2JKFA

Plasmodium falciparum profilin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
170
structure length
170
Chain Sequence
b'YSWDSYLNDRLLATNQVSGAGLASEEDGVVYACVAQGEESDPNFDKWSLFYKEDYDIEVEDENGTKTTKTINEGQTILVVFNEGYAPDGVWLGGTKYQFINIERDLEFEGYNFDVATCAKLKGGLHLVKVPGGNILVVLYDEEKEQDRGNSKIAALTFAKELAESSQLQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN
publication title Structural Basis for Parasite-Specific Functions of the Divergent Profilin of Plasmodium Falciparum
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Protein binding
total genus 41
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2jkfA00
3UB5P 2VK3A 4X1MA 1G5UA 1PNEA 3L9KA 1HLUP 3CPTA 1D1JA 4FUWA 2BTFP 1SKOB 4X25A 1AWIA 1SZVA 5FEFA 3LGOA 2PAVP 2JKFA 1Z09A 4D60A 1VETA 2HZ5A 3T12B 5FEGA 2PRFA 3MS6A 2ZL1A 1ACFA 2V8FA 1VEUA 1A0KA 3CHWP 3CPTB 2V8CA 1YPRA 5EM0A 2PBDP 3LEQA 5EM1A 5FDSA 1F2KA 3MSHA 2ACGA 3T1SA 4ESPA 1VETB 3KYEA 2ZL1B 1K0KA 5EV0A 1CF0A 1VEUB 4X1LA 1FIKA 4QWOA 3NULA 1PFLA 3T1QB 1J3WA 1FILA 1CJFA 4FTXA 1PRQA 3T1RA 2B95A 3DAVA 3NECA 1CQAA 1Y4OA 2JKGA 3T1XA 3D9YA 1SKOA 2E8JA 5EVEA 3U4LP 3L7HA
chains in the Genus database with same CATH superfamily
3LYXA 1S0WA 1OT9A 4JBFA 2P7JA 4IJGA 3ZG0A 3MQ0A 3HVFA 4LV2A 1BLPA 3CPTA 1IOUA 4FUWA 1VHMA 4FD8A 3TSGA 2C6WB 3W8KA 4EETB 1XJ6A 4PKYG 3P01A 2JCHA 1XJ3A 4JGOA 4DJ3A 4DE1A 3LY4A 2WZZA 1BLCA 3T12B 4S2JA 3GRJA 3FG8A 4NG2A 2W1TA 3N8LA 1XA7A 3FV7A 3C4OA 4ETXA 2QJ7A 2HJ9C 1K56D 4IEDA 1DP9A 3VP4A 1D06A 3HLEA 2B5RA 4HOIA 3BWLA 4EUZA 5HWVA 3T1SA 3T4LA 1L0FA 3GDIA 4X69A 3MKFA 3P7NA 3EOIA 2GZAA 4OOLA 3U2AA 3UDFA 4QWOA 1W63Q 4K08A 4G3WA 2OWJA 4RX2A 2Y2QA 3UB9A 2HPBA 1OPXA 4OLGA 4NKPA 2X01A 4CLCB 3R7WB 3VFFA 4EXOA 4KZ9A 1E4DA 5GLAA 1FSWA 3VOYA 1C3BA 4MBKA 3PBTA 2IA2A 2P04A 4OOMA 1ALQA 1XKZA 5M1AA 3L7HA 3NHQA 3RJUA 5IT5A 4GZBA 3LICA 3SZTA 2PU4A 2KLIA 2G2UA 2IWBA 1EW0A 4GN2A 1PNEA 1IEMA 3KO6A 2EXBA 4C6YA 4B93A 1GSWA 1T1CA 5G4YA 5MC7A 3F1OB 1PWGA 1YMXA 5DKLA 4R3AA 4P0MA 4D60A 3OPPA 2Z2LB 3EQVA 4GS9B 2R9WA 3CHWP 3IF5A 3IS2B 4N1HA 1K55C 2HJEA 2WYXA 3ZG5A 5FAOA 1X0OA 3E2KA 3LCEA 4O01A 4QJGA 4EWFA 1PWDA 5F5YA 1G6AA 1OTAA 1M40A 3WWXA 3OPHA 4JXGA 3BJNA 5CEDA 4G3KA 4BJPA 4K0WA 3AGFA 3IWOA 1P97A 5DJTA 1CF0A 1N4OA 1G28A 4X1LA 5HSQA 4II7A 3ZGAB 5F1FA 4JF5A 1S4SA 4KENB 4F3LB 1MKIA 2JBFA 1Y28A 1CI8A 4P85A 2HDUA 2PDRA 3G32A 3T4KA 2WKRA 1GCEA 2Y2OA 4N92A 2NUTC 1PW1A 3TG9A 3OBFA 1XX2A 2QYBA 4OPYA 4DE2A 2W3FA 3NOPC 3QHYA 1GHPA 3BRMA 5EFWA 5CGXA 3K3DA 1GSVA 2B18A 5JYOA 3ZCZA 3QP8A 4JLFA 4MMNA 4C3QA 4E04A 3PR6A 1BLHA 1K57C 3GQZA 1D7EA 2JKTM 1YLWA 3IH8A 5GLDA 4RQ9A 2W3EA 1LI9A 3Q1FA 2RL3A 4IUHA 3UNWA 3MXRA 2Y91A 3HREA 1V9ZA 4KZ7A 2W3GA 4S2NC 1SDEA 2ZL1A 3S4XA 2GDNA 3UB7A 4X56A 2CC1A 3MQQA 4FCFA 3SS3A 1WYCA 2VV6A 2ZJ9A 4DE3A 2Y2HA 3IF6A 4L9EA 3UPPA 3UB8A 3CUEA 1W8QA 2WUQA 2H0TA 1JTDA 1ESUA 3VP0A 1S67L 3EQUA 5AJGA 4LPZA 2O9BA 5GLCA 1OTEA 4N9LA 2Y2PA 5TBMA 3PTEA 1WYBA 4DDYA 3JVUA 5FQ9A 2XF3A 1BTLA 1J3WA 2JN7A 4MLLA 1FILA 2J8YA 3HLBA 1DJCA 3TOIA 2A24A 3JPUA 3VSKA 3B3XA 5GHXA 3BQAA 1H5XA 2P74A 5DTKA 2Z6CA 1LSXA 4Y15A 4BBUA 4P6BA 4HY8A 5HWTA 1IYPA 5M18A 1MY8A 3A3FA 4E3NA 4JKTA 3IHAA 3C38A 2XROA 4X1MA 5AQBA 3C8CA 4OP5A 2W0NA 4LCLA 1ZG4A 2P9VB 1MC0A 2JHEA 3H82B 4U3TA 3WS5A 4QY5A 4R4RA 3LGOA 4WM9A 4NXBA 3A3JA 1TEMA 2PU2A 2KDKA 3KYZA 5BOHA 1Y54A 4NK3A 3O86A 5DVAA 4LGWA 1IYQA 5EM0A 4KUKA 1QMEA 5EM1A 3N8RA 1F98A 3O87A 1FR6A 5F6AA 2XK1A 2Y2GA 4P6ZS 3BFFA 3LIAA 2EFXA 4R1GA 4XUZA 1OJGA 1OTDA 5CTNA 1RCJA 2LB5A 2VA0A 3CJMA 3MZDA 3DTMA 4KG6A 3GSGA 1BLSA 