2JKFA

Plasmodium falciparum profilin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
170
structure length
170
Chain Sequence
b'YSWDSYLNDRLLATNQVSGAGLASEEDGVVYACVAQGEESDPNFDKWSLFYKEDYDIEVEDENGTKTTKTINEGQTILVVFNEGYAPDGVWLGGTKYQFINIERDLEFEGYNFDVATCAKLKGGLHLVKVPGGNILVVLYDEEKEQDRGNSKIAALTFAKELAESSQLQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN
molecule tags Protein binding
source organism Plasmodium falciparum
publication title Structural Basis for Parasite-Specific Functions of the Divergent Profilin of Plasmodium Falciparum
pubmed doi rcsb
total genus 41
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2jkfA00
5EM1A 3T1RA 3LGOA 4X1LA 3MS6A 2PAVP 1PFLA 1YPRA 1D1JA 1SKOA 3L7HA 3UB5P 1SZVA 2JKFA 1CQAA 3D9YA 1VETB 2ZL1A 1Z09A 3CPTB 1ACFA 3LEQA 5EV0A 5EM0A 1J3WA 1PRQA 1HLUP 2JKGA 4ESPA 2BTFP 3U4LP 2B95A 1Y4OA 2ACGA 2VK3A 1VEUB 4QWOA 2V8CA 3KYEA 1PNEA 1FILA 5FEGA 4FTXA 1CF0A 3DAVA 3T1SA 3T1XA 3CHWP 1AWIA 5EVEA 5FDSA 1SKOB 4X25A 4FUWA 2PBDP 2E8JA 1K0KA 2PRFA 3L9KA 4D60A 1VETA 3T12B 1A0KA 3CPTA 2V8FA 2ZL1B 4X1MA 5FEFA 3MSHA 3T1QB 3NECA 3NULA 1F2KA 1FIKA 1CJFA 1G5UA 2HZ5A 1VEUA
chains in the Genus database with same CATH superfamily
3LY3A 3OLOA 1PFLA 1W8QA 3DW0A 3KSFA 4U0XA 1N9OA 5HAPA 4E3IA 3LYXA 1PWGA 1XKZA 4OPRA 1XFQA 2Y8HA 4LV3A 3C2WA 2D02A 4KUOA 4OLDA 2IWCA 2ZC4B 3PBSA 2P74A 1HTZA 4OOYA 4S2MA 5FEFA 3UB9A 1XXMA 4JGRA 1L2SA 2UV0E 2DMWA 2XR0A 3C8CA 4LV1A 3LGOA 4BLMA 2INWA 4ZBEA 5A92A 4PAUA 1KE0A 3ZQ5A 5AQAA 1EW0A 5F69A 4OPZA 1FSYA 4R0QA 1YLWA 5CTNA 3E98A 2E8JA 3BLSA 1GA9A 3E4PA 5GHZA 3VSKA 4QPRA 3BLMA 3NIAA 3UB5P 5BOHA 3TSGA 3HLBA 3VMAA 1XGIA 1VHMA 1ES4A 1J9MA 4FUWA 4P85A 1GHPA 4LRZE 3A3DA 4IBXA 4B88A 4HJ6A 2EX8A 4GW9A 1PWDA 3RTYA 1HZOA 4GN2A 5GHYA 2OAP1 4HOIA 3B47A 3LEQA 1E25A 5E2HA 5I5LA 4QWOA 3C5AA 1BYWA 1MWUA 1VM1A 2ZJ9A 3UPPA 5K5BA 4LFUA 4GKUA 5CEBA 1XX2A 2QHKA 1QMFA 2EXAA 4DDYA 1JNUA 1D1JA 1K57A 3LIBA 2JKGA 3IS2A 3DTIA 3HVFA 2HF6A 3H82A 4QU3A 3LO7A 3CUEA 4GOGA 1LI9A 2Y79A 3QP4A 3ITBA 3GSGA 1NXYA 4IUKA 4LENA 1DJCA 3CJMA 4LCLA 3IBJA 2FFYA 2R9XA 3TJZC 3FWLA 2D01A 5MC7A 3U4LP 3S22A 3MBZA 2ZC6B 1K54C 1NWZA 5CHJA 5J7EA 2QYBA 3W4OA 2DRWA 3JVUA 2DNSA 1LHYA 2V1AA 3C4PA 4E3NA 1EROA 3E2KA 1OTDA 4BMWA 1DY6A 4Y17A 5HAQA 3DWZA 2WGVA 5DVAA 2PU2A 1NRFA 3S4XA 2V20A 1K57C 3DTMA 1W5DA 4WL9A 3K2NA 2O0YA 4EXOA 4QD4A 5F1FA 3T4SA 3NOPC 1IYOA 4N92A 5FDSA 1F5MA 1KE4A 5A8BA 1LSWA 1YT4A 1NYMA 3HLGA 3MZEA 1K25A 3OBFA 3N8LA 1S0WA 2XGNA 4OPYA 3IF6B 3M2JA 4H6JA 4S2NC 2PRFA 3HJIA 3MFXA 3O5YA 3A3FA 4YINA 3LR5A 2LB9A 3RXWA 1K55A 1M40A 5CRFA 3ZHHA 5KSCA 3VV4A 4KZ5A 1U60A 3FKVA 5FQIA 3GRJA 1JWZA 3H7WB 2K7SA 1YQSA 5FL3A 4PM9A 4E3JA 5CECA 5J4EA 1LL8A 3T4KA 1PI4A 4KG6A 4KUKA 3DTEA 3SS3A 4PPRA 5HDDA 3IF6C 4BD0A 3PAGA 3E4OA 3LR3A 1SKFA 1DP9A 2V8CA 5CHMA 2WGWA 2A24A 5HSQA 3FV7A 3B33A 4KENB 4EQ1A 4EUZA 5CHUA 4CLCE 3LICA 2VKSA 3G4PA 1K6SA 4GDBA 1SDEA 4ZDXA 2VEAA 1YSPA 1Q2PA 4PKYA 1MBLA 2EX6A 4K91A 1CEFA 5FQKA 3V5MA 4ZRRA 2Z6CA 2ZQDA 3D9YA 2O99A 5HWVA 2K2NA 3BRMA 4MEZA 1H3QA 3Q7VA 3BFDA 4JF5A 1UGUA 1ERMA 4G3VA 4HHDA 4ID4A 3IHBA 5FQ9A 1WA9A 3IXDA 3F1NB 1Y54A 1S1YA 5HW3A 3CPTB 2JKRI 3QNBA 4R23A 4ESPA 3S7QA 1DP8A 5G4YA 2FZ0A 3KYZA 2HGVA 3VOLA 4RQ9A 5DTKA 4P6ZS 2JKTM 2H0TA 2XSSA 2ZQAA 3PTEA 4E3LA 5F5YA 3E4QA 1W63Q 4RX3A 5IT5A 4O0PA 1K4EA 4X1LA 2IWBA 1YKDA 4X56A 3LR0A 1K55C 4NXGA 1S66L 4BL3A 5EM0A 1OTIA 4CLCA 3TG9A 5KMWA 4E3OA 1PWCA 3R7WB 4EU0A 4WUJA 5DF9A 2Y2QA 1HVBA 3ZDJA 2C5WB 2WZZA 3DTKA 5I94A 3QNCA 4HNBA 1P9WA 4UA6A 2VV7A 3WRZA 4HP9A 2Z2LB 1ACFA 2EFUA 