2JKGA

Plasmodium falciparum profilin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
165
structure length
165
Chain Sequence
b'YSWDSYLNDRLLATNQVSGAGLASEEDGVVYACVAQGEESDPNFDKWSLFYKEDYDIEVEDENGTKTTKTINEGQTILVVFNEGYAPDGVWLGGTKYQFINIERDLEFEGYNFDVATCAKLKGGLHLVKVPGGNILVVLYDEEKEQDRGNSKIAALTFAKELAES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN
molecule tags Protein binding
source organism Plasmodium falciparum
publication title Structural Basis for Parasite-Specific Functions of the Divergent Profilin of Plasmodium Falciparum.
pubmed doi rcsb
total genus 45
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2jkgA00
1VEUB 1PNEA 3CPTB 2BTFP 1ACFA 1YPRA 2PRFA 3T12B 3U4LP 1FILA 3T1QB 1PFLA 1A0KA 1VETB 2B95A 1FIKA 3MSHA 5EV0A 5FEFA 2V8FA 1D1JA 2V8CA 1AWIA 1SKOB 1HLUP 1Y4OA 2E8JA 3D9YA 4X1MA 3CPTA 1VEUA 3NECA 1CJFA 1K0KA 2JKGA 2VK3A 3DAVA 1PRQA 2HZ5A 1SZVA 3L7HA 3UB5P 2PBDP 3CHWP 3L9KA 4QWOA 5EM0A 1Z09A 1SKOA 3T1XA 5EM1A 1G5UA 4X25A 1VETA 2ZL1B 3LGOA 3LEQA 3MS6A 3NULA 2JKFA 5EVEA 4ESPA 3T1SA 1F2KA 2ZL1A 3T1RA 4X1LA 2ACGA 1CQAA 1J3WA 4FTXA 4D60A 4FUWA 2PAVP 5FDSA 3KYEA 5FEGA 1CF0A
chains in the Genus database with same CATH superfamily
2ZC6B 5GLCA 1W8YA 1IYSA 4M3KA 4H6JA 2HGVA 2C6WB 2PU4A 1CI9A 1K57C 4IHQA 3QP2A 4F3LA 2X71A 3TE8A 4DF6A 3N4IA 3IBJA 5F69A 3UE6A 4CLCD 2D02A 4QPRA 4UHUA 2DRWA 3LIAA 2A24B 4DJ2A 1JWVA 5E2GA 2Y2GA 3HLWA 3VE4A 3T1RA 2VA0A 5FA7A 2JCHA 4Z9QA 2H10A 4KZ6A 1S1YA 4JLFA 2PD8A 5J4EA 2A49A 2Z2MB 2PHYA 3C38A 3VSLA 3HJKA 3IS2B 2JE5A 4BBVA 3T1SA 3ZG0A 1K38A 3UB7A 3ZHHA 2EX9A 3A3EA 2QYBA 4OONA 1YSQA 4GDBA 1OTBA 4GHIB 2WAEA 4JKTA 5HDSA 1XFQA 2WGVA 3P01A 4K08A 3Q7VB 4LRXC 2BASA 2LB9A 4K91A 3LGOA 5HDDA 3CMZA 4MLLA 3RXWA 1IFQA 3NOUC 3PTEA 3U4LP 2Y59A 3MQ0A 3N8LA 1XJ4A 5CGXA 3E2KA 1L0FA 2Y2KA 