCD 1HHIB 5CJOL 1WWCA 3LHPL 3LKSA 4J4PC 4MA8H 1J8HE 3OR7A 5IHZB 5JXEA 1K6QL 4YEEA 5CJ5A 3GK8L 5C0AB 3ZTNL 4MZ2A 3IKKA 5D1QA 2A0LD 2HFGL 3CFIC 2C1OB 2FR4A 4X8JB 1TIUA 4QHUB 4EI5B 4LGSB 1T22B 4KKLC 1U8MB 4NJ9H 5LAXB 5C0RH 1LDPH 2YEZA 3GEWB 4AM0A 2WV3A 2IFFL 1LE9A 4ZFOL 3RNKA 2Y5TA 3MV9E 1W0WB 4NO2A 3S34L 3EBAA 3WS6A 2X7LA 5IB5B 4G7VH 3OKEA 3QDGE 5AG9A 4OF5A 4KKAC 1S3KH 4M1DH 3STZB 3H3PH 1QFOA 1V8HA 2Q86B 1AC6A 1ZHKB 4JVWA 5F1KC 2X2YA 1IFHH 1E4KA 3PQYA 4BM7A 2E27L 2DKSA 3SKJH 4NZUL 5TDPB 5IHZA 3CPLB 5CEZH 2VIRB 4JJ5B 3MRIB 5DJDB 3GNML 4K2UH 1LO3L 1ACYL 3NPZB 4L4TE 5DUMH 4XAWL 4DK6A 3PHSA 3CFKA 1VDGA 2XA8L 4PP2B 2BY1A 2FJFB 3L3DA 2VDMH 4ZS7L 5EBWB 2GJZB 4R3SA 4PS4L 2Y7QA 1CE1H 2YD7A 5FV2A 5D70H 1GHFL 1KC5H 4MNGB 1I8LC 4OFYD 2NY5H 4OAWA 25C8L 1T0NA 1Z9OA 2NY6C 5TQ2L 1EK3A 4PB0L 1WWWX 4G6KH 4XPTH 1YZZA 5D7KE 5C8JA 3GSVB 2KUTA 3SDXB 3FT4B 3T08A 2J8UF 4H1LG 1IAKB 3ALPA 3GKWH 4WTZA 5JW4N 4LSSL 3QRGL 4FQ2L 1CT8B 3B9EA 4YHIA 1ZLVK 4GKNA 4LFHD 3CVIH 1OGAE 1XGTB 3ARZA 4PTTB 5IG7B 5SWZD 4RWYL 5JW4M 1OTUD 1X4YA 3IGAB 3U9UA 4OGAD 3NABH 4FQLH 4ZO9A 1BLNA 3MUJA 2W60A 5D7LE 5DJAB 3NCMA 5ITFA 3RWHB 1CS6A 5BMFL 2GJZA 3OPZH 3QQ3A 5JPNA 3WXVH 4YQXL 2D7NA 1LGVA 4U6HB 1ZWIB 1FH5L 2YK1H 3SKNB 4ZAKB 4XP5H 3RIAF 3V6FB 3B9VA 2HT4D 1Y6NR 3LEXB 4KKLD 3FQWA 1A0QH 1IEAB 1BQSA 5E9DB 1M7XA 2G60L 1Z2KA 3V79C 5ISZD 1RJLA 4PJEE 5I1LA 3KYAA 1MCIA 2VSDA 3WJLC 3PGDB 4FQXB 4G43A 1ZVHA 3WO3B 4RGND 3T0VA 5D6CA 5DWUL 3QA3B 2D9CA 3E6HB 3QUMH 3ARBC 5HYSG 1REIA 5EBMA 2BMKB 1U8KB 5GJTH 5AD0A 3ZKXC 3SDAB 2EDLA 4M7JL 4LEOA 5EBLB 3SGEI 1BFVL 1QRNE 1UH4A 5JZ7D 3AUVA 1K4DA 1TJIL 3N1PC 5TE6H 2ZWLT 1X5YA 1QSZA 4NO0D 5HI5C 2XKNB 3TBTA 4TTDD 4JFXA 1JZ8A 4OFPA 3OKDB 3MRBA 2QADB 3QBTB 1ZLSH 1MFDH 2AJZB 3IAPA 5E99L 3LRSA 3C9NB 1QFWL 5DJ8B 4FQJL 1IGFL 3VXUE 1AGCB 3QI9A 4O5LL 1VFAB 3WFHA 1S78D 2EIDA 1C7SA 3GIZH 3SKJL 1L0QA 5HGDA 4OLVL 4IDJH 4YXKH 4HGMA 4HKXA 4G6JL 1KELL 3VGBA 3K0WA 5MI0C 1KTDB 1JTTA 3L5JA 3A6CH 2HT3C 3DURB 4NKIL 4Z9KB 4HZAA 3B8YA 3D0LA 3ARSA 4DZBB 2NY6D 4DK3A 4LSPL 3MXWL 1G9EA 5JHDB 3MV7B 3WJLA 1XR9B 4KZEL 2X40A 4S2SA 2CUHA 4NZUH 1JNNH 3QZWB 4ETYA 1YUHA 3IETA 1KPUB 1KJ2H 1CFSA 3LOWA 4LKCA 4BSJA 4LVNC 3PWPE 2P8PB 2IQAA 4R8WL 3T1WA 5BZWB 4B41A 3G6JB 1RMFL 3VGFA 4M61B 1U3JA 2VDOH 3D0VB 4P2RE 2WWMD 4CNIB 2DQJL 2HN7B 3F8UB 2ZJSH 3MROB 2PW2B 5L2KD 1JHKH 1FIGH 32C2A 4UQ3A 4FRWA 2J4WH 2CDGB 3QUZD 4LLDA 2NLJB 3D1MC 1X3DA 1WTGT 5JDJA 1NCTA 1C5BL 1JNJA 1U8LA 4L1DA 1PJ9A 2HT4C 4JY5H 3GNMH 4RGMC 3CGTA 1WJ3A 2W9EL 5JIIA 1MRCL 3MFFB 5EA0H 2HFGH 3CZFA 4WU7B 4L29B 4KRMB 2YMXH 2X10A 3DIFA 3G6JF 3ROLB 1K8DB 3ARBD 5E8NA 4CDHA 4OLWH 1U3HA 2XKNA 3TBTB 4PGDB 3CXHK 4M5ZL 4KVNL 4FP8L 4XMPH 3GRWA 4IMKC 5DI8B 5FGCB 5JZ7C 3K81A 3KYMA 1P84J 4MA1B 1J0JA 4JQVC 3AS2A 4F7PA 3WS3A 3HFMH 5HI5D 4W70A 4WHTA 5I1LB 3L7FA 4G6ML 4PRPA 5BVJA 2GKIA 5E5UB 5DFTA 3LEXA 1PD6A 3QDMA 3KPSA 1HKFA 4NDMA 1R5IB 4HKXB 5TE4H 1U93A 3PDGA 4JY5L 4MX7A 3BWUC 4OQ1A 5KANI 3DX9A 4E41D 2GAZB 4YEFA 1I3VA 2PW1A 1A47A 1RUAH 2NXZC 2P24B 5DD6A 4H8WC 3WFHB 2ICWI 3OAYH 5CEZE 5ICZB 2YUZA 3BPLB 1OAZL 2OX5A 4XNXH 1OGAD 4WO4A 3G5ZB 4GQPH 1ZVSB 