3D4FA 3WRTA 2FH5A 5HWTA 3D72A 2EX9A 2Y4AA 2XK1A 4RYEA 2H5SA 4OOMA 2ZM2A 5DF8A 3Q7VB 2PHYA 4M3KA 1JWPA 3UB7A 4HESA 4WELA 2VLGA 4WLAA 5HL1A 4WN5A 3W2ZA 4N1XA 2J7VA 1KGFA 4ZJ1A 1XPBA 5KSHA 1NLYA 3G30A 3IXHA 2Y2MA 4C75A 3BY8A 5FA7A 1AXBA 3NCKA 2J3TC 3O3VA 3MZFA 1T19A 1L0FA 1TF1A 5HAIA 2ZMAA 5FAOA 1Z6FA 4IJGA 4Y0OA 2WKIA 4B4XA 3TW8A 1IYSA 5KIZA 2Q9MA 5FSRA 3B42A 2LB5A 4JBFA 1C3BA 4NXBA 4F3LA 5JYOA 3IX4A 1L0DA 1L3LA 3JPUA 3Q7ZA 2XFTA 2H0YA 1NYYA 4LRXC 1HD8A 3EQUA 2ZQ9A 1NY0A 4MN6A 1K54A 3IS2B 4S2LA 3T4OA 5G18A 2JKRM 4MCWA 4OVDA 4P0MA 4Z9QA 4DF6A 1CI9A 1TEMA 2B02A 3SS4A 4WM9A 5FATA 2OLUA 3C30A 2J3WA 1V9YA 3P01A 4Q8IA 4MDZA 5EM1A 2EWVA 5M18A 2WUQA 3BW6A 3KX0X 1YAXA 2QMIA 3MXSA 4E3MA 4JXGA 4MN7A 3MFDA 4EEUA 4YNRA 3FPVA 3G6OA 4IVKA 4I5SA 2GZAA 3SH9A 2Y2GA 5DFYA 4OQGA 1ESUA 4HP4A 4JF6A 5EVIB 1GHIA 1FILA 5E2GA 2QWSA 5TJJA 3CUEC 4ETZA 1EI5A 1E4DA 4CLCB 4MBFA 3FZCA 3OC2A 5HZHA 3IH9A 1P9RA 1OJGA 5LBRA 1KGGA 2W27A 2DCFA 2VA0A 2WKQA 4MMNA 2BTFP 1FSWA 2VGLM 5HPFA 4AFIA 1G6OA 5HDCA 3T1SA 2IA2A 1G6AA 5JYPA 4JPMA 3BFFA 1JWVA 5FI2A 2V0WA 1SZVA 3OCNA 2NUTC 4R6LA 2W3FA 4JXSA 4NG2A 4EW7A 4R4RA 4JGQA 2CMNA 3H7WA 4X69A 5CXWA 2HDSA 5FAQA 4CLCC 1XFNA 1DP6A 3ULFA 4MBKA 4NXEA 1CJFA 3E2LA 2C6WB 3N6IA 1ESIA 4KZ6A 5DKLA 2UWXA 5L10A 3RXXA 3UMDA 4S2NA 3A0RA 2W3HA 3UE0A 2V8FA 1OTAA 2Y2LA 2ZMFA 4WZ4A 4GB7A 2MJ6A 1H8ZA 3D3OA 2Z6DA 1W79A 3AGDA 3HUOA 2O9AA 3PR6A 1CK3A 2K31A 3ZG5A 4KZ7A 3O88A 1H0MA 5F82A 2XA7S 2ZM0A 4BQMA 4QHCA 4KQRA 1L0GA 4PMAA 5EUAA 4DXBA 1P0ZA 4EESA 2XD5A 5DTSA 3IQAA 3IWQA 4ARZA 4F94A 3S7PA 3UO9A 4BBTA 3G2ZA 2IWDA 3MJQA 3JYIA 5DJUA 2VZWA 4KQDA 1I2WA 3O87A 4IUHA 5G4ZA 4JXVA 1YLTA 3M2KA 3OPRA 5KZHA 1K56A 4K0WA 1G28A 5CX7A 3T4JA 5AQ9A 1ERQA 2G2UA 1BSGA 1XJ2A 4KZBA 4OKPA 4DE1A 3KYEA 3UE3A 1X0OA 3HLCA 1SKOB 2GX5A 1ES3A 1XGJA 3ITAA 1LI0A 4BENA 3MQ0A 5M1AA 1VB6A 3VP3A 2O9BA 4XT2B 4NETA 4I3IA 2JE5A 2V0UA 4UHUA 1RP5A 1VQQA 2RL3A 1HLUP 2W3GA 4I39A 2PR6A 4HH3A 4MLLA 4EERA 4D60A 1DJBA 3F1OA 2XDMA 1NRJA 1IEMA 4E04A 4R3AA 1FOFA 3PBOA 3T1RA 1IYPA 2HJEA 3CWFA 1NJ4A 3BECA 4HY8A 2V9AA 3QHYA 1PI5A 4GCZA 4KZ9A 1K38A 3DAVA 1JVJA 3MSHA 5GLAA 4OQIA 4U3TA 1Q2QA 4O01A 1KE3A 1QMEA 1YLJA 4OONA 1GHMA 2KX6A 2WADA 4ETXA 5CGWA 2WAEA 2J9PA 3ICYA 4JXWA 2ZQ7A 3MKEA 4C6YA 4XUZA 3BWLA 5HPIA 5E2EA 3GR2A 1DJAA 4UEYA 4HEFA 3HLFA 5U47A 1YLPA 1Y4OA 3KSHA 3NJAA 5DF7A 3VE4A 3HLEA 1SDNA 5HWWA 4HQAA 3IWIA 3WS0A 4GNUA 4DMZA 5L8MA 5EOOA 1RGYA 2B95A 1N4OA 4XT2A 2J8YA 2VV8A 2W3EA 3IHAA 3LIAA 3IBRA 2OAQ1 1YLYA 3GQZA 4MNRA 4E6WA 4R70A 4XUXA 5TBMA 3IT9A 3RJUA 1GA0A 3VP1A 3W4QA 3HUNA 4DE0A 3ISGA 3WS1A 1ZHHB 1FQGA 4F3LB 3CHWP 4UA9A 2PT7A 4EETB 4KG2A 3PBTA 4DE2A 2A2LA 5FAPA 3G32A 3SH8A 3PBQA 1KDWA 5FDHA 2VGKA 5J3WA 3G31A 4L9GA 4EUVA 4E3KA 2W3DA 3NY4A 5FASA 3BJNA 1IKIA 2JN7A 1PNEA 4G3KA 4BL2A 2QJ5A 4GDNA 4DJ2A 1CEGA 2PBYA 5EVLA 4OLGA 1BULA 3VOYA 3CITA 5EVID 5HD3A 4I38A 5F1GA 5FEGA 4LRYC 1GCEA 3LIFA 1VETA 1IYQA 4C3QA 5FI6A 3ZG9B 4PKYG 3OZHA 4Y2FA 3CMZA 2JC7A 5M19A 4K08A 4IEDA 3ZG8B 1ES5A 4P6BA 5IS1A 2HDRA 2OWJA 3F1OB 3OPPA 4P87A 5FQJA 2J3TD 3GECA 2HPBA 2VGLS 4ZAMA 1YMXA 4NKPA 4UAAA 4A5RA 5A93A 4NK3A 1GSXA 4GHIB 4L0LA 2RCXA 4JF4A 3LUQA 5EPHA 1O07A 4GJ4A 3UY6A 4O8GA 3UDFA 4BBVA 2Y2IA 1YM1A 3HCYA 3Q07A 2CC1A 1TS6A 4G3WA 3S7NA 2Y2NA 1ZTUA 1N9BA 2HDQA 3VFHA 1I5QA 3UE1A 1A0KA 2WK0A 3KSGA 3SOIA 2Q9NA 3MR0A 3CZDA 2X71A 2Y55A 1PYYA 3BFCA 3UB8A 2JKTI 2BLSA 3IWOA 3Q81A 3VE3A 3K3DA 4WEJA 4DXCA 4RVAA 4FTXA 2ZQCA 5EVEA 4WYYA 5FI7A 2I72A 4IVIA 1T18A 5J8XA 1MKIA 2EFXA 4EEPA 5EE8A 3FYZA 2KLIA 5E2FA 2Y2HA 3GTCA 5HL6A 