1J9MA 2L0WA 1K6SA 4B4XA 4L0LA 4MN6A 5E2FA 2EX9A 2Y2JA 3VOZA 1NYYA 2V1ZA 3EGDC 2LB9A 4GLQA 4GDBA 4YNRA 4MN7A 3LIEA 4PM5A 2AVXA 2YKFA 3Q7ZA 4GD8A 1KVLA 4QHCA 5CHJA 2PYRA 1MWTA 3OOVA 1PZPA 1Z6FA 2ZOHA 4WZ5C 3UE1A 4Q8IA 2FZ0A 2M7UA 2PAVP 3BM6A 5A92A 3F1NB 4ZAMA 3G31A 4HJ4A 4Q0HA 5FQJA 4DN0A 4UHUA 5J3WA 4EV4A 2JE5A 4S2KA 3Q81A 4HEFA 2ZBBA 1LLBA 1KGGA 1HTZA 1MWRA 3B33A 1YLZA 2YKHA 2V9AA 3QP6A 3G34A 3RTYA 5EECA 4CLCA 3R7WA 1VEUB 4WEKA 5AVFA 2V0WA 4Y13A 2XH9A 4DKIA 3VFHA 4K91A 5KIZA 5E2GA 4WMCD 3MFXA 2H28A 3UN7A 3LEZA 1PRQA 1VM1A 4LLOB 3SH9A 2ZC3B 1ZHHB 2WKEA 2WKPA 2ZQAA 4O7DA 3ZYTA 4U0TA 4PM7A 4DE0A 4GOGA 1XFQA 4GD6A 1NRFA 1DP8A 3BLSA 1MKMA 1OT6A 3U4LP 4OONA 2R78A 2PD8A 1DJBA 2ZLYA 2DMWA 3SH7A 5FSRA 1YLJA 4GS9A 4E3MA 1HLUP 2A49A 4MBFA 1D1JA 4NETA 2XA7M 1TVFA 1PWCA 2H5SA 2PR6A 2QHKA 4ZDXA 4U0XA 1S1YA 3E98A 3KSHA 3MXSA 1V9YA 2O9AA 1Z09A 3A3DA 3IBJA 3NC8A 4LENA 1ACFA 3BECA 3BY8A 4N1XA 5HPIA 3ITBA 1H8MA 2Y55A 3VMAA 1K56A 5HL1A 5HX9A 1MXOA 1ESIA 3LEQA 4F3LA 4OPRA 3OPRA 3D3OA 2J3WA 4LRZE 2ZQ7A 5L2FA 2WADA 3ICYA 3H7WA 4RYEA 1XJ4A 1ZG6A 5GL9A 2ZC4B 1VQQA 3V67A 3NOTC 5E2EA 3S7OA 3Q07A 2UWXA 4P6ZM 1W5DA 3E4PA 1YKDA 2WGIA 2NUPC 3T4OA 4RX3A 5KZHA 1FQGA 2VV7A 2OAQ1 3HL9A 1TS7A 4KQOA 3QNBA 3CLOA 1YM1A 3M2JA 3T4TA 3TE8A 3QP2A 1RGZA 3BW6A 3UO9A 3BFEA 5G18A 2HP9A 5A8BA 2G2WA 3HLCA 4BD1A 1KDWA 4KQDA 1ERQA 2BTFP 3HLGA 3S1YA 3MMHA 2G7UA 4Y0UA 4EUVA 4X25A 5F1GA 4EW7A 3LO7A 5HZHA 1XPBA 3AGEA 4HH3A 3R4KA 2ZMFA 3OZHA 4OVDA 1IELA 2I72A 1TS0A 5DFYA 1YPRA 4DF6A 3DBAA 2DNSA 4GDNA 3FYZA 1K55A 5CERA 3BFCA 3N8SA 1VETB 4HIAA 4EERA 2R9XA 1UGUA 4WBGA 1FCOA 4H8RA 4UQIS 1P0ZA 5CXWA 2OAP1 4YINA 2Y2LA 1K25A 4LV0A 5EVIC 3TW8A 5M19A 3LIBA 3HJIA 1P9WA 4S2OA 1HZOA 5CRFA 3PYPA 2OOLA 5EVID 3VP3A 3M6HA 4QD4A 1NLZA 1OJ5A 2MJ6A 4KUOA 1DP6A 3FKVA 1NZOA 3IBRA 3VE4A 4MDZA 2JKRM 3DAVA 4OPZA 2BLSA 5LBRA 1CQAA 4LCMA 1JWZA 4GHIB 5GLBA 3C2WA 3H82A 3BFDA 2E8JA 2XD5A 3Q7VB 4N9KA 1XFNA 5HARA 5GHYA 2PHYA 4DXCA 1W8YA 4CLCE 1G5UA 4OPQA 3IH9A 1PZOA 3MZFA 3UDXA 2Y8HA 4EQIA 5CX7A 1K57A 1YSPA 5L09A 4DXBA 1DRMA 3B42A 5GHZA 3UE3A 3UE6A 5HAPA 1ZKJA 3FZCA 4BENA 4NEED 5HDDA 3PBQA 3V3SA 1DY6A 1S4RA 4S2NA 2V8FA 2GNXA 5DFXA 3ZVWA 2V8CA 1G6OA 2J9OA 4WL9A 4WZ4A 3VV4A 3DW0A 2QPNA 2L1MA 4QPRA 3FPVA 3MXQA 2W1RA 3MFDA 1ONGA 4ME4A 2KX6A 3CG5A 1TD5A 2UV0E 5L10A 5KSHA 3O88A 2QMIA 3M6BA 1HVBA 5CHUA 1YMSA 2EXAA 3WRTA 2ZD8A 3C4PA 2VZWA 4UEYA 1IKIA 4YOFA 4BD0A 2ZC5B 2OV5A 1LL8A 4S2PA 4OQ0A 5TJJA 3T4SA 3HJKA 1BT5A 3ZG8B 5HD3A 4KG5A 5KMWA 2Y4AA 5HDSA 3PXPA 1K54C 5FDHA 5EVEA 5EVIB 4UA6A 2VV8A 1KVMA 1E25A 3F1NA 3ULFA 4DJ2A 4EQ1A 5HPFA 3NY4A 1L2SA 1ES3A 3NDGA 4HESA 3WS2A 3CZDA 4RA7A 2B02A 3CI6A 1HD8A 4GJ4A 3LI9A 1SKOB 5CECA 3CUEC 1E3UD 4IVKA 3G2ZA 1OTIA 4PM8A 5CGSA 5FEFA 2O99A 3K3CA 2XA7S 3ZQ5A 4E3IA 1YSQA 3C7VA 4EBPA 5FAQA 1EROA 4Z1WA 5I94A 3MQOA 4OLDA 4AFIA 5J7EA 2OLUA 1VEUA 5F69A 4Z9QA 2HP5A 1PI5A 3SS4A 1T18A 3HCYA 5CHMA 5A91A 4OOYA 1I2SA 4BWIA 2H0YA 4CPKA 2INWA 3NJAA 5FDSA 5EE8A 3MSHA 4KZ3A 1NYMA 4BQMA 4ESPA 3NBLA 3OC2A 3V50A 5FI7A 5EV0A 4KZAA 4HBUA 5F83A 2HDQA 4Y3IA 3LR3A 4I5SA 4MNRA 3G2YA 3LR4A 2K31A 4UQIM 4CJNA 3V39A 1NWZA 1YLTA 2FFYA 2WZXA 2EX6A 4L9GA 5DKKA 2K2NA 4BL2A 1H8ZA 4E6WA 1YLYA 5IS1A 3GTCA 4JGPA 2ZMVA 3DTEA 4YWZA 3VP1A 3LIFA 3MR0A 4JXWA 2J9PA 1SCWA 3IWIA 1W63M 2ZM0A 3E4QA 4A5RA 1N9OA 4LV3A 5FI2A 4GB7A 3P98A 3E2LA 3EEAA 5HAIA 4GCZA 1FSYA 3HUNA 2XRNA 1DJAA 3MZEA 3Q82A 2FFFB 2JKRI 4S2LA 1OMEA 4WZ5A 1ZTUA 4ZBEA 3LFVA 2Q9MA 2DCFA 3CWFA 5J4EA 1NY0A 4IBRA 4OQGA 3IQAA 4XUXA 3JYIA 4P87A 1H0MA 1TDLA 5CEBA 3IF6B 