3V6OC 2APFA 1ZLUK 1PG7H 2ZUUA 1AIFA 3HZKA 4OCSH 2B1AH 3EO0B 4Y4KD 2G75B 1EBAA 5F88B 4NKOB 3TO2A 1UVQB 1QSEA 2PYEE 3P4OB 5D71L 2F54B 2X4RA 1T1WA 2YPKA 5EUOE 3UTTD 3ZT5A 5F8RC 1V7NH 3DXAB 1EMTH 5EZOL 4N68A 3RY5A 1FP5A 2A83B 3MJ8B 2HAZA 3QO0A 2VLME 4RISL 5EZIH 3LKPA 2BVUA 1SY6H 1SBSH 5B21A 1XGPA 5F9JB 4MNGA 2EH7L 1CTOA 3HG1E 4FZ8H 1EUTA 5DK0B 5C71A 5DJYB 3QUZC 3ZTJH 4NN5B 1FNAA 1HINL 4XCFH 3SDXF 4PRAB 4JO4H 5DQ9B 3DIFB 5F93C 1JPSH 5FUZL 2EIEA 4U3XA 3NA9H 5C1MB 1IGFH 2DLEA 4WWID 5D2NA 3RDTB 5BOZG 1FNEA 1H9VA 4JFFE 3S3PA 3HCVB 5E5RB 3ZHKA 1YJDC 4KROB 2DTMH 4KXZI 5T3ZH 1XF4A 1LVEA 3PQYB 3PABB 2GHWB 2YD4A 4HUMB 4OSUL 4I0CC 3IFPB 5GQBA 4EQ3A 1JWMA 5CIPH 1QLFA 1QZ1A 1EEZA 3U2SA 4KROC 1HZHL 1FGVL 5FAAA 1KENL 3BEVA 5BRZE 2G9HB 5J13B 1T5XA 4P5MA 2WBWB 5CBAB 1YEFH 1CFVH 4NO2B 3FRUA 1DSFH 3VFSB 4ACPA 4P5TC 1EDQA 3OKEB 1X4ZA 1X4XA 1NQBA 4N0UE 2E7LA 4ONHA 2I5YL 3KNBB 5BQ7A 5IHBA 2AEQL 2Y25A 1UM6H 4JANB 4HS3A 3CH1B 3VXNB 4FTVB 2QKIA 4OQTH 1YNKH 1FGNH 4O9HH 3ULUC 1GPOH 5B8CA 3ESVF 4G3YL 1TVDA 4NSKB 4AEEA 4MD5A 3TM6A 2LVCA 3L5WB 4GXUN 1CFNB 4GAGL 3JUYA 4HIJB 5JORA 3UTQA 1YN7B 3UJTL 1D9KA 4G8FA 4PJ8D 4ELKA 4F7MB 3CFKB 4J3SA 2VAAB 3V0WL 3OPZL 2XTJB 1W8NA 4UB0L 4CDGC 4K71C 1KIRB 4X9HA 3VRLE 5IBLC 4Z7VE 3O8XB 3GIZL 1B88A 1UB6B 2LVEA 2QL1A 1BOYA 1QSVA 2XTJC 3SKNA 2PYEB 3P73A 3REVA 4NQCD 1HEZA 1U2CA 1DEEA 4P46D 3LD8C 1MRDL 4Y4KC 1OAYL 5EB9A 3QQ3B 4PG9A 1EA9C 4GAJH 1QACA 4JZOB 1FC2D 2H45A 4LVHB 5AEAA 3BXNB 4F37F 4Q9RL 5EG6C 2JJVA 4YHYC 2JJTA 1UWEH 4MB5A 1NCBL 3G6JE 4Y4HC 2BNRD 3MRCB 2EEDA 1GAFH 3JSSA 4XMKL 3OZ9H 3VGGA 4OBRA 1U8NB 3W5NA 4N8VA 2APWA 1KJVB 1VEPA 2A6IA 2JJTC 4I48A 5EOCJ 3CC5B 1KGCE 4OLUL 3S35X 1W72H 1WQVT 1WZMA 4K7PL 1IM3B 2AJ3B 3Q5TA 4LLUB 1UEYA 3GSOB 4NBZB 4TSAH 4FFWD 5FYLD 4PV8B 5C0ND 4AY0A 4FG6D 4FZ8L 2VC2L 4PJDF 1NAML 4OV6F 4JM2D 1SY6L 3IDJB 5DSCB 3DWTA 4HC1A 1DBJL 3ULVE 1CXHA 3MV9A 3FN3A 3GSUA 5IB1B 3RZCB 3MNVA 5CZVL 2E6JA 3SKUD 4Y5YA 4KROD 2D7QA 2Y6SC 4K9EH 4M1DL 1D6EA 4XZUA 3O6FB 2FB4L 1W8OA 1BZ9B 2C1PA 3FQUB 1RZJC 4HS8L 3VFPA 5HDQL 1UADC 5D2LB 3BEWB 1Q0XH 3GMNA 5B3JF 4JFPA 1SJHB 1U92A 1VFBA 1QBBA 3ZYIA 4PTTA 3GKWL 1M7DA 2AK4E 4LSUL 2ERJB 3U0WL 4RX4A 3SDDC 2OSLA 4P3DB 2X1WL 1ES0B 1WISA 4TRPL 1FL3A 5IFJB 4YHZL 1Y18A 4PJ7F 1UB5B 1OGTB 4WUKL 2Q8BH 2B7DT 1EHAA 1MI5B 4PP1C 5E6ID 2AXFA 3VXMA 5I1KL 3QHTC 5IBLD 1MHPL 4PGEA 1ZA6A 2VLRD 3LSOB 3FZUC 2XTJD 5B38A 5TJWK 4P9MH 5ICXB 4E42B 3D69A 3PP4H 4HK3J 3T65A 3VGEA 3ZKXB 4EBQH 3T1FB 5F96L 5KVMC 1ZKAA 4RRPA 2GUOA 3MV8B 4NQXA 3S88L 4FQHA 5IGXH 1QLEH 5KSVA 2BHYA 1UB6A 4LCWD 2IFGA 4H1LH 1DQDL 1KCKA 4NQTA 5GJSL 4Y4HD 4JO3H 1UXWA 5C09A 2EIZB 5J57B 4WUKH 1V3KA 4OCRH 12E8H 1GZPB 2BSSA 3ZKMC 4L3CA 2UZYB 1WAAA 4HH8A 1G7JA 5D7LB 4Z0XA 4KJQD 2CRZA 2BVYA 2JCCF 2WIMA 2UUDH 3SE8L 5EIVA 4UV7L 3TIDA 3U0PB 3QNXB 1OP3H 3D2UD 2IFFH 4FFWC 4ZFZA 3KNBA 5E8NB 5BQ7B 5IIEB 1OGAB 3C8HA 4POZD 4F9PA 4P4KB 1RFDH 1QA9B 1WT5C 3SPVA 1A3QA 1KCSH 5LAXA 1UQSB 2EDQA 2DQCL 3ARED 4GOSA 5CAYB 3VXRD 1D9KC 5FM5M 4HZLB 3CXDH 4BH7A 3PWPA 5T1LD 2XFXB 3DSFL 4DEPC 5A2JH 2F74A 2GI7A 5T3ZE 3RKPA 1OAQL 3PXJA 2RFXA 2VXUL 2P5EA 1MCOH 3RZCC 4M1GH 