1S67L 4LGWA 5TFQA 4R3BA 3UE6A 1TD5A 2FFFB 3BQAA 1DRMA 1NZOA 3QP2A 3PBRA 1LL9A 1XJ3A 2B18A 2XF3A 3IXGA 4WEKA 2WKHA 4KZAA 3UPOA 3C38A 5AJGA 1I2SA 2P04A 3MQQA 2JCHA 1BLPA 5CGXA 4Z1WA 2YKFA 3IH8A 4EQIA 3A3JA 4EBNA 3T1QB 3N7WA 4UA7A 1FCOA 1KGEA 3F1PB 5F6AA 3MMHA 1PW8A 4K0XA 4JLFA 4HJ3A 2L4RA 2Y2JA 3TE8A 4E6XA 5E43A 2PU4A 3BEBA 1AWIA 3LEZA 1ODVA 4KQQA 3IX3A 2Q0OA 4X68A 1K56D 4BJPA 4CJNA 1BZAA 1W7FA 2PYRA 3U2AA 3UDIA 3P09A 2WYXA 1JTGA 3RFBA 1PZOA 3EOIA 3FG8A 3ZCZA 2QJ7A 2A49A 3BFGA 2M7VA 4ME4A 1Y28A 2R9WA 4R4SA 2HJ9C 4PHTA 2E8IA 2XFSA 4WMCA 1ONGA 3O86A 3SH7A 1SCWA 1BLCA 5EVIC 3V3SA 2ZLYA 3CPTA 1MY8A 2PDRA 2WZXA 2P08A 4DJ3A 4WZ5C 3MXRA 4R38A 5EV0A 2ZQ8A 4Q0IA 5AVFA 3MS6A 1MZUA 3M6HA 3HBRA 3N8RA 3OPLA 3IX8A 1IELA 5TR7A 2ZC3B 4IBRA 2XROA 2X02A 3K3CA 2HP6A 5AQ7A 3OCLA 5C5KA 3WS5A 3SW1A 1G5UA 1TS7A 3R4KA 4L9FA 3EWKA 1PIOA 2GDNA 1TDLA 1PRQA 1BUEA 3HUMA 1IFQA 1MPLA 3BM6A 1T1BA 2OV5A 4PM8A 2WAFA 1K0KA 3TRCA 2ZOIA 5AQBA 3QP8A 1N9LA 2G2WA 2VX8A 3G2YA 3Q1FA 4JGOA 3SS5A 1IKGA 1ALQA 1GSWA 3ZFZA 1ZC2A 2Y2PA 4Y5FA 1NLZA 1WYBA 4KZ4A 4QY5A 1W8YA 4GS9A 2J9OA 3MZDA 2W1TA 1TS0A 4NEED 3P7NA 4UQIM 1ZKJA 5DKKA 4BBUA 4ZTKA 1UWNX 1ZG6A 5A91A 3HLWA 1MWSA 5TBMB 3UPNA 4Y15A 1BLSA 5D3OA 3KSIA 2XLNA 2QZ6A 3SZTA 3A3IA 3WWXA 1RCJA 1W63M 5L07A 2L0WA 2OOLA 4II7A 4PM5A 2WGWB 3G35A 3GMWA 1F9IA 5GLCA 1WYCA 3T4QA 4FH2A 1CI8A 4JKTA 3A0VA 2JKFA 3LIDA 4OP8A 4DN0A 5FQMA 1J3WA 5IU1A 3MQOA 3BFEA 5L09A 3FC7A 1OJ5A 2Y59A 4GZBA 1O7EA 1D7EA 1XA1A 4LV0A 2PBDP 3UB6A 3MKFA 4X53A 2PYPA 2V2FF 2Y2OA 3V50A 2ZC5B 4HBTA 1H8MA 2P9VB 5HDSA 3PYPA 5CEDA 2XEPA 3VP2A 5HARA 1N9NA 2M1CA 5A90A 1JTDA 2VGJA 2O9CA 1MWRA 3BQ8A 1SHVA 3OPHA 4Y3IA 3T12B 4D2OA 3VP0A 3WS2A 4B93A 1ZG4A 2HZ5A 2XQZA 4WBGA 4QY6A 1YMSA 3V3RA 3VSLA 1L0EA 3NDEA 3S7OA 1IOUA 2Y91A 4N9KA 1XA7A 1G68A 4UQIS 5GLDA 2ACGA 5EVIA 1OTBA 4QB8A 4B9OA 3R7WA 4OQHA 4YWZA 2OLVA 4LCMA 2NUPC 2M7UA 4OPQA 4YFMA 2V1ZA 1KVLA 4Y0UA 5CTMA 1OTEA 4H6JB 2WKRA 4LLOB 3NDGA 3N4IA 4R3JA 4BD1A 5DJTA 4HH2A 4HJ4A 1KDSA 3OOVA 4O7DA 4KZ3A 3B3XA 1K6RA 1BT5A 1FR1A 3GVBA 1BTLA 3FPWA 4HIAA 2WKEA 3T4TA 2ZC7A 4NXFA 1FIKA 3PAEA 3EQVA 1ES2A 4I3JA 4FH4A 4GHIA 1Z09A 5DFXA 3EGDC 3VOZA 2ZOHA 3S1YA 2QKPA 4HBUA 3KYQA 1FCMA 1YSQA 3T4LA 3CLOA 1TS8A 4WMCD 1VEUB 1VEUA 3LI9A 2JHEA 2YKHA 3ZG0A 1H5XA 3QP5A 5CERA 4KZ8A 4WZ5A 3JVVA 2PD7A 4FSFA 3QP6A 1K4FA 2GJ3A 2XA7M 1S4SA 3C7VA 4Q0HA 2ZL1B 4L9EA 2W1TB 2BASA 2HP9A 1F2KA 2HP5A 2P7JA 4YOFA 1SKOA 2GNXA 4I3AA 1LSVA 4KG5A 4N1HA 4B4ZA 1H8YA 1LT0A 2V1BA 2VV6A 2KDKA 3QP1A 4M4XA 3W4PA 1S6RA 1S4RA 4LPZA 2G7UA 3NHQA 3H9WA 1PW1A 4FOFA 4GLQA 3HL9A 3PBNA 4HI4A 3VFFA 1PZPA 4Y7PA 2EWWA 2KOIA 5IHVA 4RA7A 4MN5A 1RGZA 3AGEA 3GV9A 3H82B 1T1CA 2R78A 3ZYTA 2WGIA 4X25A 1OPXA 3IF5A 2AVXA 4Y0TA 1TVFA 3TOIA 3LI8A 3V67A 3V39A 1NZUA 4IHQA 3KO6A 2I9VA 4X55A 1OT9A 4CPKA 3MXQA 2P9VA 5GL9A 4OH0A 1ONHA 2BG1A 3L9KA 3EEAA 2ZM8A 3CI6A 3ZG7B 2HDUA 2J80A 3A3EA 1MWTA 4Y13A 4S2IA 2EA9A 3UMEA 1M6KA 3F1PA 2ZBBA 4R1GA 1LLBA 3W8KA 5F83A 1WE4A 5AVEA 5DTTA 2L1MA 5F68A 2H28A 2OSUA 3MF0A 3P98A 1E3UA 1UWPX 3AGFA 1S1ZA 1P97A 5GHXA 5GLBA 1LSXA 4PM6A 5TGFA 4P6ZM 4QJGA 4GD6A 2W0NA 4LV2A 4S2JA 3EEHA 4PM7A 3E0YA 3GDIA 1XJ6A 3IXBA 3LR4A 4DRTA 4RX2A 1MXOA 2EXBA 3M6BA 4H8RA 4JGPA 4OP5A 1CQAA 3CAXA 2VJWA 2H10A 3NC8A 3NBLA 3Q82A 1KOUA 2A24B 2ZD8A 2XH9A 3ZVWA 4EBPA 1FR6A 5FQQA 2JBFA 3UDXA 3LFVA 3IF6A 5HFOA 4WF0A 3LY4A 1XJ4A 3BYDA 4DDSA 1YPRA 3VP4A 2ZMVA 3WS4A 1STZA 1TDGA 2QPNA 1OMEA 1D06A 3C7UA 1MC0A 3NOTC 3PXPA 3PHYA 3HREA 1FCNA 1LL5A 4S2PA 3T50A 3N8SA 4XXRA 3ZNTA 1EWZA 3I7JA 3UN7A 4X6TA 5CGSA 