5IU1A 5HAQA 4K0XA 3MKEA 4PMAA 3LI8A 2M7VA 2ZMAA 2I9VA 1KE4A 3KYEA 5C5KA 4UAAA 4HI4A 4PM6A 4I39A 3UB6A 4PAUA 4KG2A 4KZ6A 5L07A 3MJQA 4WMCA 3G6OA 4OQHA 1RGYA 4I3JA 3T1QB 2JKTI 2D01A 4Y5FA 3CITA 1LT0A 2WGVA 3PBNA 4ZJ2A 2A24B 3JVVA 4FTXA 3EEHA 4E3OA 4ARZB 5FI6A 3HLWA 5IHVA 3T1RA 3W4PA 3ZFZA 2JKGA 4OP8A 4R0QA 1N9BA 4NXGA 4ZRRA 1YAXA 1JWVA 2WGWB 3LR5A 1KE3A 5D3OA 3ZVTA 2X02A 3VSLA 3KYQA 1N9LA 3UB5P 4HBTA 2OLVA 1PI4A 2HF6A 1STZA 3IT9A 4O8GA 1JWPA 5FL3A 4DDSA 3UDIA 3SH8A 2OWHA 4IVIA 3NI9A 3LR0A 2RCXA 3W2ZA 1CK3A 4HNBA 5I5LA 3UMDA 4MN5A 2A3UA 2X71A 3IXGA 4IHQA 3F1OA 4IBXA 4R6LA 1VETA 3HUMA 3IX4A 2L4RA 3A0SA 4ZJ1A 2XEPA 5HWWA 3A3EA 4YFMA 3E0YA 3H9WA 3ZNTA 2ZQDA 2ZM2A 3IS2A 1ES5A 4DMZA 4BLMA 1XGJA 3OLOA 2Y59A 3RXXA 2EFUA 2C5WB 4OKPA 4X68A 3UE0A 4MEZA 1T1BA 2Y79A 2ZQ9A 3MBZA 3K2NA 3IXHA 2FH5A 5CGWA 4X6TA 5EOOA 1GA9A 3WRZA 1WA9A 1EWZA 4Y0OA 3Q7VA 3IHBA 2VGLS 1ES4A 1SKFA 4LFUA 4Y2FA 3LUQA 3PAEA 4X53A 3GECA 4H6JB 4S2MA 3NDEA 2XD1A 2XSSA 1H8YA 3IX3A 3BFGA 4WF0A 2XFSA 4D2OA 2XLNA 5TR7A 4WLAA 4HJ3A 3VP2A 1JVJA 1F9IA 2WK0A 3C30A 1U60A 1SHVA 4PKYA 2HDSA 2V20A 3RFBA 4R4SA 5DTSA 3ZHHA 3ZG9B 4IUKA 5A93A 3OCLA 2CMNA 4Y17A 2HZ5A 1W79A 1GHMA 1LHYA 2ZC6B 4RVAA 3CMZA 1BSGA 3F1PB 4E3LA 4EU0A 2KOIA 2WAEA 1L0GA 4KQRA 3UPOA 1LL5A 4FOFA 2QKPA 3V5MA 2QZ6A 2Z6DA 5AQ9A 2Y2NA 2DRWA 5HW3A 3GV9A 4I3AA 3IX8A 3M2KA 4Y0TA 2EA9A 2ZQ8A 1FCNA 5EVIA 2VGJA 1MWUA 3BEBA 3S7QA 3MF0A 1TS6A 2GJ3A 3HLFA 1NLYA 4WELA 1N9NA 2B95A 4QU3A 4MCWA 4JF6A 1PYYA 4JXSA 3WS4A 1M6KA 1MWSA 1SKOA 1FOFA 1YQSA 4HQAA 4XT2B 2V1AA 1ODVA 4F94A 4FSFA 2VK3A 1L3LA 2ZOIA 2OSUA 5U47A 3CAXA 3DTKA 2H10A 5E43A 3FKWA 3D4FA 3PBSA 5K5BA 4EBLA 4NXEA 1K4FA 1IYOA 2P9VA 3DWKA 3G30A 3HBRA 4PPRA 2WKHA 3VOLA 2ZM8A 2V2FF 4WUJA 2JKFA 5HL6A 3I7JA 3NCKA 2QJ5A 5HD5A 2XGNA 4KZ4A 1EI5A 4ZJ3A 3D72A 4GNUA 5A90A 4L9FA 3CPTB 3C7UA 3EWKA 4X55A 4JF4A 3O5YA 4I3IA 2VEAA 1WE4A 5AQAA 3QNCA 5FQKA 1F2KA 2W3HA 2HP6A 3TJZC 4R23A 4R3JA 1FCMA 1K0KA 5EPHA 2W1TB 4HH2A 3KX0X 3H7WB 1LI0A 1I5QA 3P09A 2M1CA 2PBYA 2WKQA 5L8MA 3T4QA 2BG1A 1ZC2A 4R38A 1W7FA 4XXRA 5FQMA 3S22A 3SW1A 4HHDA 2A2LA 3QP5A 1L0EA 1T19A 1NXYA 1GA0A 1KGFA 3RXWA 3V3RA 1XP4A 1ERMA 3OCNA 3N7WA 3ZNYA 2VGLM 2BASA 2O9CA 4MBHA 3ZG7B 4R3BA 1K4EA 3PBRA 3VE3A 3KSGA 1XA1A 4PM9A 1MPLA 5FATA 1GSXA 1K54A 3PBOA 2K7SA 2W27A 2Y2IA 1O7EA 2EWVA 2GX5A 4UA7A 5FQIA 1E3UA 4BBVA 4Q0JA 4UA9A 4LV1A 3BLMA 5DJUA 1KE0A 4DRTA 3KSIA 3SS5A 4HP9A 1JTGA 4ID4A 3UY6A 4KZ8A 3DTIA 5DF8A 1GHIA 5FEGA 2ZQCA 4BL3A 4JPMA 3MS6A 3LY3A 1G68A 3T4JA 3B47A 5DF9A 3IF6C 1LSVA 3PHYA 4WN5A 4WEJA 4ETZA 2ACGA 4JGRA 1BULA 2HGVA 4FH2A 4ARZA 2Z2MB 1OTBA 1TDGA 2E8IA 3ZDJA 3DWZA 5FAPA 4ZTKA 1O07A 3HUOA 1YT4A 2WGWA 4Q0IA 1BZAA 4BBTA 3IXDA 1PFLA 3KSFA 3UMEA 1MZUA 2XDMA 3WS0A 1PW8A 5CTMA 5KSCA 3FC7A 1K38A 4M4XA 2HDRA 3T1XA 4OH0A 3D9YA 2ZC7A 3G35A 3ISGA 1CI9A 2Y2MA 4LRXC 2HV1A 5E2HA 3E4OA 2Q9NA 4B9OA 5F82A 3SOIA 4QY6A 2PD7A 4Y7PA 1NRJA 4EESA 2XQZA 1YLPA 3A0VA 3LIDA 5EVLA 5DF7A 4B88A 2VX8A 3FWLA 4E3JA 3PAGA 3G4PA 3T50A 2VKSA 5TGFA 2VLGA 4HJ6A 2XR0A 2Q0OA 3N4IA 1Q2PA 3AGDA 5FA7A 1UWNX 1UWPX 1S6RA 3IWQA 2EX8A 1A0KA 2VJWA 5DTTA 5EUAA 4M3KA 1MBLA 3GMWA 1JNUA 4E3KA 4LRYC 1L0DA 2WAFA 1KOUA 1CEGA 2V1BA 3NOUC 4EEUA 2EWWA 2IWDA 2D02A 4JGQA 2JC7A 2ZL1B 3QP1A 5AQ7A 4HP4A 2IWCA 3W4OA 3O3VA 4H6JA 1KGEA 1S66L 3S7NA 1VB6A 5FQQA 1K6RA 1Q2QA 2J80A 1XXMA 4PHTA 1NJ4A 3A3IA 2EX2A 5EOEA 1TF1A 3IXBA 1CJFA 1BUEA 1XGIA 4CQHA 2PR5A 3S7PA 1Y4OA 3FPWA 5JYPA 4KQQA 2QWSA 2J7VA 4NXFA 5TBMB 1S1ZA 3N6IA 1TS8A 4O0PA 1H3QA 5F68A 3BY9A 3L9KA 1PIOA 2P08A 3UPNA 3QP4A 