2JKFA

Plasmodium falciparum profilin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
170
structure length
170
Chain Sequence
YSWDSYLNDRLLATNQVSGAGLASEEDGVVYACVAQGEESDPNFDKWSLFYKEDYDIEVEDENGTKTTKTINEGQTILVVFNEGYAPDGVWLGGTKYQFINIERDLEFEGYNFDVATCAKLKGGLHLVKVPGGNILVVLYDEEKEQDRGNSKIAALTFAKELAESSQLQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN
publication title Structural Basis for Parasite-Specific Functions of the Divergent Profilin of Plasmodium Falciparum
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Protein binding
total genus 41
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2jkfA00
1VETB 3CPTB 1VETA 3T1XA 1VEUA 4FTXA 1PRQA 3NULA 5EM0A 3T1RA 3DAVA 3T1QB 2VK3A 2ZL1B 2PRFA 2PBDP 3L7HA 2E8JA 1YPRA 1Y4OA 5FDSA 3NECA 3CPTA 3MSHA 3CHWP 3UB5P 2JKFA 1FIKA 1ACFA 2ACGA 1SZVA 1CQAA 4X25A 2B95A 3T1SA 1PFLA 2ZL1A 1CJFA 2JKGA 5EM1A 3D9YA 1D1JA 5FEGA 4D60A 3LEQA 1Z09A 1K0KA 5EV0A 4ESPA 3T12B 3U4LP 1A0KA 2V8FA 2BTFP 4QWOA 1HLUP 1J3WA 2V8CA 3MS6A 2HZ5A 3KYEA 1VEUB 4X1LA 1G5UA 4FUWA 5FEFA 1SKOB 1FILA 1SKOA 4X1MA 1F2KA 2PAVP 3L9KA 1CF0A 3LGOA 1AWIA 5EVEA 1PNEA
chains in the Genus database with same CATH superfamily
2Z6CA 5GLDA 4NG2A 3ZGAB 2ZM0A 2WGWB 4WYYA 1YLWA 2ZQCA 1T1BA 4KZAA 3FC7A 2VGKA 3OPHA 3H7WB 2XFSA 1GCEA 4YNRA 1XPBA 1K57C 4I3JA 1PWCA 3EOIA 3L7HA 5HWWA 2Y2MA 4DF6A 5HW3A 4MBHA 3LIEA 1UWPX 3F1PA 2Y2NA 2W1RA 2JKTI 2ACGA 3WS0A 4WEJA 3HLEA 1ZTUA 4X25A 4S2JA 4ARZA 3V3SA 4FOFA 4JF5A 1E25A 4IUHA 5KZHA 2XK1A 2VEAA 3A3JA 4CLCE 5GHZA 3NOUC 4N92A 1IELA 4JXSA 3B42A 2V20A 4O01A 3TW8A 3OOVA 1E3UD 2XQZA 1YSPA 4HHDA 1K4FA 5FL3A 1NYMA 1JWPA 2B02A 3BFEA 4QB8A 3CWFA 5FQMA 5EOEA 1W5DA 3UMEA 1ALQA 4GNUA 1XKZA 2JE5A 4OOLA 2W3DA 1FR6A 1BLSA 4OQHA 2LB5A 2INWA 4X1MA 4K91A 4YWZA 1OTEA 3AGEA 5I5LA 4GN2A 4JF6A 3MZEA 4H8RA 3W8KA 4DDSA 4JF4A 4N9KA 5EVIA 3MJQA 4BLMA 1L0FA 1GHPA 3R7WB 3CI6A 3EQUA 4WEKA 4UA6A 2K2NA 4EESA 4ZJ1A 3BECA 1K25A 4HIAA 2W3HA 4Y17A 4R4RA 3UPPA 3NBLA 1TS8A 4PKYG 2Y2QA 2VZWA 4GZBA 2HJ9C 3N8RA 4DE2A 5J4EA 3MQ0A 3IX8A 5IHVA 1IYOA 1ERMA 3CMZA 1NLYA 3BJNA 3HLGA 1K6RA 5AQ9A 2QHKA 4QD4A 3PXPA 3CZDA 4D60A 4HJ4A 5HARA 3TRCA 3FPWA 3ZG5A 5F1FA 4P6ZS 4LCLA 1Z09A 4JLFA 4GHIA 2Q9MA 4S2OA 3SS5A 2QPNA 1MKMA 3S7PA 4CLCB 4CQHA 1L0DA 3VE4A 3LY4A 1LI0A 2HV1A 2Y2LA 4MBFA 1KGEA 1OTBA 3BLMA 1OPXA 1KDWA 2M1CA 4IHQA 4OVDA 1FSYA 4DE3A 4S2MA 3P7NA 5I94A 3OCLA 5FATA 2KDKA 4X56A 3HUMA 3E4QA 1S66L 4JBFA 1IFQA 1SDNA 4IJGA 4QPRA 1Y28A 3CPTB 2KLIA 5GLBA 2Y2JA 3BW6A 4L9EA 2CMNA 3V67A 5J3WA 1XXMA 2P9VA 3S1YA 4MBKA 2WZZA 2XROA 1NZOA 2ZL1B 5C5KA 3ZYTA 1T18A 3UPNA 4OP8A 4B88A 4WL9A 1DJAA 5FQKA 5HAPA 5DF7A 3MFXA 4GKUA 5FDSA 2ZOIA 2QYBA 4OKPA 1TDGA 4LLOB 5G4YA 3EGXC 1TEMA 5EECA 3N8LA 4NKPA 5L09A 4U3TA 1G28A 5FEGA 1ES4A 4YFMA 1IKGA 4X55A 1JWZA 3MXRA 1KVLA 3AGFA 1K0KA 2VGJA 5E2HA 2HDQA 3C38A 2W1TB 1L2SA 5A91A 3IF6A 4D2OA 1RGZA 3ZVWA 2JKTM 1FQGA 3MQQA 1MWSA 2EFUA 3FWLA 4KZ4A 2HF6A 2NUTC 3OCNA 5JYOA 3BFDA 2C5WB 3O3VA 2JCHA 3VFHA 3IH9A 5F1GA 3G35A 2JHEA 3WS2A 2MJ6A 2IWDA 4JGRA 4UHUA 1EROA 2VV8A 4KG2A 1KE0A 4KZBA 3PBOA 1H5XA 3S7QA 5HAQA 4R70A 4FH2A 1YLJA 1PNEA 1VETA 4WBGA 4O0PA 4LV0A 3UB6A 4WMCA 3WRTA 3UDIA 1LL8A 3DAVA 3P98A 4H6JB 4LV1A 3T4JA 3B33A 1Z6FA 1HVBA 4B4XA 1OTDA 2WKEA 2PR5A 5DFXA 2YKFA 5HAIA 4KQDA 4KZ5A 4GDBA 3VSKA 1FIKA 1K54A 3GRJA 2OV5A 1NRJA 5CRFA 2EWWA 3LFVA 1CJFA 1D7EA 4S2IA 4OOMA 4Y13A 2R78A 4HBTA 4ZJ2A 4ETZA 3RJUA 2WYXA 5EPHA 4M3KA 5EV0A 3HLDA 4YINA 1TF1A 1XGIA 3ZQ5A 2OSUA 1LSXA 2FFYA 3ZG7B 1ES3A 3EEHA 3GR2A 4EUVA 2UV0E 1OTIA 2PBYA 3TSGA 