3L7HA 4S2KA 3A0SA 2ZL1A 4EV4A 2WKPA 4OQ0A 2Z2MB 4GS9B 4BWIA 3G34A 2PD8A 1CF0A 4EBLA 4ZJ3A 4N9LA 1GSVA 5HD5A 1YLZA 3ZVTA 5L2FA 1KVMA 3NECA 3NULA 1XP4A 3EGXC 4ZJ2A 2A3UA 3DWKA 1VETB 3CG5A 2XRNA 3NI9A 3ZNYA 4EWFA 2X01A 2VK3A 3HLDA 4S2OA 2PR5A 3F1NA 3DBAA 3LIEA 4KQOA 2HV1A 4DKIA 4DE3A 1MKMA 3NOUC 3RH8B 1E3UD 2W1RA 4X1MA 3LCEA 2PAVP 2Y2KA 5HX9A 3HJKA 2XD1A 5EFWA 4Q0JA 3UNWA 1T1AA 4CLCD 5EOEA 3ZGAB 4ARZB 1V9ZA 2EX2A 1BLHA 4FCFA 4U0TA 1F98A 1OT6A 4FD8A 4GD8A 4MBHA 3FKWA 3BY9A 3T1XA 2B5RA 2OWHA 5EECA 4CQHA 3C4OA 4OOLA
chains in the Genus database with same CATH topology
5EM1A 3T1RA 3LGOA 4X1LA 3MS6A 2PAVP 1PFLA 1YPRA 1D1JA 1SKOA 3L7HA 3UB5P 1SZVA 2JKFA 1CQAA 3D9YA 1VETB 2ZL1A 1Z09A 3CPTB 1ACFA 3LEQA 5EV0A 5EM0A 1J3WA 1PRQA 1HLUP 2JKGA 4ESPA 2BTFP 3U4LP 2B95A 1Y4OA 2ACGA 2VK3A 1VEUB 4QWOA 2V8CA 3KYEA 1PNEA 1FILA 5FEGA 4FTXA 1CF0A 3DAVA 3T1SA 3T1XA 3CHWP 1AWIA 5EVEA 5FDSA 1SKOB 4X25A 4FUWA 2PBDP 2E8JA 1K0KA 2PRFA 3L9KA 4D60A 1VETA 3T12B 1A0KA 3CPTA 2V8FA 2ZL1B 4X1MA 5FEFA 3MSHA 3T1QB 3NECA 3NULA 1F2KA 1FIKA 1CJFA 1G5UA 2HZ5A 1VEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EM1 A;  3T1R A;  3LGO A;  4X1L A;  3MS6 A;  2PAV P;  1PFL A;  1YPR A;  1D1J A;  1SKO A;  3L7H A;  3UB5 P;  1SZV A;  2JKF A;  1CQA A;  3D9Y A;  1VET B;  2ZL1 A;  1Z09 A;  3CPT B;  1ACF A;  3LEQ A;  5EV0 A;  5EM0 A;  1J3W A;  1PRQ A;  1HLU P;  2JKG A;  4ESP A;  2BTF P;  3U4L P;  2B95 A;  1Y4O A;  2ACG A;  2VK3 A;  1VEU B;  4QWO A;  2V8C A;  3KYE A;  1PNE A;  1FIL A;  5FEG A;  4FTX A;  1CF0 A;  3DAV A;  3T1S A;  3T1X A;  3CHW P;  1AWI A;  5EVE A;  5FDS A;  1SKO B;  4X25 A;  4FUW A;  2PBD P;  2E8J A;  1K0K A;  2PRF A;  3L9K A;  4D60 A;  1VET A;  3T12 B;  1A0K A;  3CPT A;  2V8F A;  2ZL1 B;  4X1M A;  5FEF A;  3MSH A;  3T1Q B;  3NEC A;  3NUL A;  1F2K A;  1FIK A;  1CJF A;  1G5U A;  2HZ5 A;  1VEU A; 
#chains in the Genus database with same CATH topology
 3LY3 A;  3OLO A;  1PFL A;  1W8Q A;  3DW0 A;  3KSF A;  4U0X A;  1N9O A;  5HAP A;  4E3I A;  3LYX A;  1PWG A;  1XKZ A;  4OPR A;  1XFQ A;  2Y8H A;  4LV3 A;  3C2W A;  2D02 A;  4KUO A;  4OLD A;  2IWC A;  2ZC4 B;  3PBS A;  2P74 A;  1HTZ A;  4OOY A;  4S2M A;  5FEF A;  3UB9 A;  1XXM A;  4JGR A;  1L2S A;  2UV0 E;  2DMW A;  2XR0 A;  3C8C A;  4LV1 A;  3LGO A;  4BLM A;  2INW A;  4ZBE A;  5A92 A;  4PAU A;  1KE0 A;  3ZQ5 A;  5AQA A;  1EW0 A;  5F69 A;  4OPZ A;  1FSY A;  4R0Q A;  1YLW A;  5CTN A;  3E98 A;  2E8J A;  3BLS A;  1GA9 A;  3E4P A;  5GHZ A;  3VSK A;  4QPR A;  3BLM A;  3NIA A;  3UB5 P;  5BOH A;  3TSG A;  3HLB A;  3VMA A;  1XGI A;  1VHM A;  1ES4 A;  1J9M A;  4FUW A;  4P85 A;  1GHP A;  4LRZ E;  3A3D A;  4IBX A;  4B88 A;  4HJ6 A;  2EX8 A;  4GW9 A;  1PWD A;  3RTY A;  1HZO A;  4GN2 A;  5GHY A;  2OAP 1;  4HOI A;  3B47 A;  3LEQ A;  1E25 A;  5E2H A;  5I5L A;  4QWO A;  3C5A A;  1BYW A;  1MWU A;  1VM1 A;  2ZJ9 A;  3UPP A;  5K5B A;  4LFU A;  4GKU A;  5CEB A;  1XX2 A;  2QHK A;  1QMF A;  2EXA A;  4DDY A;  1JNU A;  1D1J A;  1K57 A;  3LIB A;  2JKG A;  3IS2 A;  3DTI A;  3HVF A;  2HF6 A;  3H82 A;  4QU3 A;  3LO7 A;  3CUE A;  4GOG A;  1LI9 A;  2Y79 A;  3QP4 A;  3ITB A;  3GSG A;  1NXY A;  4IUK A;  4LEN A;  1DJC A;  3CJM A;  4LCL A;  3IBJ A;  2FFY A;  2R9X A;  3TJZ C;  3FWL A;  2D01 A;  5MC7 A;  3U4L P;  3S22 A;  3MBZ A;  2ZC6 B;  1K54 C;  1NWZ A;  5CHJ A;  5J7E A;  2QYB A;  3W4O A;  2DRW A;  3JVU A;  2DNS A;  1LHY A;  2V1A A;  3C4P A;  4E3N A;  1ERO A;  3E2K A;  1OTD A;  4BMW A;  1DY6 A;  4Y17 A;  5HAQ A;  3DWZ A;  2WGV A;  5DVA A;  2PU2 A;  