1LSWA 5HFOA 1RP5A 3F1PA 3C5AA 4GW9A 1AWIA 1SZVA 4S2IA 1IKGA 3GR2A 1ES2A 2PYPA 2PRFA 4WYYA 1ONHA 3RH8B 4E6XA 3OPLA 3NIAA 3TRCA 3BYDA 4OQIA 4BMWA 2Y2KA 4EEPA 2VGKA 2PBDP 1F5MA 1XJ2A 4C75A 1FR1A 2J3TC 3GVBA 2V0UA 5J8XA 4R70A 3EGXC 1P9RA 4CLCC 5AVEA 1NZUA 2W3DA 2O0YA 2XFTA 1IFQA 2J3TD 3ITAA 1FIKA 3BQ8A 3HLDA 2PT7A 4CLCD 3W4QA 1KDSA 1AXBA 3NULA 4XT2A 5G4ZA 5HDCA 5TFQA 4FH4A 1T1AA 1I2WA 1IYSA 3WS1A 4B4ZA 1QMFA 4QB8A 4G3VA 1BYWA 1CEFA 3A0RA 4GKUA 3NECA 4KZBA 1LL9A 5FASA 4GHIA 4JXVA 4EBNA 2WKIA 1SDNA 4KZ5A 4I38A
chains in the Genus database with same CATH topology
3UB5P 2VK3A 4X1MA 1G5UA 1PNEA 3L9KA 1HLUP 3CPTA 1D1JA 4FUWA 2BTFP 1SKOB 4X25A 1AWIA 1SZVA 5FEFA 3LGOA 2PAVP 2JKFA 1Z09A 4D60A 1VETA 2HZ5A 3T12B 5FEGA 2PRFA 3MS6A 2ZL1A 1ACFA 2V8FA 1VEUA 1A0KA 3CHWP 3CPTB 2V8CA 1YPRA 5EM0A 2PBDP 3LEQA 5EM1A 5FDSA 1F2KA 3MSHA 2ACGA 3T1SA 4ESPA 1VETB 3KYEA 2ZL1B 1K0KA 5EV0A 1CF0A 1VEUB 4X1LA 1FIKA 4QWOA 3NULA 1PFLA 3T1QB 1J3WA 1FILA 1CJFA 4FTXA 1PRQA 3T1RA 2B95A 3DAVA 3NECA 1CQAA 1Y4OA 2JKGA 3T1XA 3D9YA 1SKOA 2E8JA 5EVEA 3U4LP 3L7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UB5 P;  2VK3 A;  4X1M A;  1G5U A;  1PNE A;  3L9K A;  1HLU P;  3CPT A;  1D1J A;  4FUW A;  2BTF P;  1SKO B;  4X25 A;  1AWI A;  1SZV A;  5FEF A;  3LGO A;  2PAV P;  2JKF A;  1Z09 A;  4D60 A;  1VET A;  2HZ5 A;  3T12 B;  5FEG A;  2PRF A;  3MS6 A;  2ZL1 A;  1ACF A;  2V8F A;  1VEU A;  1A0K A;  3CHW P;  3CPT B;  2V8C A;  1YPR A;  5EM0 A;  2PBD P;  3LEQ A;  5EM1 A;  5FDS A;  1F2K A;  3MSH A;  2ACG A;  3T1S A;  4ESP A;  1VET B;  3KYE A;  2ZL1 B;  1K0K A;  5EV0 A;  1CF0 A;  1VEU B;  4X1L A;  1FIK A;  4QWO A;  3NUL A;  1PFL A;  3T1Q B;  1J3W A;  1FIL A;  1CJF A;  4FTX A;  1PRQ A;  3T1R A;  2B95 A;  3DAV A;  3NEC A;  1CQA A;  1Y4O A;  2JKG A;  3T1X A;  3D9Y A;  1SKO A;  2E8J A;  5EVE A;  3U4L P;  3L7H A; 
#chains in the Genus database with same CATH topology
 3LYX A;  1S0W A;  1OT9 A;  4JBF A;  2P7J A;  4IJG A;  3ZG0 A;  3MQ0 A;  3HVF A;  4LV2 A;  1BLP A;  3CPT A;  1IOU A;  4FUW A;  1VHM A;  4FD8 A;  3TSG A;  2C6W B;  3W8K A;  4EET B;  1XJ6 A;  4PKY G;  3P01 A;  2JCH A;  1XJ3 A;  4JGO A;  4DJ3 A;  4DE1 A;  3LY4 A;  2WZZ A;  1BLC A;  3T12 B;  4S2J A;  3GRJ A;  3FG8 A;  4NG2 A;  2W1T A;  3N8L A;  1XA7 A;  3FV7 A;  3C4O A;  4ETX A;  2QJ7 A;  2HJ9 C;  1K56 D;  4IED A;  1DP9 A;  3VP4 A;  1D06 A;  3HLE A;  2B5R A;  4HOI A;  3BWL A;  4EUZ A;  5HWV A;  3T1S A;  3T4L A;  1L0F A;  3GDI A;  4X69 A;  3MKF A;  3P7N A;  3EOI A;  2GZA A;  4OOL A;  3U2A A;  3UDF A;  4QWO A;  1W63 Q;  4K08 A;  4G3W A;  2OWJ A;  4RX2 A;  2Y2Q A;  3UB9 A;  2HPB A;  1OPX A;  4OLG A;  4NKP A;  2X01 A;  4CLC B;  3R7W B;  3VFF A;  4EXO A;  4KZ9 A;  1E4D A;  5GLA A;  1FSW A;  3VOY A;  1C3B A;  4MBK A;  3PBT A;  2IA2 A;  2P04 A;  4OOM A;  1ALQ A;  1XKZ A;  5M1A A;  3L7H A;  3NHQ A;  3RJU A;  5IT5 A;  4GZB A;  3LIC A;  3SZT A;  2PU4 A;  2KLI A;  2G2U A;  2IWB A;  1EW0 A;  4GN2 A;  1PNE A;  1IEM A;  3KO6 A;  2EXB A;  4C6Y A;  4B93 A;  1GSW A;  1T1C A;  5G4Y A;  5MC7 A;  3F1O B;  1PWG A;  1YMX A;  5DKL A;  4R3A A;  4P0M A;  4D60 A;  3OPP A;  2Z2L B;  3EQV A;  4GS9 B;  2R9W A;  3CHW P;  3IF5 A;  3IS2 B;  4N1H A;  1K55 C;  2HJE A;  2WYX A;  3ZG5 A;  5FAO A;  1X0O A;  3E2K A;  3LCE A;  4O01 A;  4QJG A;  4EWF A;  1PWD A;  5F5Y A;  1G6A A;  1OTA A;  1M40 A;  3WWX A;  3OPH A;  4JXG A;  3BJN A;  5CED A;  4G3K A;  4BJP A;  4K0W A;  3AGF A;  3IWO A;  1P97 A;  5DJT A;  1CF0 A;  1N4O A;  1G28 A;  4X1L A;  5HSQ A;  4II7 A;  3ZGA