3D25A 1CGXA 4ZQKB 3RA7H 1QO3B 1JHTB 4GMTH 1G7HA 3BPNC 3C2AH 1GRWA 4MJID 4KDTA 4MNQB 1KPRA 4K9EL 3U30C 4O4YL 5C07D 2EECA 5I1CL 2IPTH 5C3LD 3FL7A 5EU7C 1MHEA 1XF5A 5D8JH 3QDJE 4DVRL 4NJAH 1YEJH 4O58H 5IMMB 7CGTA 1FG2A 1G6RH 3RIFF 1F4XL 1AY1L 4PP1D 2Q3AA 1HCVA 3BH8A 4AIZA 3E0GA 1HQRB 4PLOB 4F8QA 3UDWC 4Q9RH 4YAQA 3C2SA 4KI5C 1QBLH 4WHCA 4NQXB 2ICEB 4DFHA 5HVGB 3HR6A 3KJ6L 5JOPE 3O9WA 3CLEH 2VLLB 4PJXE 2HTKD 4NOBA 1CXEA 4NM4H 1ZTXH 1V05A 1JWUA 3JVGC 4XCCH 3PP3H 3BRDA 5EC1B 1A6VH 2BC4B 5TGBB 1HH6A 3ULVF 2XACC 4BYHA 4NNPH 1NBVL 5IQ7L 1S7SA 2BVTA 2OTWA 2JTDA 5FO9B 4KGLA 3KWWA 1YNLL 4DKEH 4I77L 5EU6B 3O11A 2ATKB 2BSTA 3UJTH 3ZKMD 3D18A 1IAOB 4C4KO 2G60H 4GAGH 3H42H 5J9PB 1NGYB 1FV1B 4JCMA 3IFLH 4L8SB 4ENEC 4H5SB 1DCLA 1DBAL 4U7SA 2XA3A 2MQ3A 1N26A 3CCHA 4ELMA 1XIWC 2EDDA 2V9QA 4POZC 1CIDA 4PJAF 2A77H 4M6OL 4D9QE 5MP6H 4UTBH 1A4KB 5ISZB 1AQKL 2QSVA 5HHME 3TN0A 3HUJA 3L3KA 5D7IA 1FNGA 3T0EB 3AREC 1TENA 1UJ3B 4ODTL 3BUYB 4HKBA 3DGGA 2LTQB 2AAVA 3BN9D 5J3HD 5L88L 1G7HB 4GH7B 4R7DB 2FX9H 1FL5A 5LGJA 1O0VA 3RZCD 2FIRT 1P7HL 1HE7A 2HVKB 2P5EB 3I6KB 4PRDB 2ITDB 4PJFB 3BMVA 3TA3A 2VWEE 3VD7A 1IAMA 1HINH 4XCFL 2M2DA 3NVQA 3L3IA 4KI1A 1P84K 2XWBA 1IMHC 4HLZG 5JQ6L 3LPWA 4LEXL 4I2XA 4L8DB 1A9EB 3QFJB 2HN7A 4CGTA 5E56A 3C8KA 4GBXA 3KJ4B 4M43H 1RZFH 3BDYL 4TNVK 1FVEA 1FZJA 1ZHLB 1L7IL 4DKFH 5EN2A 1VEOA 4DN3H 2DQUL 2YA0A 4OZ4A 2LAAA 2Y06L 3MREB 1CK0L 4JN2B 3AROA 1Q94B 5E00B 3NZHL 5M95B 4PJXA 1RZ7H 4NQCA 3LQAC 3I6LE 2ITCB 3OKOA 9CGTA 3R8QA 1JN6A 5GS2H 1CGSL 4I3SH 4NBYB 1GCFA 3BPOC 5FB8B 1RK1B 3OKYA 1IEHA 3T0BA 5JHDA 4OZIA 1EERB 4R6UA 5DD1L 5AZ2H 3TJHC 4RZCB 1DQQB 2AABL 4EDXA 1UH3A 3MLSH 5E8PB 5JOFB 3VFRA 1JYNA 2X44D 4XNZB 4HHAA 2OR9H 3RL2B 2VERN 1B90A 4G8EB 4ONOA 1DBKL 4GRWF 4NZJA 1J0HA 1FNLA 2VLJE 5IUSA 1OCWH 3U4BL 5IJVA 4JY4A 4HLZH 4EN3D 3W0WA 3E3QC 4XBEH 1PEWA 2C4FT 4QF1A 5KANG 1HWHB 1QFWM 3P0GB 4X6CB 3BP5B 3VWJC 3IDYC 1T7XA 1P7KA 4N9GA 4POUB 4ZOCA 3ARXA 4K94L 4R4BA 1U3HC 2XXCB 4QRPE 1NH6A 4XCYB 2A74A 5IFJA 1A7PL 1G9MH 4KMLB 2DLFL 3G5VA 1FVCB 3H9HB 4UNTA 3TPUA 4S1DC 5IROA 1JGLL 4A6YL 1A7QH 3MRGB 1EHXA 4C59B 5LGHL 2YMXL 1UWXK 3BN9C 3EUUA 3M1BB 3DVGA 3UTPD 5ILTH 5E24E 3LY6A 4N9OB 2FYYA 4XWOC 1F6AB 1EO8L 1ND0B 2VR5A 4ODSL 4NBXB 1CDGA 1MHCA 1VCAA 1RIVL 4KPHL 1DQLH 3MJ6A 3DXAE 3O6FA 5I1IH 4A6YH 4X7TB 3G6AB 3R4DA 4LFHG 2GUOB 3MV8A 4XMPL 5ESAA 3KPSE 5FKAB 4MCYA 1HCFX 4DGYH 4NQED 4AZ8A 2J4WL 4M5ZH 3HE7A 4OJFL 2XKSA 4LVHC 2VLKB 2V6HA 5JXAL 4P57B 2VDNH 2C3GA 2EDFA 4NUJA 3GI8H 3IAQA 3W39B 3LPGA 5I66A 2VDOL 1ZHNB 3IGAA 2X5PA 3I6GA 3IDJA 5DSCA 3U9UB 2X4QB 5H2BB 3WS6C 5LWYL 4ISVB 4ELME 2VZOA 4WGWB 3WHE0 3CMGA 2HFEB 4WU5A 2FHBA 2OSLB 4JEGB 4HJ0D 1OLLA 3DMMA 1LO2L 1MIEH 4NKOA 2NNAA 3U7YL 2DM4A 1QPPA 3BISA 2OJEB 5HD8C 3SDXA 1J12A 1SEBB 1G7PB 4I2XB 5TE7H 3IDNA 4MD4A 3SE3C 4P2OB 4JHBA 2DYPB 2ZJSL 2H2PC 4LHQB 4U1GC 5SV3A 4V1DD 5D7IF 3HI6H 3JWOC 4ZO8A 5GGQH 2UUDK 3WD5L 4M6NH 3TJHD 3D3VD 4TTGA 4OZFG 3OKMB 2W92A 3ULUE 4XNQB 3FQNB 5ABDE 4OM0L 5HGHB 4R0LC 1QKZL 3DXAD 4WHDA 4NQDD 3CSBA 2OTUB 3PXHA 4JLRB 4YHYB 6FABL 4P57A 1PKQE 4LCIL 1QVOA 4TPRL 4O02H 2V2TB 3IXAB 2EH8L 1HHGB 