1NRF A;  3S4X A;  2V20 A;  1K57 C;  3DTM A;  1W5D A;  4WL9 A;  3K2N A;  2O0Y A;  4EXO A;  4QD4 A;  5F1F A;  3T4S A;  3NOP C;  1IYO A;  4N92 A;  5FDS A;  1F5M A;  1KE4 A;  5A8B A;  1LSW A;  1YT4 A;  1NYM A;  3HLG A;  3MZE A;  1K25 A;  3OBF A;  3N8L A;  1S0W A;  2XGN A;  4OPY A;  3IF6 B;  3M2J A;  4H6J A;  4S2N C;  2PRF A;  3HJI A;  3MFX A;  3O5Y A;  3A3F A;  4YIN A;  3LR5 A;  2LB9 A;  3RXW A;  1K55 A;  1M40 A;  5CRF A;  3ZHH A;  5KSC A;  3VV4 A;  4KZ5 A;  1U60 A;  3FKV A;  5FQI A;  3GRJ A;  1JWZ A;  3H7W B;  2K7S A;  1YQS A;  5FL3 A;  4PM9 A;  4E3J A;  5CEC A;  5J4E A;  1LL8 A;  3T4K A;  1PI4 A;  4KG6 A;  4KUK A;  3DTE A;  3SS3 A;  4PPR A;  5HDD A;  3IF6 C;  4BD0 A;  3PAG A;  3E4O A;  3LR3 A;  1SKF A;  1DP9 A;  2V8C A;  5CHM A;  2WGW A;  2A24 A;  5HSQ A;  3FV7 A;  3B33 A;  4KEN B;  4EQ1 A;  4EUZ A;  5CHU A;  4CLC E;  3LIC A;  2VKS A;  3G4P A;  1K6S A;  4GDB A;  1SDE A;  4ZDX A;  2VEA A;  1YSP A;  1Q2P A;  4PKY A;  1MBL A;  2EX6 A;  4K91 A;  1CEF A;  5FQK A;  3V5M A;  4ZRR A;  2Z6C A;  2ZQD A;  3D9Y A;  2O99 A;  5HWV A;  2K2N A;  3BRM A;  4MEZ A;  1H3Q A;  3Q7V A;  3BFD A;  4JF5 A;  1UGU A;  1ERM A;  4G3V A;  4HHD A;  4ID4 A;  3IHB A;  5FQ9 A;  1WA9 A;  3IXD A;  3F1N B;  1Y54 A;  1S1Y A;  5HW3 A;  3CPT B;  2JKR I;  3QNB A;  4R23 A;  4ESP A;  3S7Q A;  1DP8 A;  5G4Y A;  2FZ0 A;  3KYZ A;  2HGV A;  3VOL A;  4RQ9 A;  5DTK A;  4P6Z S;  2JKT M;  2H0T A;  2XSS A;  2ZQA A;  3PTE A;  4E3L A;  5F5Y A;  3E4Q A;  1W63 Q;  4RX3 A;  5IT5 A;  4O0P A;  1K4E A;  4X1L A;  2IWB A;  1YKD A;  4X56 A;  3LR0 A;  1K55 C;  4NXG A;  1S66 L;  4BL3 A;  5EM0 A;  1OTI A;  4CLC A;  3TG9 A;  5KMW A;  4E3O A;  1PWC A;  3R7W B;  4EU0 A;  4WUJ A;  5DF9 A;  2Y2Q A;  1HVB A;  3ZDJ A;  2C5W B;  2WZZ A;  3DTK A;  5I94 A;  3QNC A;  4HNB A;  1P9W A;  4UA6 A;  2VV7 A;  3WRZ A;  4HP9 A;  2Z2L B;  1ACF A;  2EFU A;  3D4F A;  3WRT A;  2FH5 A;  5HWT A;  3D72 A;  2EX9 A;  2Y4A A;  2XK1 A;  4RYE A;  2H5S A;  4OOM A;  2ZM2 A;  5DF8 A;  3Q7V B;  2PHY A;  4M3K A;  1JWP A;  3UB7 A;  4HES A;  4WEL A;  2VLG A;  4WLA A;  5HL1 A;  4WN5 A;  3W2Z A;  4N1X A;  2J7V A;  1KGF A;  4ZJ1 A;  1XPB A;  5KSH A;  1NLY A;  3G30 A;  3IXH A;  2Y2M A;  4C75 A;  3BY8 A;  5FA7 A;  1AXB A;  3NCK A;  2J3T C;  3O3V A;  3MZF A;  1T19 A;  1L0F A;  1TF1 A;  5HAI A;  2ZMA A;  5FAO A;  1Z6F A;  4IJG A;  4Y0O A;  2WKI A;  4B4X A;  3TW8 A;  1IYS A;  5KIZ A;  2Q9M A;  5FSR A;  3B42 A;  2LB5 A;  4JBF A;  1C3B A;  4NXB A;  4F3L A;  5JYO A;  3IX4 A;  1L0D A;  1L3L A;  3JPU A;  3Q7Z A;  2XFT A;  2H0Y A;  1NYY A;  4LRX C;  1HD8 A;  3EQU A;  2ZQ9 A;  1NY0 A;  4MN6 A;  1K54 A;  3IS2 B;  4S2L A;  3T4O A;  5G18 A;  2JKR M;  4MCW A;  4OVD A;  4P0M A;  4Z9Q A;  4DF6 A;  1CI9 A;  1TEM A;  2B02 A;  3SS4 A;  4WM9 A;  5FAT A;  2OLU A;  3C30 A;  2J3W A;  1V9Y A;  3P01 A;  4Q8I A;  4MDZ A;  5EM1 A;  2EWV A;  5M18 A;  2WUQ A;  3BW6 A;  3KX0 X;  1YAX A;  2QMI A;  3MXS A;  4E3M A;  4JXG A;  4MN7 A;  3MFD A;  4EEU A;  4YNR A;  3FPV A;  3G6O A;  4IVK A;  4I5S A;  2GZA A;  3SH9 A;  2Y2G A;  5DFY A;  4OQG A;  1ESU A;  4HP4 A;  4JF6 A;  5EVI B;  1GHI A;  1FIL A;  5E2G A;  2QWS A;  5TJJ A;  3CUE C;  4ETZ A;  1EI5 A;  1E4D A;  4CLC B;  4MBF A;  3FZC A;  3OC2 A;  5HZH A;  3IH9 A;  1P9R A;  1OJG A;  5LBR A;  1KGG A;  2W27 A;  2DCF A;  2VA0 A;  2WKQ A;  4MMN A;  2BTF P;  1FSW A;  2VGL M;  5HPF A;  4AFI A;  1G6O A;  5HDC A;  3T1S A;  2IA2 A;  1G6A A;  5JYP A;  4JPM A;  3BFF A;  1JWV A;  5FI2 A;  2V0W A;  1SZV A;  3OCN A;  2NUT C;  4R6L A;  