B;  5F1F A;  4JF5 A;  1S4S A;  4KEN B;  4F3L B;  1MKI A;  2JBF A;  1Y28 A;  1CI8 A;  4P85 A;  2HDU A;  2PDR A;  3G32 A;  3T4K A;  2WKR A;  1GCE A;  2Y2O A;  4N92 A;  2NUT C;  1PW1 A;  3TG9 A;  3OBF A;  1XX2 A;  2QYB A;  4OPY A;  4DE2 A;  2W3F A;  3NOP C;  3QHY A;  1GHP A;  3BRM A;  5EFW A;  5CGX A;  3K3D A;  1GSV A;  2B18 A;  5JYO A;  3ZCZ A;  3QP8 A;  4JLF A;  4MMN A;  4C3Q A;  4E04 A;  3PR6 A;  1BLH A;  1K57 C;  3GQZ A;  1D7E A;  2JKT M;  1YLW A;  3IH8 A;  5GLD A;  4RQ9 A;  2W3E A;  1LI9 A;  3Q1F A;  2RL3 A;  4IUH A;  3UNW A;  3MXR A;  2Y91 A;  3HRE A;  1V9Z A;  4KZ7 A;  2W3G A;  4S2N C;  1SDE A;  2ZL1 A;  3S4X A;  2GDN A;  3UB7 A;  4X56 A;  2CC1 A;  3MQQ A;  4FCF A;  3SS3 A;  1WYC A;  2VV6 A;  2ZJ9 A;  4DE3 A;  2Y2H A;  3IF6 A;  4L9E A;  3UPP A;  3UB8 A;  3CUE A;  1W8Q A;  2WUQ A;  2H0T A;  1JTD A;  1ESU A;  3VP0 A;  1S67 L;  3EQU A;  5AJG A;  4LPZ A;  2O9B A;  5GLC A;  1OTE A;  4N9L A;  2Y2P A;  5TBM A;  3PTE A;  1WYB A;  4DDY A;  3JVU A;  5FQ9 A;  2XF3 A;  1BTL A;  1J3W A;  2JN7 A;  4MLL A;  1FIL A;  2J8Y A;  3HLB A;  1DJC A;  3TOI A;  2A24 A;  3JPU A;  3VSK A;  3B3X A;  5GHX A;  3BQA A;  1H5X A;  2P74 A;  5DTK A;  2Z6C A;  1LSX A;  4Y15 A;  4BBU A;  4P6B A;  4HY8 A;  5HWT A;  1IYP A;  5M18 A;  1MY8 A;  3A3F A;  4E3N A;  4JKT A;  3IHA A;  3C38 A;  2XRO A;  4X1M A;  5AQB A;  3C8C A;  4OP5 A;  2W0N A;  4LCL A;  1ZG4 A;  2P9V B;  1MC0 A;  2JHE A;  3H82 B;  4U3T A;  3WS5 A;  4QY5 A;  4R4R A;  3LGO A;  4WM9 A;  4NXB A;  3A3J A;  1TEM A;  2PU2 A;  2KDK A;  3KYZ A;  5BOH A;  1Y54 A;  4NK3 A;  3O86 A;  5DVA A;  4LGW A;  1IYQ A;  5EM0 A;  4KUK A;  1QME A;  5EM1 A;  3N8R A;  1F98 A;  3O87 A;  1FR6 A;  5F6A A;  2XK1 A;  2Y2G A;  4P6Z S;  3BFF A;  3LIA A;  2EFX A;  4R1G A;  4XUZ A;  1OJG A;  1OTD A;  5CTN A;  1RCJ A;  2LB5 A;  2VA0 A;  3CJM A;  3MZD A;  3DTM A;  4KG6 A;  3GSG A;  1BLS A;  1J9M A;  2L0W A;  1K6S A;  4B4X A;  4L0L A;  4MN6 A;  5E2F A;  2EX9 A;  2Y2J A;  3VOZ A;  1NYY A;  2V1Z A;  3EGD C;  2LB9 A;  4GLQ A;  4GDB A;  4YNR A;  4MN7 A;  3LIE A;  4PM5 A;  2AVX A;  2YKF A;  3Q7Z A;  4GD8 A;  1KVL A;  4QHC A;  5CHJ A;  2PYR A;  1MWT A;  3OOV A;  1PZP A;  1Z6F A;  2ZOH A;  4WZ5 C;  3UE1 A;  4Q8I A;  2FZ0 A;  2M7U A;  2PAV P;  3BM6 A;  5A92 A;  3F1N B;  4ZAM A;  3G31 A;  4HJ4 A;  4Q0H A;  5FQJ A;  4DN0 A;  4UHU A;  5J3W A;  4EV4 A;  2JE5 A;  4S2K A;  3Q81 A;  4HEF A;  2ZBB A;  1LLB A;  1KGG A;  1HTZ A;  1MWR A;  3B33 A;  1YLZ A;  2YKH A;  2V9A A;  3QP6 A;  3G34 A;  3RTY A;  5EEC A;  4CLC A;  3R7W A;  1VEU B;  4WEK A;  5AVF A;  2V0W A;  4Y13 A;  2XH9 A;  4DKI A;  3VFH A;  4K91 A;  5KIZ A;  5E2G A;  4WMC D;  3MFX A;  2H28 A;  3UN7 A;  3LEZ A;  1PRQ A;  1VM1 A;  4LLO B;  3SH9 A;  2ZC3 B;  1ZHH B;  2WKE A;  2WKP A;  2ZQA A;  4O7D A;  3ZYT A;  4U0T A;  4PM7 A;  4DE0 A;  4GOG A;  1XFQ A;  4GD6 A;  1NRF A;  1DP8 A;  3BLS A;  1MKM A;  1OT6 A;  3U4L P;  4OON A;  2R78 A;  2PD8 A;  1DJB A;  2ZLY A;  2DMW A;  3SH7 A;  5FSR A;  1YLJ A;  4GS9 A;  4E3M A;  1HLU P;  2A49 A;  4MBF A;  1D1J A;  4NET A;  2XA7 M;  1TVF A;  1PWC A;  2H5S A;  2PR6 A;  2QHK A;  4ZDX A;  4U0X A;  1S1Y A;  3E98 A;  3KSH A;  3MXS A;  1V9Y A;  2O9A A;  1Z09 A;  3A3D A;  3IBJ A;  3NC8 A;  4LEN A;  1ACF A;  3BEC A;  3BY8 A;  4N1X A;  5HPI A;  3ITB A;  1H8M A;  2Y55 A;  3VMA A;  1K56 A;  5HL1 A;  5HX9 A;  1MXO A;  1ESI A;  3LEQ A;  4F3L A;  4OPR A;  3OPR A;  3D3O A;  2J3W A;  4LRZ E;  2ZQ7 A;  5L2F A;  2WAD A;  3ICY A;  3H7W A;  4RYE A;  1XJ4 A;  1ZG6 A;  5GL9 A;  2ZC4 