3SH7A 4CLCC 5DJUA 3HJKA 1V9ZA 1Y54A 5HD5A 4Y15A 4E3KA 1GA9A 4Y0OA 2J8YA 3LICA 3OLOA 3PHYA 5CERA 5CXWA 3GDIA 2W3EA 1W8YA 4GS9B 2PT7A 3C2WA 2WK0A 1HZOA 1CF0A 4BBTA 1BLCA 2K7SA 1DRMA 1ZG6A 1AWIA 2R9XA 5HDSA 1GHMA 3VV4A 3UY6A 3MFDA 4EU0A 2VV7A 2FFFB 5KSHA 1K57A 2ZMAA 5HWVA 3IS2B 5F6AA 3KO6A 3DW0A 3HL9A 3QP5A 2IWBA 1Q2QA 4ZDXA 1P0ZA 1T1AA 3G34A 3FV7A 3PBQA 5DF9A 3K3DA 1N9OA 2WKHA 4DE1A 2G2WA 4Y5FA 2J80A 3OC2A 3Q7ZA 2ZMVA 4ZRRA 1N9LA 4L9FA 1VM1A 5J8XA 4LPZA 3G31A 2ZC7A 1WE4A 1S1ZA 1TS6A 1ERQA 2XA7S 1MC0A 2XEPA 3BY8A 4EUZA 2A2LA 4JXVA 1KGFA 5J7EA 2XD5A 1XFQA 4R0QA 3BRMA 3MBZA 4Q8IA 2V1AA 5HD3A 3MKFA 3MXQA 2PDRA 2P04A 4GB7A 3RXWA 3T50A 5FI6A 1TD5A 1JVJA 2ZC3B 4EXOA 4MMNA 4FUWA 3W2ZA 3LI8A 4HH2A 4FH4A 5HL6A 2GDNA 4FCFA 2Y2IA 4EETB 2EX2A 5DVAA 3A3DA 4HI4A 2HDUA 2XD1A 3B3XA 5HL1A 3E2LA 3VE3A 4CLCD 3DTKA 1U60A 1IEMA 3F1PB 3O86A 4II7A 3IX3A 2O9AA 4FTXA 3BFCA 4R3JA 4I5SA 3PBSA 2EX9A 4GJ4A 4ARZB 4Y3IA 3R4KA 3ZG8B 4I3AA 4E04A 1F9IA 3WWXA 3I7JA 2H10A 3DWKA 4I3IA 2WKPA 2G7UA 2WUQA 1RGYA 2OLVA 1T19A 2JKFA 3ZFZA 3E2KA 4NXBA 1GSVA 1YQSA 1LHYA 2A3UA 2VGLS 3WS5A 1LSVA 2G2UA 2JKRM 2BASA 4EQIA 2HJEA 4L0LA 4MN6A 3LIDA 4EERA 4KENB 1ESUA 3ZCZA 2VA0A 4B93A 1FCOA 1GSXA 4BD1A 4RVAA 2ZOHA 5DTSA 4LGWA 5A92A 4E3JA 1I2SA 2BTFP 4KZ6A 3PAGA 2EX8A 2RL3A 4CJNA 2B18A 3UO9A 5AVFA 3MQOA 1ESIA 4BWIA 5EVIB 3S22A 5DKKA 3IHAA 4MNRA 1BSGA 4JKTA 3UDFA 4DJ3A 4LFUA 3N6IA 3F1OB 2NUPC 3ZNTA 4BBUA 2ZQDA 4R1GA 2ZM2A 5M19A 5E2EA 1CI8A 3Q7VA 4Y0TA 2WGWA 1H8ZA 4K0XA 5FI2A 2ZQ8A 2Y79A 3PBRA 1PZOA 4PAUA 5MC7A 5TBMA 3H7WA 3ISGA 1KE4A 1ONHA 3D4FA 1K55A 3UDXA 4Q0JA 2PRFA 4KUKA 4XUZA 4GHIB 2OOLA 3O5YA 3UB7A 1CK3A 4GD6A 4R38A 4DN0A 4DE0A 5EUAA 3IXHA 4EBLA 3C8CA 3T1SA 1H3QA 1PW1A 4KQOA 4BL3A 5CHMA 1P97A 1D1JA 1JWVA 1DP6A 2EA9A 4PM7A 1ZG4A 4JXWA 1YSQA 5CHJA 1G6OA 1J9MA 4UAAA 4LRXC 3G30A 3VP4A 5GLAA 3T12B 4MLLA 2KX6A 2XH9A 1PZPA 2WAFA 3PBTA 3QNCA 1BLHA 1KE3A 1YKDA 4LCMA 3IX4A 3SH8A 2VLGA 1J3WA 3LR4A 3LUQA 2V8CA 4BD0A 3G32A 1GSWA 3E98A 3FKWA 2P9VB 3MR0A 2EX6A 2DMWA 4GDNA 4KZ9A 2X01A 3K2NA 1SKOB 5CEBA 2Y55A 3BY9A 3NOTC 3WS4A 2PAVP 3BFFA 3FG8A 5IU1A 2FH5A 4E3NA 4KZ7A 1MWRA 3DBAA 1BZAA 4U0TA 5HDCA 3QP2A 2EXBA 2R9WA 3MMHA 2WKRA 4N9LA 3UE0A 1K56D 3B47A 5BOHA 2UWXA 4WN5A 5GHYA 2WKIA 4UQIS 4R23A 5CECA 4YOFA 2P74A 3G6OA 1ZHHB 1ZKJA 3C4PA 2IWCA 4MN7A 3LI9A 1LL5A 4E6XA 1NWZA 3E4OA 3IF6B 4ZBEA 3W4OA 5DJTA 2B95A 3MKEA 1OJ5A 4BBVA 3IH8A 2A49A 2OAP1 2PD8A 4GW9A 4NETA 2D01A 3PAEA 5EE8A 1MKIA 4Z1WA 3T4OA 2Y59A 3BLSA 4BENA 1FR1A 1A0KA 3V5MA 4JGQA 4GCZA 3HJIA 1XA1A 3D3OA 2HP9A 4QY6A 5HPFA 2ZC6B 2VJWA 3IXDA 5FAQA 4CPKA 1YMSA 3UN7A 2VV6A 5FAOA 2ZMFA 4OLDA 1MBLA 5TGFA 1SKFA 2V2FF 2Y2KA 5JYPA 2PU2A 3TE8A 1YM1A 3VP2A 3F1NA 1SHVA 2V0WA 1JTGA 2OAQ1 2V0UA 3LGOA 2PYRA 2P7JA 5FQJA 3VOZA 1UGUA 3VSLA 1BYWA 1MPLA 3IBRA 1G6AA 3NDGA 4DKIA 3S7OA 4GOGA 5HDDA 3N8SA 2A24A 1VEUA 4N1HA 4KQQA 5FQ9A 4R3AA 3C4OA 5F82A 4E3OA 4XUXA 3C30A 3T4SA 3LIFA 4NK3A 1RP5A 2D02A 4HQAA 4KQRA 2BG1A 1Y4OA 3T4QA 2WGIA 1QMEA 1NY0A 4DMZA 4HJ3A 4A5RA 3GMWA 2ZQAA 4KZ3A 4JPMA 3CUEC 5EFWA 2O0YA 3IF5A 1E3UA 4OPRA 4EBPA 3ULFA 3LR0A 4R6LA 3U4LP 3LEZA 3VP0A 2JN7A 3NOPC 5G18A 2XSSA 5DTKA 2V1ZA 2QMIA 3FKVA 2X02A 5HWTA 2M7UA 3EGDC 1D06A 2W27A 1W79A 4IEDA 5CHUA 1NJ4A 3FYZA 1PWGA 4OP5A 4PM5A 3L9KA 4P6ZM 3UMDA 3HBRA 5K5BA 3S7NA 2J3TD 3EEAA 2QZ6A 1HTZA 1IYPA 5FI7A 5EVEA 4JGPA 3Q82A 2QJ7A 1VB6A 3T4KA 3BM6A 3NDEA 2O9BA 4UEYA 5CGSA 2JBFA 1JTDA 2HDRA 5EVID 2H28A 2O99A 2VK3A 4PM6A 3SW1A 1IYQA 1K4EA 1GA0A 1S4RA 3VMAA 2X71A 4UQIM 4C6YA 4F94A 3BQAA 1P9RA 4Y0UA 2QJ5A 2LB9A 