2W3F A;  4JXS A;  4NG2 A;  4EW7 A;  4R4R A;  4JGQ A;  2CMN A;  3H7W A;  4X69 A;  5CXW A;  2HDS A;  5FAQ A;  4CLC C;  1XFN A;  1DP6 A;  3ULF A;  4MBK A;  4NXE A;  1CJF A;  3E2L A;  2C6W B;  3N6I A;  1ESI A;  4KZ6 A;  5DKL A;  2UWX A;  5L10 A;  3RXX A;  3UMD A;  4S2N A;  3A0R A;  2W3H A;  3UE0 A;  2V8F A;  1OTA A;  2Y2L A;  2ZMF A;  4WZ4 A;  4GB7 A;  2MJ6 A;  1H8Z A;  3D3O A;  2Z6D A;  1W79 A;  3AGD A;  3HUO A;  2O9A A;  3PR6 A;  1CK3 A;  2K31 A;  3ZG5 A;  4KZ7 A;  3O88 A;  1H0M A;  5F82 A;  2XA7 S;  2ZM0 A;  4BQM A;  4QHC A;  4KQR A;  1L0G A;  4PMA A;  5EUA A;  4DXB A;  1P0Z A;  4EES A;  2XD5 A;  5DTS A;  3IQA A;  3IWQ A;  4ARZ A;  4F94 A;  3S7P A;  3UO9 A;  4BBT A;  3G2Z A;  2IWD A;  3MJQ A;  3JYI A;  5DJU A;  2VZW A;  4KQD A;  1I2W A;  3O87 A;  4IUH A;  5G4Z A;  4JXV A;  1YLT A;  3M2K A;  3OPR A;  5KZH A;  1K56 A;  4K0W A;  1G28 A;  5CX7 A;  3T4J A;  5AQ9 A;  1ERQ A;  2G2U A;  1BSG A;  1XJ2 A;  4KZB A;  4OKP A;  4DE1 A;  3KYE A;  3UE3 A;  1X0O A;  3HLC A;  1SKO B;  2GX5 A;  1ES3 A;  1XGJ A;  3ITA A;  1LI0 A;  4BEN A;  3MQ0 A;  5M1A A;  1VB6 A;  3VP3 A;  2O9B A;  4XT2 B;  4NET A;  4I3I A;  2JE5 A;  2V0U A;  4UHU A;  1RP5 A;  1VQQ A;  2RL3 A;  1HLU P;  2W3G A;  4I39 A;  2PR6 A;  4HH3 A;  4MLL A;  4EER A;  4D60 A;  1DJB A;  3F1O A;  2XDM A;  1NRJ A;  1IEM A;  4E04 A;  4R3A A;  1FOF A;  3PBO A;  3T1R A;  1IYP A;  2HJE A;  3CWF A;  1NJ4 A;  3BEC A;  4HY8 A;  2V9A A;  3QHY A;  1PI5 A;  4GCZ A;  4KZ9 A;  1K38 A;  3DAV A;  1JVJ A;  3MSH A;  5GLA A;  4OQI A;  4U3T A;  1Q2Q A;  4O01 A;  1KE3 A;  1QME A;  1YLJ A;  4OON A;  1GHM A;  2KX6 A;  2WAD A;  4ETX A;  5CGW A;  2WAE A;  2J9P A;  3ICY A;  4JXW A;  2ZQ7 A;  3MKE A;  4C6Y A;  4XUZ A;  3BWL A;  5HPI A;  5E2E A;  3GR2 A;  1DJA A;  4UEY A;  4HEF A;  3HLF A;  5U47 A;  1YLP A;  1Y4O A;  3KSH A;  3NJA A;  5DF7 A;  3VE4 A;  3HLE A;  1SDN A;  5HWW A;  4HQA A;  3IWI A;  3WS0 A;  4GNU A;  4DMZ A;  5L8M A;  5EOO A;  1RGY A;  2B95 A;  1N4O A;  4XT2 A;  2J8Y A;  2VV8 A;  2W3E A;  3IHA A;  3LIA A;  3IBR A;  2OAQ 1;  1YLY A;  3GQZ A;  4MNR A;  4E6W A;  4R70 A;  4XUX A;  5TBM A;  3IT9 A;  3RJU A;  1GA0 A;  3VP1 A;  3W4Q A;  3HUN A;  4DE0 A;  3ISG A;  3WS1 A;  1ZHH B;  1FQG A;  4F3L B;  3CHW P;  4UA9 A;  2PT7 A;  4EET B;  4KG2 A;  3PBT A;  4DE2 A;  2A2L A;  5FAP A;  3G32 A;  3SH8 A;  3PBQ A;  1KDW A;  5FDH A;  2VGK A;  5J3W A;  3G31 A;  4L9G A;  4EUV A;  4E3K A;  2W3D A;  3NY4 A;  5FAS A;  3BJN A;  1IKI A;  2JN7 A;  1PNE A;  4G3K A;  4BL2 A;  2QJ5 A;  4GDN A;  4DJ2 A;  1CEG A;  2PBY A;  5EVL A;  4OLG A;  1BUL A;  3VOY A;  3CIT A;  5EVI D;  5HD3 A;  4I38 A;  5F1G A;  5FEG A;  4LRY C;  1GCE A;  3LIF A;  1VET A;  1IYQ A;  4C3Q A;  5FI6 A;  3ZG9 B;  4PKY G;  3OZH A;  4Y2F A;  3CMZ A;  2JC7 A;  5M19 A;  4K08 A;  4IED A;  3ZG8 B;  1ES5 A;  4P6B A;  5IS1 A;  2HDR A;  2OWJ A;  3F1O B;  3OPP A;  4P87 A;  5FQJ A;  2J3T D;  3GEC A;  2HPB A;  2VGL S;  4ZAM A;  1YMX A;  4NKP A;  4UAA A;  4A5R A;  5A93 A;  4NK3 A;  1GSX A;  4GHI B;  4L0L A;  2RCX A;  4JF4 A;  3LUQ A;  5EPH A;  1O07 A;  4GJ4 A;  3UY6 A;  4O8G A;  3UDF A;  4BBV A;  2Y2I A;  1YM1 A;  3HCY A;  3Q07 A;  2CC1 A;  1TS6 A;  4G3W A;  3S7N A;  2Y2N A;  1ZTU A;  1N9B A;  2HDQ A;  3VFH A;  1I5Q A;  3UE1 A;  1A0K A;  2WK0 A;  3KSG A;  3SOI A;  2Q9N A;  3MR0 A;  3CZD A;  2X71 A;  2Y55 A;  1PYY A;  3BFC A;  3UB8 A;  2JKT I;  2BLS A;  3IWO A;  3Q81 A;  3VE3 A;  3K3D A;  4WEJ A;  4DXC A;  4RVA A;  4FTX A;  2ZQC A;  5EVE A;  4WYY A;  5FI7 A;  2I72 A;  4IVI