B;  1VQQ A;  3V67 A;  3NOT C;  5E2E A;  3S7O A;  3Q07 A;  2UWX A;  4P6Z M;  1W5D A;  3E4P A;  1YKD A;  2WGI A;  2NUP C;  3T4O A;  4RX3 A;  5KZH A;  1FQG A;  2VV7 A;  2OAQ 1;  3HL9 A;  1TS7 A;  4KQO A;  3QNB A;  3CLO A;  1YM1 A;  3M2J A;  3T4T A;  3TE8 A;  3QP2 A;  1RGZ A;  3BW6 A;  3UO9 A;  3BFE A;  5G18 A;  2HP9 A;  5A8B A;  2G2W A;  3HLC A;  4BD1 A;  1KDW A;  4KQD A;  1ERQ A;  2BTF P;  3HLG A;  3S1Y A;  3MMH A;  2G7U A;  4Y0U A;  4EUV A;  4X25 A;  5F1G A;  4EW7 A;  3LO7 A;  5HZH A;  1XPB A;  3AGE A;  4HH3 A;  3R4K A;  2ZMF A;  3OZH A;  4OVD A;  1IEL A;  2I72 A;  1TS0 A;  5DFY A;  1YPR A;  4DF6 A;  3DBA A;  2DNS A;  4GDN A;  3FYZ A;  1K55 A;  5CER A;  3BFC A;  3N8S A;  1VET B;  4HIA A;  4EER A;  2R9X A;  1UGU A;  4WBG A;  1FCO A;  4H8R A;  4UQI S;  1P0Z A;  5CXW A;  2OAP 1;  4YIN A;  2Y2L A;  1K25 A;  4LV0 A;  5EVI C;  3TW8 A;  5M19 A;  3LIB A;  3HJI A;  1P9W A;  4S2O A;  1HZO A;  5CRF A;  3PYP A;  2OOL A;  5EVI D;  3VP3 A;  3M6H A;  4QD4 A;  1NLZ A;  1OJ5 A;  2MJ6 A;  4KUO A;  1DP6 A;  3FKV A;  1NZO A;  3IBR A;  3VE4 A;  4MDZ A;  2JKR M;  3DAV A;  4OPZ A;  2BLS A;  5LBR A;  1CQA A;  4LCM A;  1JWZ A;  4GHI B;  5GLB A;  3C2W A;  3H82 A;  3BFD A;  2E8J A;  2XD5 A;  3Q7V B;  4N9K A;  1XFN A;  5HAR A;  5GHY A;  2PHY A;  4DXC A;  1W8Y A;  4CLC E;  1G5U A;  4OPQ A;  3IH9 A;  1PZO A;  3MZF A;  3UDX A;  2Y8H A;  4EQI A;  5CX7 A;  1K57 A;  1YSP A;  5L09 A;  4DXB A;  1DRM A;  3B42 A;  5GHZ A;  3UE3 A;  3UE6 A;  5HAP A;  1ZKJ A;  3FZC A;  4BEN A;  4NEE D;  5HDD A;  3PBQ A;  3V3S A;  1DY6 A;  1S4R A;  4S2N A;  2V8F A;  2GNX A;  5DFX A;  3ZVW A;  2V8C A;  1G6O A;  2J9O A;  4WL9 A;  4WZ4 A;  3VV4 A;  3DW0 A;  2QPN A;  2L1M A;  4QPR A;  3FPV A;  3MXQ A;  2W1R A;  3MFD A;  1ONG A;  4ME4 A;  2KX6 A;  3CG5 A;  1TD5 A;  2UV0 E;  5L10 A;  5KSH A;  3O88 A;  2QMI A;  3M6B A;  1HVB A;  5CHU A;  1YMS A;  2EXA A;  3WRT A;  2ZD8 A;  3C4P A;  2VZW A;  4UEY A;  1IKI A;  4YOF A;  4BD0 A;  2ZC5 B;  2OV5 A;  1LL8 A;  4S2P A;  4OQ0 A;  5TJJ A;  3T4S A;  3HJK A;  1BT5 A;  3ZG8 B;  5HD3 A;  4KG5 A;  5KMW A;  2Y4A A;  5HDS A;  3PXP A;  1K54 C;  5FDH A;  5EVE A;  5EVI B;  4UA6 A;  2VV8 A;  1KVM A;  1E25 A;  3F1N A;  3ULF A;  4DJ2 A;  4EQ1 A;  5HPF A;  3NY4 A;  1L2S A;  1ES3 A;  3NDG A;  4HES A;  3WS2 A;  3CZD A;  4RA7 A;  2B02 A;  3CI6 A;  1HD8 A;  4GJ4 A;  3LI9 A;  1SKO B;  5CEC A;  3CUE C;  1E3U D;  4IVK A;  3G2Z A;  1OTI A;  4PM8 A;  5CGS A;  5FEF A;  2O99 A;  3K3C A;  2XA7 S;  3ZQ5 A;  4E3I A;  1YSQ A;  3C7V A;  4EBP A;  5FAQ A;  1ERO A;  4Z1W A;  5I94 A;  3MQO A;  4OLD A;  4AFI A;  5J7E A;  2OLU A;  1VEU A;  5F69 A;  4Z9Q A;  2HP5 A;  1PI5 A;  3SS4 A;  1T18 A;  3HCY A;  5CHM A;  5A91 A;  4OOY A;  1I2S A;  4BWI A;  2H0Y A;  4CPK A;  2INW A;  3NJA A;  5FDS A;  5EE8 A;  3MSH A;  4KZ3 A;  1NYM A;  4BQM A;  4ESP A;  3NBL A;  3OC2 A;  3V50 A;  5FI7 A;  5EV0 A;  4KZA A;  4HBU A;  5F83 A;  2HDQ A;  4Y3I A;  3LR3 A;  4I5S A;  4MNR A;  3G2Y A;  3LR4 A;  2K31 A;  4UQI M;  4CJN A;  3V39 A;  1NWZ A;  1YLT A;  2FFY A;  2WZX A;  2EX6 A;  4L9G A;  5DKK A;  2K2N A;  4BL2 A;  1H8Z A;  4E6W A;  1YLY A;  5IS1 A;  3GTC A;  4JGP A;  2ZMV A;  3DTE A;  4YWZ A;  3VP1 A;  3LIF A;  3MR0 A;  4JXW A;  2J9P A;  1SCW A;  3IWI A;  1W63 M;  2ZM0 A;  3E4Q A;  4A5R A;  1N9O A;  4LV3 A;  5FI2 A;  4GB7 A;  3P98 A;  3E2L A;  3EEA A;  5HAI A;  4GCZ A;  1FSY A;  3HUN A;  2XRN A;  1DJA A;  3MZE A;  3Q82 A;  2FFF B;  2JKR I;  4S2L A;  1OME A;  4WZ5 A;  1ZTU A;  4ZBE A;  3LFV A;  2Q9M A;  