3BQ8A 2JC7A 1L3LA 3IWIA 1LT0A 4F3LA 3SOIA 3NJAA 5AQBA 2H0TA 3D72A 1LL9A 4BJPA 5CEDA 3IHBA 3G2YA 5KSCA 2EWVA 2ZJ9A 3IT9A 4DDYA 3HLWA 5HSQA 4X68A 3N7WA 1BLPA 3KX0X 2PU4A 2QKPA 4RA7A 5FDHA 5HX9A 4EBNA 3H9WA 3QHYA 2J3WA 3LCEA 4N1XA 3A0SA 4HEFA 1PI4A 3FPVA 3SS4A 4DJ2A 5FEFA 5AQ7A 3KSIA 3IWQA 4KZ8A 1GHIA 1XFNA 3OPPA 3QP4A 4DRTA 2HDSA 4GLQA 4NXGA 4E3IA 1L0EA 2XLNA 4C75A 3H82A 1FCNA 4HH3A 4XT2A 1SDEA 2ZM8A 3ZNYA 1PW8A 4K0WA 1CEFA 4R4SA 4E6WA 4MDZA 5AJGA 3CHWP 3QP6A 4QU3A 3JPUA 1YLPA 2H0YA 4EEPA 3GV9A 4JGOA 1CI9A 3E4PA 5TJJA 4E3LA 4PMAA 5EM1A 3KYZA 3OPLA 4HP4A 4OPZA 4QHCA 3TJZC 5FASA 1PYYA 5HZHA 3O88A 3HCYA 4HESA 2Z2LB 4EV4A 4HP9A 2XGNA 3RFBA 5FAPA 1LSWA 2O9CA 2HPBA 3CITA 3UE6A 3DTEA 4LRZE 2C6WB 3VFFA 1HLUP 3WRZA 1BULA 5M1AA 4O8GA 5DKLA 1FOFA 3Q7VB 4PPRA 2J9PA 4Q0IA 3ZHHA 1G5UA 3PTEA 1KGGA 3KSGA 3C7UA 4ME4A 1F2KA 5TBMB 2W3FA 2HGVA 3UPOA 3BWLA 1S0WA 1DY6A 5U47A 1H8MA 3NY4A 4M4XA 4LRYC 2XRNA 4X69A 3T1XA 4WELA 2OLUA 2PYPA 1Q2PA 2XFTA 5F68A 1NZUA 1PRQA 2PHYA 3CAXA 3HLBA 3SS3A 1WYCA 4WMCD 4EWFA 2L4RA 1N9NA 1S1YA 2L0WA 3CLOA 4S2NC 3RXXA 1O07A 3U2AA 2GX5A 1WYBA 3OZHA 3RTYA 3NECA 1MY8A 4MEZA 4WZ5C 4ETXA 2Z2MB 4WUJA 3Q1FA 4Y2FA 4HY8A 5AQAA 4U0XA 1YLTA 1EW0A 1CQAA 1JNUA 3UE1A 2B5RA 3NI9A 3AGDA 5CTNA 1F98A 1G68A 3GSGA 2JKGA 2Q9NA 5TR7A 2KOIA 1XX2A 3NC8A 2ZD8A 3NHQA 4RYEA 2RCXA 1M6KA 1H8YA 2HP6A 3MZDA 1AXBA 1OT9A 2Y2OA 4OOYA 2ZQ7A 4C3QA 3LO7A 4QWOA 2VX8A 2XDMA 2DCFA 2V9AA 3ICYA 1N4OA 4HOIA 4DXCA 1DP9A 5A8BA 2ZLYA 1KDSA 5A93A 3V3RA 4DXBA 4I39A 3A3EA 1K38A 4WZ4A 1NLZA 2HP5A 2J7VA 3PBNA 3FZCA 1MWUA 5F83A 1FILA 1BTLA 3A0RA 4X6TA 3UB8A 2XA7M 4BMWA 3UNWA 1MXOA 4G3KA 2GNXA 4RX2A 1MZUA 4IVKA 3F1OA 4G3VA 3Q81A 2DNSA 3KYQA 3HLCA 3EWKA 1YAXA 3HUOA 3VOYA 1I5QA 3NCKA 3DWZA 3ZVTA 1TVFA 3RH8B 4I38A 4P6BA 4ZJ3A 4ID4A 4HJ6A 3ZG9B 3C5AA 1YPRA 5M18A 3Q07A 5LBRA 1TS7A 5E2GA 3R7WA 1TS0A 2OWHA 1XP4A 2WAEA 3TG9A 3CUEA 4ZAMA 2EFXA 2ZQ9A 2M7VA 2V1BA 5F69A 2ZC4B 5D3OA 1UWNX 4WF0A 4EQ1A 3V39A 3BYDA 3F1NB 3UE3A 4JXGA 5EVLA 4S2LA 3ZDJA 1XA7A 2V8FA 3SH9A 4E3MA 3A0VA 4KUOA 4FD8A 3KSFA 5IT5A 1ONGA 1ZC2A 5IS1A 4GD8A 2A24B 1VEUB 2VGLM 4Q0HA 3O87A 1SKOA 3C7VA 1BUEA 1PIOA 2J3TC 5CTMA 4CLCA 4O7DA 3E0YA 1OT6A 1OTAA 1WA9A 4Z9QA 4EW7A 1IYSA 1K55C 3IBJA 2P08A 1VETB 4RX3A 1E4DA 5EVIC 2PR6A 3NULA 3CJMA 3IXGA 3M6HA 4B4ZA 5A90A 4MN5A 3N4IA 5E43A 2GJ3A 1LLBA 2PD7A 3SZTA 3CPTA 3GECA 2Y8HA 4OQIA 3K3CA 3IXBA 5CX7A 1YLYA 1IOUA 2WGVA 3KSHA 1S6RA 1H0MA 2ZL1A 3M2JA 3BFGA 2QWSA 4HNBA 1P9WA 2DRWA 1L0GA 1NYYA 3G2ZA 1OMEA 4HBUA 3LEQA 3TOIA 3MZFA 3W4QA 2BLSA 1EWZA 3IWOA 4FSFA 4X53A 4WM9A 4S2PA 2FZ0A 1W63Q 3GVBA 3EQVA 5FQIA 2HZ5A 2XR0A 2I72A 3LY3A 5DTTA 4LV3A 4S2KA 1RCJA 1M40A 4UA7A 3NIAA 3P09A 1XJ6A 2JKRI 4MCWA 2E8IA 2Y91A 4R3BA 2W1TA 1HD8A 3V50A 4PKYA 3WS1A 5F5YA 1YLZA 5HPIA 1KVMA 2H5SA 2WADA 1TDLA 2J9OA 5L10A 1QMFA 3A3IA 5KIZA 3VP3A 1ES5A 2WZXA 4OQ0A 4P0MA 1EI5A 1DJBA 1MWTA 3JYIA 3HVFA 3LR3A 5EM0A 1W8QA 4F3LB 2W3GA 2Q0OA 3PYPA 1C3BA 3HUNA 4LENA 3VOLA 3VP1A 2E8JA 3GQZA 3MXSA 3MSHA 4K08A 5EOOA 3LYXA 2XF3A 4PM8A 1XJ2A 2AVXA 2CC1A 5AVEA 4KG6A 4H6JA 3LR5A 3QP1A 3OPRA 5FA7A 3QNBA 4BQMA 4LV2A 4P85A 1NXYA 2ZC5B 1IKIA 5GL9A 3HLFA 4OLGA 5G4ZA 3UB9A 3JVUA 1F5MA 1OJGA 4ESPA 5HFOA 2VKSA 5DF8A 3ZG0A 2IA2A 4RQ9A 3IF6C 3MS6A 5L07A 5E2FA 4G3WA 1BT5A 4EEUA 3KYEA 1NRFA 3DTIA 4X1LA 4UA9A 1STZA 3W4PA 3M2KA 3ITBA 2L1MA 3H82B 3MF0A 1XJ3A 1CEGA 5DFYA 3ITAA 4BL2A 5L8MA 1PI5A 2EXAA 4OONA 1O7EA 4XT2B 2K31A 1S67L 3M6BA 1I2WA 3HREA 4IBXA 1VHMA 4OQGA 1K56A 2OWJA 4OH0A 1XJ4A 1VQQA 2Y2PA 2WKQA 3OBFA 3JVVA 2ZBBA 1LI9A 5TFQA 