A;  1T18 A;  5J8X A;  1MKI A;  2EFX A;  4EEP A;  5EE8 A;  3FYZ A;  2KLI A;  5E2F A;  2Y2H A;  3GTC A;  5HL6 A;  1S67 L;  4LGW A;  5TFQ A;  4R3B A;  3UE6 A;  1TD5 A;  2FFF B;  3BQA A;  1DRM A;  1NZO A;  3QP2 A;  3PBR A;  1LL9 A;  1XJ3 A;  2B18 A;  2XF3 A;  3IXG A;  4WEK A;  2WKH A;  4KZA A;  3UPO A;  3C38 A;  5AJG A;  1I2S A;  2P04 A;  3MQQ A;  2JCH A;  1BLP A;  5CGX A;  4Z1W A;  2YKF A;  3IH8 A;  4EQI A;  3A3J A;  4EBN A;  3T1Q B;  3N7W A;  4UA7 A;  1FCO A;  1KGE A;  3F1P B;  5F6A A;  3MMH A;  1PW8 A;  4K0X A;  4JLF A;  4HJ3 A;  2L4R A;  2Y2J A;  3TE8 A;  4E6X A;  5E43 A;  2PU4 A;  3BEB A;  1AWI A;  3LEZ A;  1ODV A;  4KQQ A;  3IX3 A;  2Q0O A;  4X68 A;  1K56 D;  4BJP A;  4CJN A;  1BZA A;  1W7F A;  2PYR A;  3U2A A;  3UDI A;  3P09 A;  2WYX A;  1JTG A;  3RFB A;  1PZO A;  3EOI A;  3FG8 A;  3ZCZ A;  2QJ7 A;  2A49 A;  3BFG A;  2M7V A;  4ME4 A;  1Y28 A;  2R9W A;  4R4S A;  2HJ9 C;  4PHT A;  2E8I A;  2XFS A;  4WMC A;  1ONG A;  3O86 A;  3SH7 A;  1SCW A;  1BLC A;  5EVI C;  3V3S A;  2ZLY A;  3CPT A;  1MY8 A;  2PDR A;  2WZX A;  2P08 A;  4DJ3 A;  4WZ5 C;  3MXR A;  4R38 A;  5EV0 A;  2ZQ8 A;  4Q0I A;  5AVF A;  3MS6 A;  1MZU A;  3M6H A;  3HBR A;  3N8R A;  3OPL A;  3IX8 A;  1IEL A;  5TR7 A;  2ZC3 B;  4IBR A;  2XRO A;  2X02 A;  3K3C A;  2HP6 A;  5AQ7 A;  3OCL A;  5C5K A;  3WS5 A;  3SW1 A;  1G5U A;  1TS7 A;  3R4K A;  4L9F A;  3EWK A;  1PIO A;  2GDN A;  1TDL A;  1PRQ A;  1BUE A;  3HUM A;  1IFQ A;  1MPL A;  3BM6 A;  1T1B A;  2OV5 A;  4PM8 A;  2WAF A;  1K0K A;  3TRC A;  2ZOI A;  5AQB A;  3QP8 A;  1N9L A;  2G2W A;  2VX8 A;  3G2Y A;  3Q1F A;  4JGO A;  3SS5 A;  1IKG A;  1ALQ A;  1GSW A;  3ZFZ A;  1ZC2 A;  2Y2P A;  4Y5F A;  1NLZ A;  1WYB A;  4KZ4 A;  4QY5 A;  1W8Y A;  4GS9 A;  2J9O A;  3MZD A;  2W1T A;  1TS0 A;  4NEE D;  3P7N A;  4UQI M;  1ZKJ A;  5DKK A;  4BBU A;  4ZTK A;  1UWN X;  1ZG6 A;  5A91 A;  3HLW A;  1MWS A;  5TBM B;  3UPN A;  4Y15 A;  1BLS A;  5D3O A;  3KSI A;  2XLN A;  2QZ6 A;  3SZT A;  3A3I A;  3WWX A;  1RCJ A;  1W63 M;  5L07 A;  2L0W A;  2OOL A;  4II7 A;  4PM5 A;  2WGW B;  3G35 A;  3GMW A;  1F9I A;  5GLC A;  1WYC A;  3T4Q A;  4FH2 A;  1CI8 A;  4JKT A;  3A0V A;  2JKF A;  3LID A;  4OP8 A;  4DN0 A;  5FQM A;  1J3W A;  5IU1 A;  3MQO A;  3BFE A;  5L09 A;  3FC7 A;  1OJ5 A;  2Y59 A;  4GZB A;  1O7E A;  1D7E A;  1XA1 A;  4LV0 A;  2PBD P;  3UB6 A;  3MKF A;  4X53 A;  2PYP A;  2V2F F;  2Y2O A;  3V50 A;  2ZC5 B;  4HBT A;  1H8M A;  2P9V B;  5HDS A;  3PYP A;  5CED A;  2XEP A;  3VP2 A;  5HAR A;  1N9N A;  2M1C A;  5A90 A;  1JTD A;  2VGJ A;  2O9C A;  1MWR A;  3BQ8 A;  1SHV A;  3OPH A;  4Y3I A;  3T12 B;  4D2O A;  3VP0 A;  3WS2 A;  4B93 A;  1ZG4 A;  2HZ5 A;  2XQZ A;  4WBG A;  4QY6 A;  1YMS A;  3V3R A;  3VSL A;  1L0E A;  3NDE A;  3S7O A;  1IOU A;  2Y91 A;  4N9K A;  1XA7 A;  1G68 A;  4UQI S;  5GLD A;  2ACG A;  5EVI A;  1OTB A;  4QB8 A;  4B9O A;  3R7W A;  4OQH A;  4YWZ A;  2OLV A;  4LCM A;  2NUP C;  2M7U A;  4OPQ A;  4YFM A;  2V1Z A;  1KVL A;  4Y0U A;  5CTM A;  1OTE A;  4H6J B;  2WKR A;  4LLO B;  3NDG A;  3N4I A;  4R3J A;  4BD1 A;  5DJT A;  4HH2 A;  4HJ4 A;  1KDS A;  3OOV A;  4O7D A;  4KZ3 A;  3B3X A;  1K6R A;  1BT5 A;  1FR1 A;  3GVB A;  1BTL A;  3FPW A;  4HIA A;  2WKE A;  3T4T A;  2ZC7 A;  4NXF A;  1FIK A;  3PAE A;  3EQV A;  1ES2 A;  4I3J A;  4FH4 A;  4GHI A;  1Z09 A;  5DFX A;  3EGD C;  3VOZ A;  2ZOH A;  3S1Y A;  2QKP A;  4HBU A;  3KYQ A;  1FCM A;  1YSQ A;  3T4L A;  3CLO A;  1TS8 A;  4WMC D;  1VEU B;  1VEU A;  3LI9 A;  2JHE A;  2YKH A;  3ZG0 A;  1H5X A;  3QP5 