3WFBH 1F2XK 4NYLB 2W0LA 4OI8A 4JJ5A 4ERSL 4Y4KB 3SJVE 1MWAL 3ARDC 4MAYC 5KS9F 5KAQG 1AXSA 1IAIM 3GMRB 3TNNA 5KTEL 2QHRL 4QLRA 4EEEA 4HJGA 4DKAA 2W0PA 3GSNB 2O5ZH 3I6LD 1INEH 4G6FD 4XC3L 2EEAA 5HHPA 3S97C 2VOTA 4NNYB 2XQBH 5IROC 2FH8A 3BVNB 5GS0D 3ARBA 2I26N 4UUJB 4MD4B 1W2KT 1IKNA 5JIKA 4G5ZL 5HYSA 4PJCB 4ONGH 1NEZB 3JV6B 4S1DD 3QCVL 1KJ2L 4K23H 5BXFA 2LAGB 4KKBC 4UOJA 4OIAA 3SGKA 4D9LL 3MNZA 5HYIA 3DX8A 4RA3A 3VRJA 4R2GB 4RAUB 4XWOD 4TN9A 3QNYA 4OFIA 2WUBH 3VD3A 1CDJA 2BVQA 3W0WB 1D5XA 4KJWD 3SKMB 5FUOL 1Z3GL 4QF1B 4Z0XB 3QULB 2EDBA 3U2SB 3BN3B 3MNWB 1YEEH 5EC1A 3VFGL 3BDXA 1MJUH 1B3JA 5IOPA 3GIVB 1OLZA 5T5NG 1B9ZA 2VRAA 4ETQA 2BRRH 1YEGH 2IADB 5IV2B 4IDJL 3TESA 5GRWA 3FHQA 4HF5H 2BVEA 1PLGL 2FIKA 2KQMA 1A3RH 3KLAB 4LHUB 4P59L 2ZG1A 3I50H 4PJCE 4F33A 2CSPA 4JO1H 2ORBH 4QYOB 2C3XA 2OMBA 3KPQA 1CFBA 1I8MA 5DK0A 1FG2B 4JHWL 3QRGH 4J8RB 4H26A 3FONB 3X17A 1CZ8L 4UOW0 4HWEH 2AK1L 2PCPB 2PKDA 3IFOB 4ZNCD 2FHCA 5CEXB 2DWDA 3T0WA 4LQFH 3RU8L 5L0QC 3CH1A 1BFVH 2Z35A 3LS4H 1RIHL 4N8CL 1HKLH 5DF0A 3KHQA 1ZGLP 4WI7A 5F7FA 2CDFB 2WINB 3IFNH 5T5FH 2CKNA 3Q5OA 4QHNB 3CFEB 1IAIH 1QLFB 2X05A 4Z18A 3G5XA 4KJPC 1LEIB 3QEUB 4OCWL 5FDWA 4RNRB 1XGUA 1A1NB 2P5WD 3GSWA 4ODXB 4JFPB 5K9JH 1DQJA 3C6LC 3S96B 3MV11 2XA8H 4ZPVB 4H88H 3HLAB 5M7QA 4IRJA 5C2BH 4ODVL 4U6XA 2XOTA 4BQ6A 1T0PB 4MAYD 4NO3B 3TA3B 4LL9A 2BRQA 1G6RL 3S7GA 3KXFE 4OCNC 2X6MA 4NWTL 2IMNA 2BHUA 1YQVL 2PETA 2E7BA 2RHEA 1GC1C 5GS0C 1KTLB 1FORH 4WENB 1HHGA 1INEL 1BEYH 3MRRA 4XC3H 2C5DC 2V2TA 3H7LA 4J6RL 4J23A 4JQIH 5KTEH 5D9SB 1T03H 4UZGA 1NMAL 1AH1A 1MUJB 5DT1H 3NCCB 4HS6B 4J3WA 1A4KA 5C0GB 1H8NA 4FQQB 1U8JA 3MJ8A 3QO0B 2VL4A 3RHWK 1R24B 3HG1D 4H25B 4WEBH 3RWFB 1U3ZA 3KYMB 2NPLX 4MVBC 4JO2L 4XPTL 3RGVC 3IJYA 2OZ4H 1RULH 5DRZA 3IB4A 3FB8B 3ULSB 3ARRA 2XWBB 4WNQA 3HC0A 4L1HA 2Q6WA 3ZTNH 5ID0B 5L8KB 3MRNA 4OI7A 4OZGE 3EJZD 2XPGB 3V0AC 4WCYL 5K9OB 3QDJB 2QLVB 1J05A 4DZ8B 1HXMB 2ZKHL 5J11C 3QDGA 3BP7B 5DRNB 5CJQH 5BO1L 5K93A 4C56B 1NANI 4M9PA 2EYTA 2PW1B 4WO4B 3SDAC 2BX5A 3CNKA 1YDPA 5T1MA 1OSPL 2P24A 1DUZB 4LSVH 3D39B 2HLAB 4I0PB 3MROA 1CIUA 4CU7A 3OJMB 2R9HD 3HUJB 3L3KB 5C0JB 4HIIB 4YNYB 1UACH 4P2RB 1OQOA 5C6TL 3KPMA 2O5XH 1ITCA 2CK0L 4OZHB 5KZCD 1IZJA 3UTSD 1AJ7L 3ZKNC 4WVRA 3IU4L 3SBWA 4G7VL 2NXYD 5KVEH 2GFBA 2A9ML 1ZVYA 5HGBB 4O2EB 1I3RA 1N64L 2VDQH 5BV7H 3QIUB 1YNTB 1CLYH 4P9ML 3S36H 2J8HA 5KVDH 2D4DA 5GISH 3ORJA 5DJZA 3ULUH 1RUPL 2Y4SA 3EYUH 4GKZB 1R5WB 4KV5E 3PQYD 5IEKB 2FGWH 3I3BA 4I3RL 1A3LL 4YUEL 2DLFH 3PGCB 4JVUA 2P44B 3AS0A 4P99A 3RHWF 4FS0A 3ARWA 3QWOB 3WE6A 1FL6A 1ETZB 3MLXL 3C60B 4RMUA 4NCC2 5HGDB 3WL9A 3E1F1 3LVEA 3S96A 4PJXF 1X6NA 5GHWL 3VCLB 3R06A 4Z7NF 2JELH 1XF4B 2GK0B 2VKXA 4TULH 1MI5D 3ZSTA 5JR1H 4EOWL 1EAPB 1GOHA 3C9NA 2OYPA 4RMSA 3OAUH 3CFEA 4Y4FC 2EXWD 5D2NB 3RY6A 3O3EB 3G9AB 1N0XH 3IETB 5B3NA 1G84A 3CMOL 5HHNB 5IVXF 2DLHA 4HPYL 1QA9A 2QQLH 3DV6A 5C9JB 1DN0A 4PJIF 4TNVF 3Q6FB 1ZT7B 4V2CB 3RGVD 3CVHA 1E6JH 5DHXB 1MEXH 4XPFL 2ICWB 5IHUH 4OZGA 3P4NA 5DJ6B 2V17H 4Z6AT 1U8KA 2YZ8A 5CP7B 2GCYA 3BAEH 3D5OF 4RGMB 3B4NA 1AE6L 3AREB 3MV7A 1JNHA 5FO7B 4XP4L 2FBJH 3EJZC 3RGVA 1F4WH 