1DJCA 3LIAA 3GTCA 4GS9A 3T1RA 3DTMA 3T1QB 4S2NA 2I9VA 1DP8A 4IUKA 4OPYA 2PBDP 1W7FA 5CGWA 3P01A 4WZ5A 4Y7PA 4KG5A 2YKHA 1FSWA 1T1CA 5FQQA 3UB5P 4NXEA 4PM9A 1ACFA 3S4XA 3BEBA 3T4LA 4NEED 1SZVA 1K54C 1PFLA 4IBRA 4WLAA 3CG5A 3LIBA 4XXRA 5L2FA 3IS2A 2Y2HA 3D9YA 4QJGA 2W0NA 1K6SA 3G4PA 4P87A 4OPQA 4NXFA 1W63M 4L9GA 3A3FA 1FCMA 2Y2GA 5GHXA 1KOUA 4AFIA 1YMXA 2Z6DA 3PR6A 5GLCA 1SCWA 4QY5A 4IVIA 3IQAA 1ODVA 2Y4AA 1YT4A 1PWDA 1V9YA 2GZAA 4ZTKA 1S4SA 3T4TA 1N9BA 5CGXA 1X0OA 3QP8A 1ES2A 1XGJA 4B9OA 5KMWA 4PHTA 5FSRA
chains in the Genus database with same CATH topology
1VETB 3CPTB 1VETA 3T1XA 1VEUA 4FTXA 1PRQA 3NULA 5EM0A 3T1RA 3DAVA 3T1QB 2VK3A 2ZL1B 2PRFA 2PBDP 3L7HA 2E8JA 1YPRA 1Y4OA 5FDSA 3NECA 3CPTA 3MSHA 3CHWP 3UB5P 2JKFA 1FIKA 1ACFA 2ACGA 1SZVA 1CQAA 4X25A 2B95A 3T1SA 1PFLA 2ZL1A 1CJFA 2JKGA 5EM1A 3D9YA 1D1JA 5FEGA 4D60A 3LEQA 1Z09A 1K0KA 5EV0A 4ESPA 3T12B 3U4LP 1A0KA 2V8FA 2BTFP 4QWOA 1HLUP 1J3WA 2V8CA 3MS6A 2HZ5A 3KYEA 1VEUB 4X1LA 1G5UA 4FUWA 5FEFA 1SKOB 1FILA 1SKOA 4X1MA 1F2KA 2PAVP 3L9KA 1CF0A 3LGOA 1AWIA 5EVEA 1PNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VET B;  3CPT B;  1VET A;  3T1X A;  1VEU A;  4FTX A;  1PRQ A;  3NUL A;  5EM0 A;  3T1R A;  3DAV A;  3T1Q B;  2VK3 A;  2ZL1 B;  2PRF A;  2PBD P;  3L7H A;  2E8J A;  1YPR A;  1Y4O A;  5FDS A;  3NEC A;  3CPT A;  3MSH A;  3CHW P;  3UB5 P;  2JKF A;  1FIK A;  1ACF A;  2ACG A;  1SZV A;  1CQA A;  4X25 A;  2B95 A;  3T1S A;  1PFL A;  2ZL1 A;  1CJF A;  2JKG A;  5EM1 A;  3D9Y A;  1D1J A;  5FEG A;  4D60 A;  3LEQ A;  1Z09 A;  1K0K A;  5EV0 A;  4ESP A;  3T12 B;  3U4L P;  1A0K A;  2V8F A;  2BTF P;  4QWO A;  1HLU P;  1J3W A;  2V8C A;  3MS6 A;  2HZ5 A;  3KYE A;  1VEU B;  4X1L A;  1G5U A;  4FUW A;  5FEF A;  1SKO B;  1FIL A;  1SKO A;  4X1M A;  1F2K A;  2PAV P;  3L9K A;  1CF0 A;  3LGO A;  1AWI A;  5EVE A;  1PNE A; 
#chains in the Genus database with same CATH topology
 2Z6C A;  5GLD A;  4NG2 A;  3ZGA B;  2ZM0 A;  2WGW B;  4WYY A;  1YLW A;  2ZQC A;  1T1B A;  4KZA A;  3FC7 A;  2VGK A;  3OPH A;  3H7W B;  2XFS A;  1GCE A;  4YNR A;  1XPB A;  1K57 C;  4I3J A;  1PWC A;  3EOI A;  3L7H A;  5HWW A;  2Y2M A;  4DF6 A;  5HW3 A;  4MBH A;  3LIE A;  1UWP X;  3F1P A;  2Y2N A;  2W1R A;  2JKT I;  2ACG A;  3WS0 A;  4WEJ A;  3HLE A;  1ZTU A;  4X25 A;  4S2J A;  4ARZ A;  3V3S A;  4FOF A;  4JF5 A;  1E25 A;  4IUH A;  5KZH A;  2XK1 A;  2VEA A;  3A3J A;  4CLC E;  5GHZ A;  3NOU C;  4N92 A;  1IEL A;  4JXS A;  3B42 A;  2V20 A;  4O01 A;  3TW8 A;  3OOV A;  1E3U D;  2XQZ A;  1YSP A;  4HHD A;  1K4F A;  5FL3 A;  1NYM A;  1JWP A;  2B02 A;  3BFE A;  4QB8 A;  3CWF A;  5FQM A;  5EOE A;  1W5D A;  3UME A;  1ALQ A;  4GNU A;  1XKZ A;  2JE5 A;  4OOL A;  2W3D A;  1FR6 A;  1BLS A;  4OQH A;  2LB5 A;  2INW A;  4X1M A;  4K91 A;  4YWZ A;  1OTE A;  3AGE A;  5I5L A;  4GN2 A;  4JF6 A;  3MZE A;  4H8R A;  3W8K A;  4DDS A;  4JF4 A;  4N9K A;  5EVI A;  3MJQ A;  4BLM A;  1L0F A;  1GHP A;  3R7W B;  3CI6 A;  3EQU A;  4WEK A;  4UA6 A;  2K2N A;  4EES A;  4ZJ1 A;  3BEC A;  1K25 A;  4HIA A;  2W3H A;  4Y17 A;  4R4R A;  3UPP A;  3NBL A;  1TS8 A;  4PKY G;  2Y2Q A;  2VZW A;  4GZB A;  2HJ9 C;  3N8R A;  4DE2 A;  5J4E A;  3MQ0 A;  3IX8 A;  5IHV A;  1IYO A;  1ERM A;  3CMZ A;  1NLY A;  3BJN A;  3HLG A;  1K6R A;  5AQ9 A;  2QHK A;  4QD4 A;  3PXP A;  3CZD A;  4D60 A;  4HJ4 A;  5HAR A;  3TRC A;  3FPW A;  3ZG5 A;  5F1F A;  4P6Z S;  4LCL A;  1Z09 A;  4JLF A;  4GHI A;  2Q9M A;  4S2O A;  3SS5 A;  2QPN A;  1MKM A;  3S7P A;  4CLC B;  4CQH A;  1L0D A;  3VE4 A;  3LY4 A;  