A;  5CER A;  4KZ8 A;  4WZ5 A;  3JVV A;  2PD7 A;  4FSF A;  3QP6 A;  1K4F A;  2GJ3 A;  2XA7 M;  1S4S A;  3C7V A;  4Q0H A;  2ZL1 B;  4L9E A;  2W1T B;  2BAS A;  2HP9 A;  1F2K A;  2HP5 A;  2P7J A;  4YOF A;  1SKO A;  2GNX A;  4I3A A;  1LSV A;  4KG5 A;  4N1H A;  4B4Z A;  1H8Y A;  1LT0 A;  2V1B A;  2VV6 A;  2KDK A;  3QP1 A;  4M4X A;  3W4P A;  1S6R A;  1S4R A;  4LPZ A;  2G7U A;  3NHQ A;  3H9W A;  1PW1 A;  4FOF A;  4GLQ A;  3HL9 A;  3PBN A;  4HI4 A;  3VFF A;  1PZP A;  4Y7P A;  2EWW A;  2KOI A;  5IHV A;  4RA7 A;  4MN5 A;  1RGZ A;  3AGE A;  3GV9 A;  3H82 B;  1T1C A;  2R78 A;  3ZYT A;  2WGI A;  4X25 A;  1OPX A;  3IF5 A;  2AVX A;  4Y0T A;  1TVF A;  3TOI A;  3LI8 A;  3V67 A;  3V39 A;  1NZU A;  4IHQ A;  3KO6 A;  2I9V A;  4X55 A;  1OT9 A;  4CPK A;  3MXQ A;  2P9V A;  5GL9 A;  4OH0 A;  1ONH A;  2BG1 A;  3L9K A;  3EEA A;  2ZM8 A;  3CI6 A;  3ZG7 B;  2HDU A;  2J80 A;  3A3E A;  1MWT A;  4Y13 A;  4S2I A;  2EA9 A;  3UME A;  1M6K A;  3F1P A;  2ZBB A;  4R1G A;  1LLB A;  3W8K A;  5F83 A;  1WE4 A;  5AVE A;  5DTT A;  2L1M A;  5F68 A;  2H28 A;  2OSU A;  3MF0 A;  3P98 A;  1E3U A;  1UWP X;  3AGF A;  1S1Z A;  1P97 A;  5GHX A;  5GLB A;  1LSX A;  4PM6 A;  5TGF A;  4P6Z M;  4QJG A;  4GD6 A;  2W0N A;  4LV2 A;  4S2J A;  3EEH A;  4PM7 A;  3E0Y A;  3GDI A;  1XJ6 A;  3IXB A;  3LR4 A;  4DRT A;  4RX2 A;  1MXO A;  2EXB A;  3M6B A;  4H8R A;  4JGP A;  4OP5 A;  1CQA A;  3CAX A;  2VJW A;  2H10 A;  3NC8 A;  3NBL A;  3Q82 A;  1KOU A;  2A24 B;  2ZD8 A;  2XH9 A;  3ZVW A;  4EBP A;  1FR6 A;  5FQQ A;  2JBF A;  3UDX A;  3LFV A;  3IF6 A;  5HFO A;  4WF0 A;  3LY4 A;  1XJ4 A;  3BYD A;  4DDS A;  1YPR A;  3VP4 A;  2ZMV A;  3WS4 A;  1STZ A;  1TDG A;  2QPN A;  1OME A;  1D06 A;  3C7U A;  1MC0 A;  3NOT C;  3PXP A;  3PHY A;  3HRE A;  1FCN A;  1LL5 A;  4S2P A;  3T50 A;  3N8S A;  4XXR A;  3ZNT A;  1EWZ A;  3I7J A;  3UN7 A;  4X6T A;  5CGS A;  3L7H A;  4S2K A;  3A0S A;  2ZL1 A;  4EV4 A;  2WKP A;  4OQ0 A;  2Z2M B;  4GS9 B;  4BWI A;  3G34 A;  2PD8 A;  1CF0 A;  4EBL A;  4ZJ3 A;  4N9L A;  1GSV A;  5HD5 A;  1YLZ A;  3ZVT A;  5L2F A;  1KVM A;  3NEC A;  3NUL A;  1XP4 A;  3EGX C;  4ZJ2 A;  2A3U A;  3DWK A;  1VET B;  3CG5 A;  2XRN A;  3NI9 A;  3ZNY A;  4EWF A;  2X01 A;  2VK3 A;  3HLD A;  4S2O A;  2PR5 A;  3F1N A;  3DBA A;  3LIE A;  4KQO A;  2HV1 A;  4DKI A;  4DE3 A;  1MKM A;  3NOU C;  3RH8 B;  1E3U D;  2W1R A;  4X1M A;  3LCE A;  2PAV P;  2Y2K A;  5HX9 A;  3HJK A;  2XD1 A;  5EFW A;  4Q0J A;  3UNW A;  1T1A A;  4CLC D;  5EOE A;  3ZGA B;  4ARZ B;  1V9Z A;  2EX2 A;  1BLH A;  4FCF A;  4U0T A;  1F98 A;  1OT6 A;  4FD8 A;  4GD8 A;  4MBH A;  3FKW A;  3BY9 A;  3T1X A;  2B5R A;  2OWH A;  5EEC A;  4CQH A;  3C4O A;  4OOL A; 
#chains in the Genus database with same CATH homology
 5EM1 A;  3T1R A;  3LGO A;  4X1L A;  3MS6 A;  2PAV P;  1PFL A;  1YPR A;  1D1J A;  1SKO A;  3L7H A;  3UB5 P;  1SZV A;  2JKF A;  1CQA A;  3D9Y A;  1VET B;  2ZL1 A;  1Z09 A;  3CPT B;  1ACF A;  3LEQ A;  5EV0 A;  5EM0 A;  1J3W A;  1PRQ A;  1HLU P;  2JKG A;  4ESP A;  2BTF P;  3U4L P;  2B95 A;  1Y4O A;  2ACG A;  2VK3 A;  1VEU B;  4QWO A;  2V8C A;  3KYE A;  1PNE A;  1FIL A;  5FEG A;  4FTX A;  1CF0 A;  3DAV A;  3T1S A;  3T1X A;  3CHW P;  1AWI A;  5EVE A;  5FDS A;  1SKO B;  4X25 A;  4FUW A;  2PBD P;  2E8J A;  1K0K A;  2PRF A;  3L9K A;  4D60 A;  1VET A;  3T12 B;  1A0K A;  3CPT A;  2V8F A;  2ZL1 B;  4X1M A;  5FEF A;  3MSH A;  3T1Q B;  3NEC A;  3NUL A;  1F2K A;  1FIK A;  1CJF A;  1G5U A;  2HZ5 A;  1VEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...