1FVDB 5F6HJ 1CE6A 4LPYA 1JPFA 1MJJB 4LRNL 4NQVA 4WJ5B 4Y16A 1W72L 2XWJB 4I0PA 3SGKC 1NCDH 4FQCH 1HILB 4RFNB 3IFNL 5T5FL 4JM2B 2VH5H 1YN7A 4MCZA 5KW9L 4UAOB 1UT9A 3E2HB 3W81A 5DD0H 4EDWH 1P7QA 1S7SB 4M5YH 3MSPA 5DDHB 4G80A 1W0YT 2CRIA 1T3FB 1WCBB 5F89B 1LE5A 3BX7C 4K8RC 4R90H 2WLZA 5HBBA 4QCIB 4JHAL 1TCRB 2AK4D 2BP3A 3VD5A 2NXYC 4HX1A 3BKJH 1JNLH 4P3DA 1VPOL 5J6GA 3FMGL 5DZLA 1D5IH 1FO0A 3ARDA 2DI8A 3FRUB 3RX5A 1UB5A 2YBRB 4ZNEA 3IDXH 1AI1L 4YXLH 1A3RL 3QIWB 4AIZB 1CL7L 3TT1L 1XZ0B 5C0FA 1XCTA 1CI5A 1XF1A 3TIEB 1AFVL 4MNQD 4X9FA 2G2RA 1LILA 3U9PH 5DVMA 1ZGLB 4NN6B 4YDVA 5T1KB 3MCKB 5J7CC 4FQ1L 1KCVL 1I9RL 5HVWA 1NFDB 3O2DA 5J9PA 1I7RA 5KG9A 5IB1A 1RU9H 4LLVA 1JJUA 2ZCHL 5L6YH 1NGQH 1NCWL 5E9DD 5I15L 3X13B 4WV1C 4I5BA 4Y5YB 3BGAA 4MDJB 4LIQL 2IG2H 3E2HC 1B0RB 1U8OA 3HC4H 4HK3N 2PO6B 1KB9K 5GRVL 3AY4C 1T4KB 3OKMA 4LSTL 4QHLB 5DK2A 4NRYB 2DQEH 4E5XB 2OI9C 3W5MA 3BPLC 3W2DL 4Y2DD 5GRXG 3VXUA 1BM3H 4LCCB 3GO1H 3F58H 3HAEG 1E27A 5I0DA 3MV8E 5IMOA 2A2QT 5SWZE 3DRQB 1JYXA 5ICYB 3SE9L 1W0WA 1VFBB 4ERSH 3BKYL 4KK9C 4MQXC 5D7JA 3OF6A 4QOKB 1EEYA 1H8SA 5MHSD 2IPUG 4OLZL 1QTYT 1NGWB 4X8JA 1F02I 2FBJL 4I4WB 3FONA 2Z4QB 1QSFD 4PRIA 4MJ6A 2YS4A 3D25B 2FATL 2P8MB 2IQ9H 1ZSDA 3OR7B 1F13A 4OTXL 4WO4D 5E8DH 1E6JL 3F5WA 3MBXH 3V4UH 2GY5A 2YRPA 4M03A 5E2UH 4GXVL 1A6AB 4XNMA 2F5BL 5ICXA 4E42A 5B8CC 4KV5F 1Q0YL 4WWKC 2JB5L 2XY1A 4JQXC 3TO4D 3RUGB 1CFNA 5GHWH 4Q9BA 3MYJA 3QNXA 1OTSC 4JDVB 4FTVA 2DDQL 1JGEB 5MEPA 1S9VA 1VGEH 2DQCH 1FN4A 1IKNC 5LXGL 5K9QI 3DV4B 2Z8SA 1RK0A 1RUAL 3KPOA 4IJ3B 4O2FA 1WBZB 3ILQD 1GOFA 5TFSL 1ZLWK 4GW5A 1T5XB 4P5MB 3HRZA 4JKPH 2BVPB 4LHJB 1Q1JH 1A5FL 5D1ZA 3S37L 3L9RA 1IGIH 4Y16D 3F7QA 5EORH 1GGIH 4Q9QH 4AT6A 1I75A 4UV7H 1MLBA 4CN4A 1C1EH 5KVFH 4E41B 3IRZA 3D69B 2A9MH 3QFJE 5IMKB 1FYTE 5L7XL 4F7MA 5I1DA 3WJJA 5SWSD 4BK4A 1J8HD 2DF3A 3PE9A 1KXVC 3UTZB 2HRLA 5EBGA 1QLEL 4U6VH 4QOKA 3O6LH 4S2SB 4MAYA 1DANT 5EWIH 3QEQE 5EOCL 3ZE2F 4Y2DB 4YHNB 3SCMD 3MGTB 3M07A 1XCQA 4WWKA 1T1WB 1X5JA 3RWIB 2XN9E 1IC7H 4WGVB 2K1MA 1YEHL 3C09B 1RZJL 3MC0A 5FYLH 1U36A 1C08B 3SEPA 4CMHC 2YXMA 1LD9A 1A5FH 5D1ZC 1X5AA 3I02A 4P2OA 4EI5C 1SEBA 1FFNB 4GG8B 4YC2C 4GG6A 1FIGL 1F8TH 5GS0H 1S7TA 2OR9L 4U1IB 2A6DA 4PJHE 3VFMA 2UV3A 3V0VA 1KEML 2R2EB 1X5KA 1D6EB 2ITDA 3TYGL 4LPCA 4HKZA 3T0ED 1RULL 2H1PL 3TNMB 3SY0B 3HC3L 2VUOA 4X5XB 5FUCC 3FHAA 3I6GB 5SX4H 5DVKA 5ELIA 1K8IB 1T20B 3I2CL 3IDGA 5LQBH 1OY3B 5DMIL 1IGTA 4NRXA 1E4XL 1JHLH 2XIDA 3DTXB 4WV1A 4X7CC 3IJSA 5I73C 4LSPH 2CRYA 5EUKA 3IJHB 5HGHA 3WN5A 1GGCH 3CFBA 4QHMA 4X6DE 3OGCA 3BW9B 1IL1B 3UTTB 2E8YA 4M43L 5EBMB 1DZBA 4WI2A 3FB5A 3FFCB 3GSNH 4BSVB 1PKQB 1UYWL 5EUOF 2I60H 4BQ9A 2FO4B 3QFJD 1TDQA 2BVOA 1QHOA 2FATH 3O2VL 1NDMB 5FHAL 2ADGA 4H5SA 4NKDA 3OKLA 4RWHA 1BBDL 5T5NF 3NIFE 4FQJH 4O5LH 3CDCA 5MENA 2VC2H 4H88L 3DV6B 1KJVA 1PSKH 2PTVA 2BOCB 2B4CC 2HJLB 2R4RH 4HUKB 3FT2B 1N6UA 4DOHE 1YYLL 2P5ED 4Y16C 5IT2H 3Q1SH 5L88H 2VZUA 1NFIA 5HI3C 1IRAY 3O6ML 3KLHC 4L29A 1ZVSA 4YX2L 5DJ0A 3RY4A 1TJIH 2NLJA 4UIMB 4EN3B 1XGRA 4P49A 3ZT7A 3OZ9L 4BK5A 1NBYA 3BIKA 1N5AA 2WMPA 2VISA 1MJ8L 2ADIB 4GKNB 4BUHA 1KJ3L 4FNLH 