1LI0 A;  2HV1 A;  2Y2L A;  4MBF A;  1KGE A;  1OTB A;  3BLM A;  1OPX A;  1KDW A;  2M1C A;  4IHQ A;  4OVD A;  1FSY A;  4DE3 A;  4S2M A;  3P7N A;  5I94 A;  3OCL A;  5FAT A;  2KDK A;  4X56 A;  3HUM A;  3E4Q A;  1S66 L;  4JBF A;  1IFQ A;  1SDN A;  4IJG A;  4QPR A;  1Y28 A;  3CPT B;  2KLI A;  5GLB A;  2Y2J A;  3BW6 A;  4L9E A;  2CMN A;  3V67 A;  5J3W A;  1XXM A;  2P9V A;  3S1Y A;  4MBK A;  2WZZ A;  2XRO A;  1NZO A;  2ZL1 B;  5C5K A;  3ZYT A;  1T18 A;  3UPN A;  4OP8 A;  4B88 A;  4WL9 A;  1DJA A;  5FQK A;  5HAP A;  5DF7 A;  3MFX A;  4GKU A;  5FDS A;  2ZOI A;  2QYB A;  4OKP A;  1TDG A;  4LLO B;  5G4Y A;  3EGX C;  1TEM A;  5EEC A;  3N8L A;  4NKP A;  5L09 A;  4U3T A;  1G28 A;  5FEG A;  1ES4 A;  4YFM A;  1IKG A;  4X55 A;  1JWZ A;  3MXR A;  1KVL A;  3AGF A;  1K0K A;  2VGJ A;  5E2H A;  2HDQ A;  3C38 A;  2W1T B;  1L2S A;  5A91 A;  3IF6 A;  4D2O A;  1RGZ A;  3ZVW A;  2JKT M;  1FQG A;  3MQQ A;  1MWS A;  2EFU A;  3FWL A;  4KZ4 A;  2HF6 A;  2NUT C;  3OCN A;  5JYO A;  3BFD A;  2C5W B;  3O3V A;  2JCH A;  3VFH A;  3IH9 A;  5F1G A;  3G35 A;  2JHE A;  3WS2 A;  2MJ6 A;  2IWD A;  4JGR A;  4UHU A;  1ERO A;  2VV8 A;  4KG2 A;  1KE0 A;  4KZB A;  3PBO A;  1H5X A;  3S7Q A;  5HAQ A;  4R70 A;  4FH2 A;  1YLJ A;  1PNE A;  1VET A;  4WBG A;  4O0P A;  4LV0 A;  3UB6 A;  4WMC A;  3WRT A;  3UDI A;  1LL8 A;  3DAV A;  3P98 A;  4H6J B;  4LV1 A;  3T4J A;  3B33 A;  1Z6F A;  1HVB A;  4B4X A;  1OTD A;  2WKE A;  2PR5 A;  5DFX A;  2YKF A;  5HAI A;  4KQD A;  4KZ5 A;  4GDB A;  3VSK A;  1FIK A;  1K54 A;  3GRJ A;  2OV5 A;  1NRJ A;  5CRF A;  2EWW A;  3LFV A;  1CJF A;  1D7E A;  4S2I A;  4OOM A;  4Y13 A;  2R78 A;  4HBT A;  4ZJ2 A;  4ETZ A;  3RJU A;  2WYX A;  5EPH A;  4M3K A;  5EV0 A;  3HLD A;  4YIN A;  1TF1 A;  1XGI A;  3ZQ5 A;  2OSU A;  1LSX A;  2FFY A;  3ZG7 B;  1ES3 A;  3EEH A;  3GR2 A;  4EUV A;  2UV0 E;  1OTI A;  2PBY A;  3TSG A;  3SH7 A;  4CLC C;  5DJU A;  3HJK A;  1V9Z A;  1Y54 A;  5HD5 A;  4Y15 A;  4E3K A;  1GA9 A;  4Y0O A;  2J8Y A;  3LIC A;  3OLO A;  3PHY A;  5CER A;  5CXW A;  3GDI A;  2W3E A;  1W8Y A;  4GS9 B;  2PT7 A;  3C2W A;  2WK0 A;  1HZO A;  1CF0 A;  4BBT A;  1BLC A;  2K7S A;  1DRM A;  1ZG6 A;  1AWI A;  2R9X A;  5HDS A;  1GHM A;  3VV4 A;  3UY6 A;  3MFD A;  4EU0 A;  2VV7 A;  2FFF B;  5KSH A;  1K57 A;  2ZMA A;  5HWV A;  3IS2 B;  5F6A A;  3KO6 A;  3DW0 A;  3HL9 A;  3QP5 A;  2IWB A;  1Q2Q A;  4ZDX A;  1P0Z A;  1T1A A;  3G34 A;  3FV7 A;  3PBQ A;  5DF9 A;  3K3D A;  1N9O A;  2WKH A;  4DE1 A;  2G2W A;  4Y5F A;  2J80 A;  3OC2 A;  3Q7Z A;  2ZMV A;  4ZRR A;  1N9L A;  4L9F A;  1VM1 A;  5J8X A;  4LPZ A;  3G31 A;  2ZC7 A;  1WE4 A;  1S1Z A;  1TS6 A;  1ERQ A;  2XA7 S;  1MC0 A;  2XEP A;  3BY8 A;  4EUZ A;  2A2L A;  4JXV A;  1KGF A;  5J7E A;  2XD5 A;  1XFQ A;  4R0Q A;  3BRM A;  3MBZ A;  4Q8I A;  2V1A A;  5HD3 A;  3MKF A;  3MXQ A;  2PDR A;  2P04 A;  4GB7 A;  3RXW A;  3T50 A;  5FI6 A;  1TD5 A;  1JVJ A;  2ZC3 B;  4EXO A;  4MMN A;  4FUW A;  3W2Z A;  3LI8 A;  4HH2 A;  4FH4 A;  5HL6 A;  2GDN A;  4FCF A;  2Y2I A;  4EET B;  2EX2 A;  5DVA A;  3A3D A;  4HI4 A;  2HDU A;  2XD1 A;  3B3X A;  5HL1 A;  3E2L A;  3VE3 A;  4CLC D;  3DTK A;  1U60 A;  1IEM A;  3F1P B;  3O86 A;  4II7 A;  3IX3 A;  2O9A A;  4FTX A;  3BFC A;  4R3J A;  4I5S A;  3PBS A;  2EX9 A;  4GJ4 A;  4ARZ B;  4Y3I A;  3R4K A;  3ZG8 B;  4I3A A;  4E04 A;  1F9I A;  3WWX A;  3I7J A;  2H10 A;  3DWK A;  4I3I A;  2WKP A;  2G7U A;  2WUQ A;  1RGY A;  2OLV A;  1T19 A;  2JKF A;  3ZFZ A;  3E2K A;  4NXB A;  1GSV A;  1YQS A;  1LHY A;  2A3U A;  2VGL