4X6TA 3M2KA 1MZUA 1H8MA 4WN5A 4F94A 4UQIS 3GECA 1J9MA 3ITBA 3QP4A 4WZ5C 5FDHA 1BULA 1CF0A 4CLCB 4HH3A 1LLBA 3CLOA 4LV2A 4FH4A 2Y2QA 4UA7A 1VHMA 1DP8A 1EWZA 2HDRA 5HWVA 5J8XA 1S0WA 2H5SA 3QNCA 2VKSA 5BOHA 3PAEA 5HPFA 4E3LA 4ZJ2A 1Y4OA 3FPWA 3FPVA 1CJFA 2RL3A 2RCXA 3ZDJA 2O0YA 4Q0HA 2ZM2A 4WF0A 2L1MA 2Z6CA 4RYEA 4B4XA 5FAQA 4JGQA 3C30A 4X56A 2E8IA 4YOFA 4EUVA 5EOEA 4BD1A 3CJMA 5A8BA 5FI7A 1GA9A 1D1JA 3OC2A 3VP3A 3HUMA 4EWFA 3DAVA 1K56D 3LI9A 1ONHA 2XDMA 4GB7A 1ES3A 4PMAA 4XUZA 3HLBA 3CUEC 4OKPA 4Q0JA 1LL5A 2JHEA 2OAP1 3NIAA 5FL3A 3BWLA 2BLSA 1KDWA 1T19A 1H5XA 1YLJA 4K0WA 3W4QA 3LYXA 2ZQDA 1IYOA 4G3VA 2OLVA 2WKHA 1XP4A 3M2JA 2ZC7A 2EFXA 3SZTA 3Q82A 1RGZA 2XSSA 5CECA 1G28A 1V9ZA 3CG5A 4H6JB 5EECA 3IXDA 1S6RA 1GSVA 4JXWA 3MKFA 1IKIA 4EETB 3LICA 2B5RA 1JVJA 2OV5A 4ETXA 2K31A 5FASA 1NZOA 4NK3A 3ZG7B 4UAAA 4I3JA 3LR4A 4S2IA 3LR0A 4JXVA 4E6XA 4WMCD 4Y5FA 4RX3A 2QHKA 2QJ5A 2OSUA 4FD8A 4LFUA 2P7JA 1KE3A 5HFOA 1K55A 5KZHA 3VP2A 3C4PA 3H7WB 4L9FA 2P04A 3HUNA 4OOYA 3BJNA 3GTCA 3F1NB 2R78A 4S2LA 2A2LA 3FWLA 3L7HA 3ITAA 3UY6A 5KIZA 5C5KA 2VV6A 4X1LA 4CLCA 3MXQA 1PZOA 3T4TA 3LEZA 1U60A 4R70A 1IYQA 2GX5A 1PFLA 1WYBA 4XT2A 4KG6A 4KQQA 3KYQA 4MEZA 1LSWA 1OTDA 3IBRA 4Z1WA 2WKRA 3S22A 4R23A 1E4DA 2JKGA 1Z09A 5DTSA 1O07A 2GDNA 3OOVA 5AVEA 1S1ZA 3RH8B 3E4OA 1PWGA 3UB6A 3T4KA 4BBUA 3OCNA 1CEFA 1T1CA 1YLZA 3WS2A 2Y55A 4DDYA 3EEHA 3QP8A 1EW0A 1GSXA 3HL9A 5TFQA 3MXRA 1YMSA 1ODVA 3EWKA 4GZBA 3LFVA 4HHDA 4OQIA 3G4PA 4PKYG 1FSYA 1MC0A 4HJ4A 2B95A 1W79A 3IHBA 3TRCA 3NOPC 4OQ0A 4EEPA 4S2PA 3F1PB 1KGEA 2IA2A 4KZ7A 3VOYA 4Y13A 3MF0A 4JF6A 4DKIA 1GSWA 4WZ4A 1E25A 4EQIA 4JGRA 5F68A 3M6HA 4RA7A 5I94A 5CRFA 2VLGA 1XJ2A 1DRMA 4DE1A 5K5BA 4WELA 2E8JA 5CEBA 5L8MA 3UN7A 5DFXA 4ARZA 5KSCA 2HZ5A 3UE0A 3QHYA 4PM6A 1LSXA 4EERA 1VB6A 4R1GA 2XROA 5LBRA 