4OCYL 1RJCA 1MQ8A 5F6HI 3RWDA 4P0DA 2R69H 4GRMA 3RGVB 4XMLH 3RDTA 4LSDA 3SCMC 4OBSA 3GMQB 1XGYH 2FLBT 1A0QL 4JO1L 1NDGA 2CJUH 4MJ2A 4QT5B 4LLAA 4NC1C 3DUSB 4YGAB 3H42L 1KEGL 5DA0B 1RK1A 1K2DA 4QRRE 1URLA 2NY4B 4HF5L 5DS8B 4AMKL 4XRCB 3EW3B 3VFNB 2ADJB 3O2WL 4YQXH 3WXVL 1PY4A 2ITCA 1YMHB 4FQIH 3STLA 5K9KA 1L4IA 4YFLI 4ODUA 4N0YL 4AIXA 1U8HA 3VFOB 5IB3A 1QFHA 3ILPA 3M17B 1LK3H 4P23A 1EHNA 4KY1H 1H8OA 2H3NB 2ZUSA 3QB7C 3RIFK 3OJDA 4M4RA 1S9XB 4XCNA 5EIIB 4UILL 2MWCA 5IT2L 2Q7YA 4D9LH 3ZYZA 5DD5H 2ESVB 3FO1A 1ZLWH 4EN3A 1ZE3C 5A40E 3QQ4B 2HRPH 4N5EC 2ZNWA 4XVJH 4U1LA 2DI9A 4LOUD 4R7NB 4AG4H 4OZGF 1J1PH 3ZZ1A 1AY1H 1ADQA 4HXAL 3ZL4H 4OKVA 4PJIA 4QOKE 4R90L 4OCMC 3SBWC 4C55A 4DVRH 3RI5K 1N4XH 4DGVL 3R1GL 2QBWA 1CE1L 4KAQH 1CD1B 1N8ZB 5DQ9A 1EJOL 5DTFB 4ODBD 4H20H 1FCCA 4L3EE 3P4MB 3EOAA 1Q8MA 3WNKA 2A1WH 4XPAH 3FFCD 3VXPA 3WFDL 3T3PF 1NCDL 2P45B 4G8GB 1NC2B 4LEOB 4GXUM 2EH8H 4Q6IA 3X3FL 4Y0GA 4HGWA 1NLDL 4JGJA 4HK0A 4TVPL 4JRYE 5LQBL 5C09B 5DMKA 2ICES 3KLHD 4PY8J 2XICA 1IFHL 3BFOA 5HHOE 3UC0H 4MYWB 3KYKH 4LLYA 4Z78A 1IEAA 4JB9H 1WK0A 1QFUL 4P4RA 3JBG7 1G0XA 3CK0H 3QI9B 5LG1A 4DZ8A 3SY0A 3HZKB 4Z5RA 4XT1C 2YUVA 5D2LE 3U7AA 1L0YA 3MV7E 1K8IA 1T20A 3CUPB 1NFIB 1DUYB 4X6DA 2IALB 3D87B 5DJAA 4K8RL 1U8LB 3U0TA 1G6RA 1Q9LB 4HFUL 5F9OH 2JK5B 4PJFE 5IM7B 2VR4A 5CD5C 3T0DA 4JFYA 3WFZA 3AC0A 5C08A 5D7IB 2E9WA 2VXTH 4U6VL 1YC8A 2VDNL 4X7DC 4DUWA 1J0ZA 2L0DA 4HGWB 3WCYA 1JTPA 2YPLD 3N50A 4RMWA 5D93C 5LCVH 4AH2B 3TFKC 1U8HB 1YN6B 4TQEH 1QYGH 3C5SB 5I1HH 1L0XA 2Q1EA 4Q6IB 3CFJA 4L4TD 5HHVL 4M62H 3ULUL 1HSAA 1R0AH 1EO8H 5C0CB 5KVDL 5EORL 1AR1C 4OCLC 1U2HA 1Q9KB 1A7NH 1ZS8B 4LNVA 4I18C 5LGKA 4JG1L 1NC4B 4JFDE 4NN5C 4N5ED 5EZLA 5IQ9A 4R3SB 3D0LB 2JB6A 3U6RB 2DD8L 1XMWA 2W65A 4MMXC 4PLNC 3PWJB 4OLYH 1AJ7H 1HH6B 3T4AA 2FL5B 4RSVA 4KC3B 5FA3A 5I75C 3T0XA 1JIBA 2AJUH 2ZZUT 3NCEB 3VXUD 5F7UA 5FK9A 1NCUA 3CX2A 1Q9OB 4KDTC 1HIMH 4DFIA 3O9WB 4O2FB 3MRHB 3QXUA 2VXVL 3CD4A 4P23B 3P3YA 3VGHA 1BQHG 3DHJA 5JMOC 3HB3C 3SKOA 4PLJC 3T3ME 1S9VB 2DBLH 2MCPH 3KPPA 5FDYA 4Z7VB 4GKZA 4OD3H 5SV4A 2R1YA 1ZGLM 4E41E 1T0NB 4HGKC 5DUPL 2FB4H 1GZQB 5E2UL 2UWEA 3W9DA 4JM2F 4JFZL 5C0CA 4YK4C 1UC6A 2YPLA 1F90H 3GSRA 1LE9B 1OPGH 4JRYD 3MLTB 3HNVL 3S35H 3UTZA 1EXUA 3TN0D 1T66D 5GRUH 3PHQA 2BHZA 5EULV 3TC9A 2FIKB 2UZIL 1LNUB 4X5WA 3LS5H 4PR5A 4WI9A 4U1KB 5E5MB 2VTFA 2KL6A 3E8UH 4PV9A 1KTRL 1OW0C 1SVZA 1ZK9A 2VIRA 4PLKC 3B6SA 2MPAH 3RFZC 2Z92A 1MQKL 3UPRA 4F7TB 4KZEH 1IQDA 1R3IL 2P42B 4YHKH 5IM7A 3F12B 1S7QB 4UI2A 3VXRB 2NXYB 3O6KL 3RVTD 3VXME 1DDHA 2FJGB 1MFCH 1T0MB 1QSEE 1S78C 3WFDH 3L95A 4JQIL 1P1ZB 2IAMB 3BQUA 1C7TA 4JY6B 4JKWA 4NKIH 1U95B 4MS8D 1RZFL 3BDYH 1ZAGA 3NPSB 2N56A 2QQNH 5I19L 1IGCL 1I3UA 3MJ9A 1AXTL 5DK3A 1ZA6B 1QPXA 4OLVH 5GSRB 5IESL 5A1AA 3K4ZA 1C12B 3W2DH 1PX3A 1MCSA 1E4WL 3VXMB 1OVZA 4NFCA 4XH2B 1T2QL 3MQIA 3QWRD 4LLWA 5F7EL 4PGCB 4WW1A 3LN5A 5HYSB 1RPQA 5IB4A 3LEYH 4YGVB 1T1YA 1HHHB 1FDLH 4V2BA 4XVJL 4YBQC 5K9JL 2YWYA 3VXOA 4QHUA 4CN1A 3VFTB 4MJ4A 5C8JB 1KG0A 3BEVB 5IWLC 2K7QA 2WQRA 2W07A 1BVLA 3ARFB 3L3GA 1IE5A 2R23A 3MO1A 4L5FH 4ZS6C 2ED9A 3CFBB 1DBML 1WZ1L 5FGBA 