S;  3WS5 A;  1LSV A;  2G2U A;  2JKR M;  2BAS A;  4EQI A;  2HJE A;  4L0L A;  4MN6 A;  3LID A;  4EER A;  4KEN B;  1ESU A;  3ZCZ A;  2VA0 A;  4B93 A;  1FCO A;  1GSX A;  4BD1 A;  4RVA A;  2ZOH A;  5DTS A;  4LGW A;  5A92 A;  4E3J A;  1I2S A;  2BTF P;  4KZ6 A;  3PAG A;  2EX8 A;  2RL3 A;  4CJN A;  2B18 A;  3UO9 A;  5AVF A;  3MQO A;  1ESI A;  4BWI A;  5EVI B;  3S22 A;  5DKK A;  3IHA A;  4MNR A;  1BSG A;  4JKT A;  3UDF A;  4DJ3 A;  4LFU A;  3N6I A;  3F1O B;  2NUP C;  3ZNT A;  4BBU A;  2ZQD A;  4R1G A;  2ZM2 A;  5M19 A;  5E2E A;  1CI8 A;  3Q7V A;  4Y0T A;  2WGW A;  1H8Z A;  4K0X A;  5FI2 A;  2ZQ8 A;  2Y79 A;  3PBR A;  1PZO A;  4PAU A;  5MC7 A;  5TBM A;  3H7W A;  3ISG A;  1KE4 A;  1ONH A;  3D4F A;  1K55 A;  3UDX A;  4Q0J A;  2PRF A;  4KUK A;  4XUZ A;  4GHI B;  2OOL A;  3O5Y A;  3UB7 A;  1CK3 A;  4GD6 A;  4R38 A;  4DN0 A;  4DE0 A;  5EUA A;  3IXH A;  4EBL A;  3C8C A;  3T1S A;  1H3Q A;  1PW1 A;  4KQO A;  4BL3 A;  5CHM A;  1P97 A;  1D1J A;  1JWV A;  1DP6 A;  2EA9 A;  4PM7 A;  1ZG4 A;  4JXW A;  1YSQ A;  5CHJ A;  1G6O A;  1J9M A;  4UAA A;  4LRX C;  3G30 A;  3VP4 A;  5GLA A;  3T12 B;  4MLL A;  2KX6 A;  2XH9 A;  1PZP A;  2WAF A;  3PBT A;  3QNC A;  1BLH A;  1KE3 A;  1YKD A;  4LCM A;  3IX4 A;  3SH8 A;  2VLG A;  1J3W A;  3LR4 A;  3LUQ A;  2V8C A;  4BD0 A;  3G32 A;  1GSW A;  3E98 A;  3FKW A;  2P9V B;  3MR0 A;  2EX6 A;  2DMW A;  4GDN A;  4KZ9 A;  2X01 A;  3K2N A;  1SKO B;  5CEB A;  2Y55 A;  3BY9 A;  3NOT C;  3WS4 A;  2PAV P;  3BFF A;  3FG8 A;  5IU1 A;  2FH5 A;  4E3N A;  4KZ7 A;  1MWR A;  3DBA A;  1BZA A;  4U0T A;  5HDC A;  3QP2 A;  2EXB A;  2R9W A;  3MMH A;  2WKR A;  4N9L A;  3UE0 A;  1K56 D;  3B47 A;  5BOH A;  2UWX A;  4WN5 A;  5GHY A;  2WKI A;  4UQI S;  4R23 A;  5CEC A;  4YOF A;  2P74 A;  3G6O A;  1ZHH B;  1ZKJ A;  3C4P A;  2IWC A;  4MN7 A;  3LI9 A;  1LL5 A;  4E6X A;  1NWZ A;  3E4O A;  3IF6 B;  4ZBE A;  3W4O A;  5DJT A;  2B95 A;  3MKE A;  1OJ5 A;  4BBV A;  3IH8 A;  2A49 A;  2OAP 1;  2PD8 A;  4GW9 A;  4NET A;  2D01 A;  3PAE A;  5EE8 A;  1MKI A;  4Z1W A;  3T4O A;  2Y59 A;  3BLS A;  4BEN A;  1FR1 A;  1A0K A;  3V5M A;  4JGQ A;  4GCZ A;  3HJI A;  1XA1 A;  3D3O A;  2HP9 A;  4QY6 A;  5HPF A;  2ZC6 B;  2VJW A;  3IXD A;  5FAQ A;  4CPK A;  1YMS A;  3UN7 A;  2VV6 A;  5FAO A;  2ZMF A;  4OLD A;  1MBL A;  5TGF A;  1SKF A;  2V2F F;  2Y2K A;  5JYP A;  2PU2 A;  3TE8 A;  1YM1 A;  3VP2 A;  3F1N A;  1SHV A;  2V0W A;  1JTG A;  2OAQ 1;  2V0U A;  3LGO A;  2PYR A;  2P7J A;  5FQJ A;  3VOZ A;  1UGU A;  3VSL A;  1BYW A;  1MPL A;  3IBR A;  1G6A A;  3NDG A;  4DKI A;  3S7O A;  4GOG A;  5HDD A;  3N8S A;  2A24 A;  1VEU A;  4N1H A;  4KQQ A;  5FQ9 A;  4R3A A;  3C4O A;  5F82 A;  4E3O A;  4XUX A;  3C30 A;  3T4S A;  3LIF A;  4NK3 A;  1RP5 A;  2D02 A;  4HQA A;  4KQR A;  2BG1 A;  1Y4O A;  3T4Q A;  2WGI A;  1QME A;  1NY0 A;  4DMZ A;  4HJ3 A;  4A5R A;  3GMW A;  2ZQA A;  4KZ3 A;  4JPM A;  3CUE C;  5EFW A;  2O0Y A;  3IF5 A;  1E3U A;  4OPR A;  4EBP A;  3ULF A;  3LR0 A;  4R6L A;  3U4L P;  3LEZ A;  3VP0 A;  2JN7 A;  3NOP C;  5G18 A;  2XSS A;  5DTK A;  2V1Z A;  2QMI A;  3FKV A;  2X02 A;  5HWT A;  2M7U A;  3EGD C;  1D06 A;  2W27 A;  1W79 A;  4IED A;  5CHU A;  1NJ4 A;  3FYZ A;  1PWG A;  4OP5 A;  4PM5 A;  3L9K A;  4P6Z M;  3UMD A;  3HBR A;  5K5B A;  3S7N A;  2J3T D;  3EEA A;  2QZ6 A;  1HTZ A;  1IYP A;  5FI7 A;  5EVE A;  4JGP A;  3Q82 A;  2QJ7 A;  1VB6 A;  3T4K A;  3BM6 A;  3NDE A;  2O9B A;  4UEY A;  5CGS A;  2JBF A;  1JTD A;  2HDR A;  5EVI D;  2H28 A;  2O99 A;  2VK3 A;  4PM6 A;  3SW1 A;  