2DCF A;  3CWF A;  5J4E A;  1NY0 A;  4IBR A;  4OQG A;  3IQA A;  4XUX A;  3JYI A;  4P87 A;  1H0M A;  1TDL A;  5CEB A;  3IF6 B;  5IU1 A;  5HAQ A;  4K0X A;  3MKE A;  4PMA A;  3LI8 A;  2M7V A;  2ZMA A;  2I9V A;  1KE4 A;  3KYE A;  5C5K A;  4UAA A;  4HI4 A;  4PM6 A;  4I39 A;  3UB6 A;  4PAU A;  4KG2 A;  4KZ6 A;  5L07 A;  3MJQ A;  4WMC A;  3G6O A;  4OQH A;  1RGY A;  4I3J A;  3T1Q B;  2JKT I;  2D01 A;  4Y5F A;  3CIT A;  1LT0 A;  2WGV A;  3PBN A;  4ZJ2 A;  2A24 B;  3JVV A;  4FTX A;  3EEH A;  4E3O A;  4ARZ B;  5FI6 A;  3HLW A;  5IHV A;  3T1R A;  3W4P A;  3ZFZ A;  2JKG A;  4OP8 A;  4R0Q A;  1N9B A;  4NXG A;  4ZRR A;  1YAX A;  1JWV A;  2WGW B;  3LR5 A;  1KE3 A;  5D3O A;  3ZVT A;  2X02 A;  3VSL A;  3KYQ A;  1N9L A;  3UB5 P;  4HBT A;  2OLV A;  1PI4 A;  2HF6 A;  1STZ A;  3IT9 A;  4O8G A;  1JWP A;  5FL3 A;  4DDS A;  3UDI A;  3SH8 A;  2OWH A;  4IVI A;  3NI9 A;  3LR0 A;  2RCX A;  3W2Z A;  1CK3 A;  4HNB A;  5I5L A;  3UMD A;  4MN5 A;  2A3U A;  2X71 A;  3IXG A;  4IHQ A;  3F1O A;  4IBX A;  4R6L A;  1VET A;  3HUM A;  3IX4 A;  2L4R A;  3A0S A;  4ZJ1 A;  2XEP A;  5HWW A;  3A3E A;  4YFM A;  3E0Y A;  3H9W A;  3ZNT A;  2ZQD A;  2ZM2 A;  3IS2 A;  1ES5 A;  4DMZ A;  4BLM A;  1XGJ A;  3OLO A;  2Y59 A;  3RXX A;  2EFU A;  2C5W B;  4OKP A;  4X68 A;  3UE0 A;  4MEZ A;  1T1B A;  2Y79 A;  2ZQ9 A;  3MBZ A;  3K2N A;  3IXH A;  2FH5 A;  5CGW A;  4X6T A;  5EOO A;  1GA9 A;  3WRZ A;  1WA9 A;  1EWZ A;  4Y0O A;  3Q7V A;  3IHB A;  2VGL S;  1ES4 A;  1SKF A;  4LFU A;  4Y2F A;  3LUQ A;  3PAE A;  4X53 A;  3GEC A;  4H6J B;  4S2M A;  3NDE A;  2XD1 A;  2XSS A;  1H8Y A;  3IX3 A;  3BFG A;  4WF0 A;  2XFS A;  4D2O A;  2XLN A;  5TR7 A;  4WLA A;  4HJ3 A;  3VP2 A;  1JVJ A;  1F9I A;  2WK0 A;  3C30 A;  1U60 A;  1SHV A;  4PKY A;  2HDS A;  2V20 A;  3RFB A;  4R4S A;  5DTS A;  3ZHH A;  3ZG9 B;  4IUK A;  5A93 A;  3OCL A;  2CMN A;  4Y17 A;  2HZ5 A;  1W79 A;  1GHM A;  1LHY A;  2ZC6 B;  4RVA A;  3CMZ A;  1BSG A;  3F1P B;  4E3L A;  4EU0 A;  2KOI A;  2WAE A;  1L0G A;  4KQR A;  3UPO A;  1LL5 A;  4FOF A;  2QKP A;  3V5M A;  2QZ6 A;  2Z6D A;  5AQ9 A;  2Y2N A;  2DRW A;  5HW3 A;  3GV9 A;  4I3A A;  3IX8 A;  3M2K A;  4Y0T A;  2EA9 A;  2ZQ8 A;  1FCN A;  5EVI A;  2VGJ A;  1MWU A;  3BEB A;  3S7Q A;  3MF0 A;  1TS6 A;  2GJ3 A;  3HLF A;  1NLY A;  4WEL A;  1N9N A;  2B95 A;  4QU3 A;  4MCW A;  4JF6 A;  1PYY A;  4JXS A;  3WS4 A;  1M6K A;  1MWS A;  1SKO A;  1FOF A;  1YQS A;  4HQA A;  4XT2 B;  2V1A A;  1ODV A;  4F94 A;  4FSF A;  2VK3 A;  1L3L A;  2ZOI A;  2OSU A;  5U47 A;  3CAX A;  3DTK A;  2H10 A;  5E43 A;  3FKW A;  3D4F A;  3PBS A;  5K5B A;  4EBL A;  4NXE A;  1K4F A;  1IYO A;  2P9V A;  3DWK A;  3G30 A;  3HBR A;  4PPR A;  2WKH A;  3VOL A;  2ZM8 A;  2V2F F;  4WUJ A;  2JKF A;  5HL6 A;  3I7J A;  3NCK A;  2QJ5 A;  5HD5 A;  2XGN A;  4KZ4 A;  1EI5 A;  4ZJ3 A;  3D72 A;  4GNU A;  5A90 A;  4L9F A;  3CPT B;  3C7U A;  3EWK A;  4X55 A;  4JF4 A;  3O5Y A;  4I3I A;  2VEA A;  1WE4 A;  5AQA A;  3QNC A;  5FQK A;  1F2K A;  2W3H A;  2HP6 A;  3TJZ C;  4R23 A;  4R3J A;  1FCM A;  1K0K A;  5EPH A;  2W1T B;  4HH2 A;  3KX0 X;  3H7W B;  1LI0 A;  1I5Q A;  3P09 A;  2M1C A;  2PBY A;  2WKQ A;  5L8M A;  3T4Q A;  2BG1 A;  1ZC2 A;  4R38 A;  1W7F A;  4XXR A;  5FQM A;  3S22 A;  3SW1 A;  4HHD A;  2A2L A;  3QP5 A;  1L0E A;  1T19 A;  1NXY A;  1GA0 A;  1KGF A;  3RXW A;  3V3R A;  1XP4 A;  1ERM A;  3OCN A;  3N7W A;  3ZNY A;  2VGL M;  2BAS A;  2O9C A;  4MBH A;  3ZG7 B;  4R3B A;  1K4E A;  3PBR A;  3VE3 A;  3KSG A;  1XA1 A;  4PM9 A;  1MPL A;  5FAT A;  1GSX A;  