1DP0A 1P6AB 1LK3L 2WP3O 4J3TA 4QRRD 1VENA 2FX7L 1T89C 4XBGB 2ICWJ 2WWMC 3N1FC 3JV5A 2VLMD 1A9BB 1CLCA 4UDUA 5FHBL 2EO1A 1MFAL 5KG9B 3AB0C 3PHOB 3NOIA 3RP1A 5JW4Q 3D48R 4LQ1A 1EV2E 4I5BB 3T4YB 4Z77B 1F4AA 5FCUH 4D0CA 3PNWB 2G5BA 3V7AE 4QRUA 4KHTH 3ZE0E 2VXSL 2ORBL 4NO3A 3HB3D 3H9ZA 4PLJD 4RBPK 3RWEA 3GJFK 2JLLA 1A6TA 1MAJA 4UT9H 5DGRA 4OGXL 1XF3B 2EE9A 5HTSA 2GJ6A 2OXHA 3T09A 4FNLL 4OCYH 2JF1A 3DVIA 2X9XA 2DM2A 4PGCA 4WW1B 3SE3A 1EGJL 1YEEL 3RWJB 4CU8A 3GB7B 1T66C 3DRTB 3BPCA 4IRJC 3T8XB 1MH5A 4GW1A 2AW2A 1QSED 4XRCA 4FQ2H 3VFNA 4LSSH 4HUVA 4QCIA 2F5AL 1G7QB 3HMWH 3GJEA 4U1SA 4ZUTA 4IRZL 4RGNE 3DUSA 1F6FB 3RVTC 1BBDH 4JN1H 3MOBH 4NO0A 4ONGL 1G0DA 4XWGH 4X4MA 25C8H 2WBJC 1A6AA 4S1RH 1HEZB 1UCBL 3MV9B 3TYFA 1CN4A 1Z5LB 1N3NA 5DJ2B 4CVXA 2P7TB 1T7WA 5JW3L 4AEIH 3QIBC 2F54D 5C0IB 4J12A 1A7BA 2IH3B 2B4CL 5MEOA 5E2JA 5E7BA 5MEND 4WDIA 4YBQD 3SKMA 1ADQH 2B1AL 5F6IC 5DMIH 3I85A 1E4XH 1JHLL 4P4KC 3HNTH 3KPOB 1OHQA 4YPJA 5ALCH 3P4MA 3SOBL 1EEYB 3FFDA 3TGXA 4MSWB 3CFDB 1ERNA 1P4LB 5FF6B 4PJ7A 5IFHL 5MEQA 2V2XB 2BERA 1I8IB 1LEGA 4BSWA 1NEZA 2DI7A 4E9LA 4L8BA 2RR3A 4Q0XL 4OM1L 4ZTOL 4CJ0A 3BH9B 4MDIB 1KNOA 3N85L 4TUKL 4JGUA 5I1AA 1GSMA 1SYSB 3KLDA 3ULVH 5HGGS 1FL6B 5CUSL 5GISL 2V2WB 1AQDA 3EYSH 3S36L 1G7MA 3QJHA 3ROOB 1CXKA 4B53A 2VDQL 5BV7L 3SE8H 4M6AA 3OX8A 5F9WC 3C8DA 4U3CA 1JPTH 3G5YB 4PBXA 4O00A 5HYEA 1TQBB 2WM0A 4HBCL 4Y1AA 1FYTD 5HI4D 3N06B 2CGRH 3QO1A 5I18H 4JO3L 4JGMA 1PYWA 1J1XL 4O2EA 4PJAE 3I3DA 5B39G 3U36A 3CU7A 2Y07H 3RBGA 1EZVY 3C5JB 2X70B 1G7QA 4I9WE 5CJOH 3MLPA 1OAKH 1BQLH 4I0KA 3VRIB 4IRJD 1YEIH 5ISZA 3NH7H 5F96H 5D72H 1S7TB 1MCJA 2WIIB 2DYPA 5CEYA 3OB0K 3GUTA 3SDDB 1T04B 4R26L 1T1XB 3I02B 1XFPA 3ULVL 1G9NC 4R0LA 1BF2A 1P5UA 3ULUD 3RPIA 2CIKB 3L3IB 1YEDA 1NGYA 5E2WL 3WLWC 2EDNA 3V5DA 3FCTB 2AXGB 2WBJD 3IDUA 1G9ML 2CO6B 4P2QD 4QRPB 3DO7B 1KJ2B 2IGFL 1DUYA 1FAIH 4QEGA 5FV1L 5D6DA 4PJ8C 5CP3A 4P46B 3L3JB 1OP5K 2P5WE 1X5ZA 1CU4H 4X6CE 2Q8AH 2NTFB 3OMZA 1FNEB 3P0YH 1MHHB 2R2BA 2DKUA 4I3GA 3AGVA 1P7QB 3PWUB 5EZLB 3MRLB 4JG0H 2PXYD 1NLBH 3GSQB 2AEPL 3QDHA 1MVUA 1AHWB 5HDQH 1A7OH 1Q72L 2DTSA 1TZGL 1T03L 4HCRH 1RZKL 1KN2L 1MFEH 5F1NB 2FZ3A 3KPSB 4OLXH 2R0ZH 4GLRI 3UJJH 5KJRL 4YHPA 4BSVA 2FECL 1YECL 2X4RB 4HUWB 4NIKB 5GS1C 3O4OC 1Q9WA 4HK0B 4WUUA 1QFPA 3LN9A 3ZHDA 1KT2A 3MRRB 1T2XA 2HFTA 2EDHA 2P1YA 5A2FA 1PG7W 4NZRL 4S1QL 5C0NC 2NCMA 2NY0B 2R2BB 1TTGA 4FG6C 1LEKB 2NZIA 4OCWH 2NXZB 4K3JH 3S36X 3MV01 1KCUL 1IEBA 3BT2H 4UT7L 4OLUH 3BKYH 3HLAA 5FHBH 5HHXH 4CMMA 2X4SB 5HI4C 4U6XB 4X7SH 4OB5H 1U8PA 2YUWA 1OOAA 3LRHA 3Q6GH 3DX6B 5JUEH 3RIAK 4D0BA 3RL2A 2Y6SD 2R8SL 4GJTB 3SDCD 2NQCA 3F12A 5DLML 4LHUG 3TBYB 3GUTB 4EI6B 1VB9A 3VW3L 5CWSB 1NJ9B 1QLRB 2V5TA 3KPRA 3FB6A 4LARH 4MAUL 15C8L 1CTNA 1FRGH 1TZIA 5F7YC 2NY3C 1OARH 2GEEA 1U8JB 4LIQH 3VXQA 1NSNL 3PHQB 5FCUL 1PYWB 5E6IB 1R3LB 4UB0H 5I1JL 3SDDD 2CKBA 3ECBB 3HNSH 5I2IA 4WI6A 3QFDA 2UWEF 4ORZC 2EE2A 1VA9A 4Z7WB 4UT9L 3WEXA 1XR8B 5T33L 3QUYD 5D1XB 3L5IA 3RX7A 1TFHA 1FJ1A 3GI9L 1YNKL 5CSBA 4PTUB 1JRHL 5I1AB 5KBNC 2QV2A 1QG3A 2PXYC 1LP9F 1CQYA 3TV3H 2W1NA 1S8DB 2IMMA 3FRPA 4RFNC 4KUZL 5E8EA 4XBPB 