1IYQ A;  1K4E A;  1GA0 A;  1S4R A;  3VMA A;  2X71 A;  4UQI M;  4C6Y A;  4F94 A;  3BQA A;  1P9R A;  4Y0U A;  2QJ5 A;  2LB9 A;  3BQ8 A;  2JC7 A;  1L3L A;  3IWI A;  1LT0 A;  4F3L A;  3SOI A;  3NJA A;  5AQB A;  2H0T A;  3D72 A;  1LL9 A;  4BJP A;  5CED A;  3IHB A;  3G2Y A;  5KSC A;  2EWV A;  2ZJ9 A;  3IT9 A;  4DDY A;  3HLW A;  5HSQ A;  4X68 A;  3N7W A;  1BLP A;  3KX0 X;  2PU4 A;  2QKP A;  4RA7 A;  5FDH A;  5HX9 A;  4EBN A;  3H9W A;  3QHY A;  2J3W A;  3LCE A;  4N1X A;  3A0S A;  4HEF A;  1PI4 A;  3FPV A;  3SS4 A;  4DJ2 A;  5FEF A;  5AQ7 A;  3KSI A;  3IWQ A;  4KZ8 A;  1GHI A;  1XFN A;  3OPP A;  3QP4 A;  4DRT A;  2HDS A;  4GLQ A;  4NXG A;  4E3I A;  1L0E A;  2XLN A;  4C75 A;  3H82 A;  1FCN A;  4HH3 A;  4XT2 A;  1SDE A;  2ZM8 A;  3ZNY A;  1PW8 A;  4K0W A;  1CEF A;  4R4S A;  4E6W A;  4MDZ A;  5AJG A;  3CHW P;  3QP6 A;  4QU3 A;  3JPU A;  1YLP A;  2H0Y A;  4EEP A;  3GV9 A;  4JGO A;  1CI9 A;  3E4P A;  5TJJ A;  4E3L A;  4PMA A;  5EM1 A;  3KYZ A;  3OPL A;  4HP4 A;  4OPZ A;  4QHC A;  3TJZ C;  5FAS A;  1PYY A;  5HZH A;  3O88 A;  3HCY A;  4HES A;  2Z2L B;  4EV4 A;  4HP9 A;  2XGN A;  3RFB A;  5FAP A;  1LSW A;  2O9C A;  2HPB A;  3CIT A;  3UE6 A;  3DTE A;  4LRZ E;  2C6W B;  3VFF A;  1HLU P;  3WRZ A;  1BUL A;  5M1A A;  4O8G A;  5DKL A;  1FOF A;  3Q7V B;  4PPR A;  2J9P A;  4Q0I A;  3ZHH A;  1G5U A;  3PTE A;  1KGG A;  3KSG A;  3C7U A;  4ME4 A;  1F2K A;  5TBM B;  2W3F A;  2HGV A;  3UPO A;  3BWL A;  1S0W A;  1DY6 A;  5U47 A;  1H8M A;  3NY4 A;  4M4X A;  4LRY C;  2XRN A;  4X69 A;  3T1X A;  4WEL A;  2OLU A;  2PYP A;  1Q2P A;  2XFT A;  5F68 A;  1NZU A;  1PRQ A;  2PHY A;  3CAX A;  3HLB A;  3SS3 A;  1WYC A;  4WMC D;  4EWF A;  2L4R A;  1N9N A;  1S1Y A;  2L0W A;  3CLO A;  4S2N C;  3RXX A;  1O07 A;  3U2A A;  2GX5 A;  1WYB A;  3OZH A;  3RTY A;  3NEC A;  1MY8 A;  4MEZ A;  4WZ5 C;  4ETX A;  2Z2M B;  4WUJ A;  3Q1F A;  4Y2F A;  4HY8 A;  5AQA A;  4U0X A;  1YLT A;  1EW0 A;  1CQA A;  1JNU A;  3UE1 A;  2B5R A;  3NI9 A;  3AGD A;  5CTN A;  1F98 A;  1G68 A;  3GSG A;  2JKG A;  2Q9N A;  5TR7 A;  2KOI A;  1XX2 A;  3NC8 A;  2ZD8 A;  3NHQ A;  4RYE A;  2RCX A;  1M6K A;  1H8Y A;  2HP6 A;  3MZD A;  1AXB A;  1OT9 A;  2Y2O A;  4OOY A;  2ZQ7 A;  4C3Q A;  3LO7 A;  4QWO A;  2VX8 A;  2XDM A;  2DCF A;  2V9A A;  3ICY A;  1N4O A;  4HOI A;  4DXC A;  1DP9 A;  5A8B A;  2ZLY A;  1KDS A;  5A93 A;  3V3R A;  4DXB A;  4I39 A;  3A3E A;  1K38 A;  4WZ4 A;  1NLZ A;  2HP5 A;  2J7V A;  3PBN A;  3FZC A;  1MWU A;  5F83 A;  1FIL A;  1BTL A;  3A0R A;  4X6T A;  3UB8 A;  2XA7 M;  4BMW A;  3UNW A;  1MXO A;  4G3K A;  2GNX A;  4RX2 A;  1MZU A;  4IVK A;  3F1O A;  4G3V A;  3Q81 A;  2DNS A;  3KYQ A;  3HLC A;  3EWK A;  1YAX A;  3HUO A;  3VOY A;  1I5Q A;  3NCK A;  3DWZ A;  3ZVT A;  1TVF A;  3RH8 B;  4I38 A;  4P6B A;  4ZJ3 A;  4ID4 A;  4HJ6 A;  3ZG9 B;  3C5A A;  1YPR A;  5M18 A;  3Q07 A;  5LBR A;  1TS7 A;  5E2G A;  3R7W A;  1TS0 A;  2OWH A;  1XP4 A;  2WAE A;  3TG9 A;  3CUE A;  4ZAM A;  2EFX A;  2ZQ9 A;  2M7V A;  2V1B A;  5F69 A;  2ZC4 B;  5D3O A;  1UWN X;  4WF0 A;  4EQ1 A;  3V39 A;  3BYD A;  3F1N B;  3UE3 A;  4JXG A;  5EVL A;  4S2L A;  3ZDJ A;  1XA7 A;  2V8F A;  3SH9 A;  4E3M A;  3A0V A;  4KUO A;  4FD8 A;  3KSF A;  5IT5 A;  1ONG A;  1ZC2 A;  5IS1 A;  4GD8 A;  2A24 B;  1VEU B;  2VGL M;  4Q0H A;  3O87 A;  1SKO A;  3C7V A;  1BUE A;  1PIO A;  2J3T C;  5CTM A;  4CLC A;  4O7D A;  3E0Y A;  1OT6 A;  1OTA A;  1WA9 A;  4Z9Q A;  4EW7 A;  1IYS A;  1K55 C;  3IBJ A;  2P08 A;  1VET B;  4RX3 A;  1E4D A;  5EVI C;  2PR6 A;  3NUL A;  