1K54 A;  3PBO A;  2K7S A;  2W27 A;  2Y2I A;  1O7E A;  2EWV A;  2GX5 A;  4UA7 A;  5FQI A;  1E3U A;  4BBV A;  4Q0J A;  4UA9 A;  4LV1 A;  3BLM A;  5DJU A;  1KE0 A;  4DRT A;  3KSI A;  3SS5 A;  4HP9 A;  1JTG A;  4ID4 A;  3UY6 A;  4KZ8 A;  3DTI A;  5DF8 A;  1GHI A;  5FEG A;  2ZQC A;  4BL3 A;  4JPM A;  3MS6 A;  3LY3 A;  1G68 A;  3T4J A;  3B47 A;  5DF9 A;  3IF6 C;  1LSV A;  3PHY A;  4WN5 A;  4WEJ A;  4ETZ A;  2ACG A;  4JGR A;  1BUL A;  2HGV A;  4FH2 A;  4ARZ A;  2Z2M B;  1OTB A;  1TDG A;  2E8I A;  3ZDJ A;  3DWZ A;  5FAP A;  4ZTK A;  1O07 A;  3HUO A;  1YT4 A;  2WGW A;  4Q0I A;  1BZA A;  4BBT A;  3IXD A;  1PFL A;  3KSF A;  3UME A;  1MZU A;  2XDM A;  3WS0 A;  1PW8 A;  5CTM A;  5KSC A;  3FC7 A;  1K38 A;  4M4X A;  2HDR A;  3T1X A;  4OH0 A;  3D9Y A;  2ZC7 A;  3G35 A;  3ISG A;  1CI9 A;  2Y2M A;  4LRX C;  2HV1 A;  5E2H A;  3E4O A;  2Q9N A;  4B9O A;  5F82 A;  3SOI A;  4QY6 A;  2PD7 A;  4Y7P A;  1NRJ A;  4EES A;  2XQZ A;  1YLP A;  3A0V A;  3LID A;  5EVL A;  5DF7 A;  4B88 A;  2VX8 A;  3FWL A;  4E3J A;  3PAG A;  3G4P A;  3T50 A;  2VKS A;  5TGF A;  2VLG A;  4HJ6 A;  2XR0 A;  2Q0O A;  3N4I A;  1Q2P A;  3AGD A;  5FA7 A;  1UWN X;  1UWP X;  1S6R A;  3IWQ A;  2EX8 A;  1A0K A;  2VJW A;  5DTT A;  5EUA A;  4M3K A;  1MBL A;  3GMW A;  1JNU A;  4E3K A;  4LRY C;  1L0D A;  2WAF A;  1KOU A;  1CEG A;  2V1B A;  3NOU C;  4EEU A;  2EWW A;  2IWD A;  2D02 A;  4JGQ A;  2JC7 A;  2ZL1 B;  3QP1 A;  5AQ7 A;  4HP4 A;  2IWC A;  3W4O A;  3O3V A;  4H6J A;  1KGE A;  1S66 L;  3S7N A;  1VB6 A;  5FQQ A;  1K6R A;  1Q2Q A;  2J80 A;  1XXM A;  4PHT A;  1NJ4 A;  3A3I A;  2EX2 A;  5EOE A;  1TF1 A;  3IXB A;  1CJF A;  1BUE A;  1XGI A;  4CQH A;  2PR5 A;  3S7P A;  1Y4O A;  3FPW A;  5JYP A;  4KQQ A;  2QWS A;  2J7V A;  4NXF A;  5TBM B;  1S1Z A;  3N6I A;  1TS8 A;  4O0P A;  1H3Q A;  5F68 A;  3BY9 A;  3L9K A;  1PIO A;  2P08 A;  3UPN A;  3QP4 A;  1LSW A;  5HFO A;  1RP5 A;  3F1P A;  3C5A A;  4GW9 A;  1AWI A;  1SZV A;  4S2I A;  1IKG A;  3GR2 A;  1ES2 A;  2PYP A;  2PRF A;  4WYY A;  1ONH A;  3RH8 B;  4E6X A;  3OPL A;  3NIA A;  3TRC A;  3BYD A;  4OQI A;  4BMW A;  2Y2K A;  4EEP A;  2VGK A;  2PBD P;  1F5M A;  1XJ2 A;  4C75 A;  1FR1 A;  2J3T C;  3GVB A;  2V0U A;  5J8X A;  4R70 A;  3EGX C;  1P9R A;  4CLC C;  5AVE A;  1NZU A;  2W3D A;  2O0Y A;  2XFT A;  1IFQ A;  2J3T D;  3ITA A;  1FIK A;  3BQ8 A;  3HLD A;  2PT7 A;  4CLC D;  3W4Q A;  1KDS A;  1AXB A;  3NUL A;  4XT2 A;  5G4Z A;  5HDC A;  5TFQ A;  4FH4 A;  1T1A A;  1I2W A;  1IYS A;  3WS1 A;  4B4Z A;  1QMF A;  4QB8 A;  4G3V A;  1BYW A;  1CEF A;  3A0R A;  4GKU A;  3NEC A;  4KZB A;  1LL9 A;  5FAS A;  4GHI A;  4JXV A;  4EBN A;  2WKI A;  1SDN A;  4KZ5 A;  4I38 A; 
#chains in the Genus database with same CATH homology
 3UB5 P;  2VK3 A;  4X1M A;  1G5U A;  1PNE A;  3L9K A;  1HLU P;  3CPT A;  1D1J A;  4FUW A;  2BTF P;  1SKO B;  4X25 A;  1AWI A;  1SZV A;  5FEF A;  3LGO A;  2PAV P;  2JKF A;  1Z09 A;  4D60 A;  1VET A;  2HZ5 A;  3T12 B;  5FEG A;  2PRF A;  3MS6 A;  2ZL1 A;  1ACF A;  2V8F A;  1VEU A;  1A0K A;  3CHW P;  3CPT B;  2V8C A;  1YPR A;  5EM0 A;  2PBD P;  3LEQ A;  5EM1 A;  5FDS A;  1F2K A;  3MSH A;  2ACG A;  3T1S A;  4ESP A;  1VET B;  3KYE A;  2ZL1 B;  1K0K A;  5EV0 A;  1CF0 A;  1VEU B;  4X1L A;  1FIK A;  4QWO A;  3NUL A;  1PFL A;  3T1Q B;  1J3W A;  1FIL A;  1CJF A;  4FTX A;  1PRQ A;  3T1R A;  2B95 A;  3DAV A;  3NEC A;  1CQA A;  1Y4O A;  2JKG A;  3T1X A;  3D9Y A;  1SKO A;  2E8J A;  5EVE A;  3U4L P;  3L7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...