1JNLL 5CJXA 1ETZA 4OCXL 3JTSB 1CFQB 5HPMA 5SWQB 5DJZB 1D5ZB 5T3XE 1AR2A 4NQEA 4OB5L 2EDRA 1VFMA 4TUOA 5I1EL 2NW2B 4RFOH 3DX8B 5F1SA 1WC7B 2NY7H 2VDPL 1FCGA 1GGTA 3THMH 3QI9C 1VFUA 2OL3L 5JPMB 5GGTH 3DUUA 3PV6A 1I3RB 2FR4B 1TVHA 1PZ5A 5IEHB 4NGHH 3OL2A 4TPRH 5C0AA 1QBLL 6FABH 4S1SL 4HWZA 4FFYH 5ESVB 4CADA 1KTDA 2VLRB 2JJUA 3VFPB 1BFOA 4PJ5B 4HJGB 4JRYA 4OF0A 3NBNA 3OHXA 3MBEC 1A1OA 1D9KD 5EU6A 1T1ZA 2HVJB 4XXCC 2Z8RA 2R0ZL 1PG7X 3UTPE 5D71H 4D8PB 5TE7L 2PYFB 3MRDA 4RGOL 5IJKC 3A67L 1SMOA 2DBJA 5CJ8A 3PWVA 1LDPL 3VRJB 3VA6A 8CGTA 5DGQA 4HC1L 3GB7A 2J6EA 4HDIA 4PJBE 3TWCH 5E2TL 2C7UA 2FGZA 2QTEA 4YPGA 1JPFB 1S9YB 3GSOA 4TOYH 3G04A 5K33A 4DCQB 1NMBL 3ZDYF 4LLYB 4Y19B 1DVFA 1FPTH 1OT1A 5AYUL 1WCQA 2DQTL 4PD4J 4Q97A 3QEQB 1T89A 3QA3A 4U1JA 4U33A 2JIXB 4QXGL 4QKXB 3KPLB 2H6PA 1KCSL 1KLGB 3NPSC 3EYVB 4ZD3H 5JA9A 2D03H 3MRCA 4PJHF 4MJIA 3JV4B 1EPFA 5JOPD 1VKXB 5B38G 3PNWA 1H0DA 1CVSC 3O3AB 1KLUA 1U8OB 1X5FA 1F58H 4JG1H 5J12B 4KI5D 1DN0B 3CDGB 2YRZA 5ANMA 1ITBB 1XGQA 1UH2A 3L5HA 5CLTA 2HYMA 3KPNB 2YKLL 3K74B 4ZFGH 5H37G 3FQRB 3CK0L 5C0DB 1YEIL 3NCYP 4MA3B 1F2QA 3QDJD 1Z6JT 3TNMA 1RZGB 4AL8H 3OKNB 4TVPD 1J9CT 2DQIH 4WTZG 4QRQB 4C83A 4HMCA 3QEUA 3BYTA 5I18L 4HIEA 2YPVH 3LKOB 4ZPVA 2VWEC 2EKSB 3GDBA 4G7YH 5JORB 3VWKD 1KUMA 1QRKA 4S0SD 5CIPB 4TNWK 5DA4A 3QI9D 1UQSA 1QFWI 3AB0B 5FDWB 3UO1H 4C57C 4CBPA 4WY7L 4J2XA 3T77A 4BSWB 5DUBA 1UWXH 1FO0B 2XT1B 3ARDB 5JNYB 2FH6A 4K8RH 3G5VB 4W4NA 2Z8VC 5D7SH 4Y5XC 4YDKH 1JYVA 4OAWB 5B4MD 3EZ8A 4DVBA 1C5CL 5A16A 1XIWD 2NY7L 5HVFB 4U0RC 4OZIE 3ARTA 4WW2C 1CVRA 2VDLL 4XBPA 5I1GL 4AYFA 1JHKL 4IIQB 5EU6E 3VGAB 5HVHC 5CEXA 3NFNA 3INUH 3GRWH 5CBAA 4XC1H 5D7LA 3MCG1 4M8QA 3MBED 3TLRA 3W9EA 5IW6B 4J8RA 2FJFA 1VERA 2AK4B 2IANA 4P9HC 3V6ZB 3QHFL 3ZKQD 4AG4L 4JO2H 1RJYB 1CGWA 1UXWB 4PFEA 5H37H 5IK3A 3M45A 1UENA 2MHAB 4WHYG 1QSFE 1ZLVH 2OQJB 3P0VL 5ERWB 5E5MA 1UWGH 3KPSD 2PXYA 5KAQF 3HCVA 4OIIH 1OB1B 1BREA 2VLRA 4YHOL 5DVOA 4KTDH 4NYLA 5JLZA 3BKMH 1SVCP 2B4CH 4BA8A 4KY1L 5HHMD 4IHOA 1CG9A 4PGBA 5I74C 4CU6A 1YMME 4H20L 3OJVC 4CVZA 1IM9B 3X11B 2APXA 4YFEA 2F58L 4G6JH 4YXKL 5DJXA 1EVUA 3EYOB 4NWTH 2P8LB 3ZL4L 1FFPB 2VN4A 3FT2A 1RUQH 3CLFL 4XVUD 5B22A 2NTSP 5C2BL 2QHLA 3O45B 3QIBB 4OD2A 3ARBB 1CQKA 2N1KA 2F19L 2X89A 3IFPA 3MCLL 2J1KA 1LO0L 4F7CB 5KSBE 2HLFD 2Y36L 5IVZA 4JM4L 4HDIB 2DLGA 1QBAA 3GMNB 4ISVA 4HIEB 4XI5D 3RWGA 4XX1E 4XPHL 5HHPB 5JO5A 2VN7A 4IJ3C 3BD4A 3OKNA 2BZDA 3WUZA 3HPLA 3OWEA 3BMWA 4HWEL 5BV7C 1DL7L 3VWKC 1KT2B 2QR0A 1D5MB 2A6JB 4LGRB 2JE8A 3KPRD 2O61A 1NCAH 2WP3T 5H94B 4EN3C 3FO0L 2J7LA 1D3CA 4UNUA 3FQNA 1WEJH 1C5DB 3HTLX 1KIQA 4JREC 3VI4E 2R23B 4OI9A 1KCLA 2GT9B 4H1LB 3ME0A 5F9WB 2OR8A 4DKEL 2I9TB 5C0BE 2ADFL 3H9SA 1DVFB 3MOAH 1U3HD 2NY0D 2BDNH 4OT1L 5ADOH 5E08L 3TBVA 3H9SD 1MFEL 2DN7A 4P2QA 2CLRA 1LO4H 1F00I 4JFYB 4ALAL 3D9AL 4L8SA 1Z3GH 4TUOB 4UINH 1DBMH 1WZ1H 2JIXD 1T5WA 3CVIL 2OTWB 2X4SA 1IILE 3WO4B 2NW3A 1LO0H 4C56A 2AEQH 4JHZA 2H32B 2E7LC 1YYLH 4OQTA 4LF3B 5JQHC 1IM9A 3HE6A 1M6OA 1SMAA 1I1FA 3EDEA 3SGDI 2ATPB 4XGZB 3QHFH 4WUUD 3L6FB 2R2CA 5JLZB 4LHUA 3MLRL 5IBUB 4JFOA 3KLAA 4NUGL 4PY7B 1GHFH 4LLQB