3CJM A;  3IXG A;  3M6H A;  4B4Z A;  5A90 A;  4MN5 A;  3N4I A;  5E43 A;  2GJ3 A;  1LLB A;  2PD7 A;  3SZT A;  3CPT A;  3GEC A;  2Y8H A;  4OQI A;  3K3C A;  3IXB A;  5CX7 A;  1YLY A;  1IOU A;  2WGV A;  3KSH A;  1S6R A;  1H0M A;  2ZL1 A;  3M2J A;  3BFG A;  2QWS A;  4HNB A;  1P9W A;  2DRW A;  1L0G A;  1NYY A;  3G2Z A;  1OME A;  4HBU A;  3LEQ A;  3TOI A;  3MZF A;  3W4Q A;  2BLS A;  1EWZ A;  3IWO A;  4FSF A;  4X53 A;  4WM9 A;  4S2P A;  2FZ0 A;  1W63 Q;  3GVB A;  3EQV A;  5FQI A;  2HZ5 A;  2XR0 A;  2I72 A;  3LY3 A;  5DTT A;  4LV3 A;  4S2K A;  1RCJ A;  1M40 A;  4UA7 A;  3NIA A;  3P09 A;  1XJ6 A;  2JKR I;  4MCW A;  2E8I A;  2Y91 A;  4R3B A;  2W1T A;  1HD8 A;  3V50 A;  4PKY A;  3WS1 A;  5F5Y A;  1YLZ A;  5HPI A;  1KVM A;  2H5S A;  2WAD A;  1TDL A;  2J9O A;  5L10 A;  1QMF A;  3A3I A;  5KIZ A;  3VP3 A;  1ES5 A;  2WZX A;  4OQ0 A;  4P0M A;  1EI5 A;  1DJB A;  1MWT A;  3JYI A;  3HVF A;  3LR3 A;  5EM0 A;  1W8Q A;  4F3L B;  2W3G A;  2Q0O A;  3PYP A;  1C3B A;  3HUN A;  4LEN A;  3VOL A;  3VP1 A;  2E8J A;  3GQZ A;  3MXS A;  3MSH A;  4K08 A;  5EOO A;  3LYX A;  2XF3 A;  4PM8 A;  1XJ2 A;  2AVX A;  2CC1 A;  5AVE A;  4KG6 A;  4H6J A;  3LR5 A;  3QP1 A;  3OPR A;  5FA7 A;  3QNB A;  4BQM A;  4LV2 A;  4P85 A;  1NXY A;  2ZC5 B;  1IKI A;  5GL9 A;  3HLF A;  4OLG A;  5G4Z A;  3UB9 A;  3JVU A;  1F5M A;  1OJG A;  4ESP A;  5HFO A;  2VKS A;  5DF8 A;  3ZG0 A;  2IA2 A;  4RQ9 A;  3IF6 C;  3MS6 A;  5L07 A;  5E2F A;  4G3W A;  1BT5 A;  4EEU A;  3KYE A;  1NRF A;  3DTI A;  4X1L A;  4UA9 A;  1STZ A;  3W4P A;  3M2K A;  3ITB A;  2L1M A;  3H82 B;  3MF0 A;  1XJ3 A;  1CEG A;  5DFY A;  3ITA A;  4BL2 A;  5L8M A;  1PI5 A;  2EXA A;  4OON A;  1O7E A;  4XT2 B;  2K31 A;  1S67 L;  3M6B A;  1I2W A;  3HRE A;  4IBX A;  1VHM A;  4OQG A;  1K56 A;  2OWJ A;  4OH0 A;  1XJ4 A;  1VQQ A;  2Y2P A;  2WKQ A;  3OBF A;  3JVV A;  2ZBB A;  1LI9 A;  5TFQ A;  1DJC A;  3LIA A;  3GTC A;  4GS9 A;  3T1R A;  3DTM A;  3T1Q B;  4S2N A;  2I9V A;  1DP8 A;  4IUK A;  4OPY A;  2PBD P;  1W7F A;  5CGW A;  3P01 A;  4WZ5 A;  4Y7P A;  4KG5 A;  2YKH A;  1FSW A;  1T1C A;  5FQQ A;  3UB5 P;  4NXE A;  4PM9 A;  1ACF A;  3S4X A;  3BEB A;  3T4L A;  4NEE D;  1SZV A;  1K54 C;  1PFL A;  4IBR A;  4WLA A;  3CG5 A;  3LIB A;  4XXR A;  5L2F A;  3IS2 A;  2Y2H A;  3D9Y A;  4QJG A;  2W0N A;  1K6S A;  3G4P A;  4P87 A;  4OPQ A;  4NXF A;  1W63 M;  4L9G A;  3A3F A;  1FCM A;  2Y2G A;  5GHX A;  1KOU A;  4AFI A;  1YMX A;  2Z6D A;  3PR6 A;  5GLC A;  1SCW A;  4QY5 A;  4IVI A;  3IQA A;  1ODV A;  2Y4A A;  1YT4 A;  1PWD A;  1V9Y A;  2GZA A;  4ZTK A;  1S4S A;  3T4T A;  1N9B A;  5CGX A;  1X0O A;  3QP8 A;  1ES2 A;  1XGJ A;  4B9O A;  5KMW A;  4PHT A;  5FSR A; 
#chains in the Genus database with same CATH homology
 1VET B;  3CPT B;  1VET A;  3T1X A;  1VEU A;  4FTX A;  1PRQ A;  3NUL A;  5EM0 A;  3T1R A;  3DAV A;  3T1Q B;  2VK3 A;  2ZL1 B;  2PRF A;  2PBD P;  3L7H A;  2E8J A;  1YPR A;  1Y4O A;  5FDS A;  3NEC A;  3CPT A;  3MSH A;  3CHW P;  3UB5 P;  2JKF A;  1FIK A;  1ACF A;  2ACG A;  1SZV A;  1CQA A;  4X25 A;  2B95 A;  3T1S A;  1PFL A;  2ZL1 A;  1CJF A;  2JKG A;  5EM1 A;  3D9Y A;  1D1J A;  5FEG A;  4D60 A;  3LEQ A;  1Z09 A;  1K0K A;  5EV0 A;  4ESP A;  3T12 B;  3U4L P;  1A0K A;  2V8F A;  2BTF P;  4QWO A;  1HLU P;  1J3W A;  2V8C A;  3MS6 A;  2HZ5 A;  3KYE A;  1VEU B;  4X1L A;  1G5U A;  4FUW A;  5FEF A;  1SKO B;  1FIL A;  1SKO A;  4X1M A;  1F2K A;  2PAV P;  3L9K A;  1CF0 A;  3LGO A;  1AWI A;  5EVE A;  1PNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...