3N7WA 4ZDXA 3K3DA 2W3HA 2R9WA 3EQVA 3LY4A 3T1QB 4KQDA 3FZCA 3D9YA 2Z6DA 3DWZA 2FZ0A 1PW8A 4OP8A 4MN6A 3CUEA 3F1NA 3KYZA 3KSFA 1XJ3A 5IHVA 5DKLA 4FUWA 5DVAA 5FDSA 4X69A 3HCYA 4NEED 4QB8A 1ZG4A 5DFYA 3MFXA 1YLYA 1FIKA 1XA7A 2Y2MA 3ZCZA 2O99A 3O3VA 3PBNA 1OT6A 1XKZA 4DE2A 5DF9A 2M7UA 3T4SA 5FSRA 3GVBA 2XA7M 3VSKA 4YNRA 5L09A 1ES5A 4Y2FA 2ZQ8A 4Y0TA 1AWIA 5F5YA 1XPBA 2G7UA 3EQUA 2C5WB 1K25A 1D06A 5IS1A 4XXRA 3K3CA 1Y28A 3LO7A 3F1PA 1E3UD 3KSIA 3PR6A 2K2NA 4OH0A 4OQHA 4Y15A 1YM1A 2ZMFA 1KDSA 1DP6A 2XH9A 5TBMA 2FFYA 4PAUA 1K4EA 3S4XA 4R3JA 1PI5A 2VGLM 1W7FA 4LRYC 3I7JA 1J3WA 5EVID 1SCWA 2ZQAA 4BBTA 1ESUA 4C75A 3MZFA 3CZDA 1P0ZA 4L9GA 1KOUA 1YQSA 3E2LA 3UO9A 1TDLA 2YKHA 1FOFA 2I9VA 1TS6A 3LIEA 4R3AA 2X02A 1NLZA 1GCEA 1Q2PA 1TS8A 2I72A 3BYDA 3P09A 2PD7A 2WKPA 2MJ6A 1BUEA 4Y17A 5EVIB 4XT2B 3H82A 4IBXA 1S66L 4Q0IA 2V9AA 5HL6A 2VEAA 4II7A 4DXCA 2ZM0A 3BY9A 1G5UA 5M19A 3HLFA 2WAFA 5FQQA 3DTEA 3T4OA 2JKRM 3AGFA 5KSHA 3O5YA 3IH9A 5AQBA 2Z2LB 3G31A 5E2FA 2KLIA 5HARA 2V1BA 4DE3A 3HJIA 2VV8A 4D2OA 2YKFA 5DF8A 2UWXA 4S2NC 4A5RA 2V0UA 3UPOA 2DCFA 1MY8A 2G2WA 3IS2A 2Y2LA 3D4FA 4S2NA 1ESIA 5EPHA 1ACFA 3IF6B 4GN2A 1LI9A 1SKOB 1HLUP 4R4SA 4N1HA 4NKPA 4LLOB 4MBKA 4JGOA 3QP6A 1ZC2A 1BSGA 2ZQ9A 4WMCA 3IXHA 3A0SA 4D60A 5IT5A 3T4LA 5F1GA 2V1AA 4EV4A 3UPPA 1M40A 4MBHA 3O86A 1WE4A 3ZVTA 3MKEA 4HH2A 5CHJA 3G32A 1G6OA 3JYIA 1K6RA 3QP5A 1YLWA 3KO6A 3ZQ5A 1SKFA 2Y91A 2JC7A 4X1MA 5CHUA 2XK1A 3NOTC 3IWIA 2P08A 2XQZA 3VMAA 4G3KA 4X55A 1CQAA 4WL9A 4GOGA 4HBTA 1S4SA 2P9VA 1ES4A 1K54A 4GS9A 2NUTC 5A90A 4KZ8A 3N6IA 4WBGA 3F1OB 4QD4A 2M1CA 2WKEA 2W3GA 3IF5A 3JPUA 5EM0A 3SS3A 2EWWA 3SS5A 5DF7A 1I5QA 3E4QA 3ZGAB 4KG5A 4KZ5A 2VX8A 3IXBA 5HAQA 3OPPA 1ONGA 2L0WA 1BLSA 2ZD8A 3A3JA 4I3IA 3RJUA 3B33A 5F1FA 4GLQA 4JF5A 1NLYA 3S7QA 1XFNA 4QWOA 3NJAA 3T1XA 5EM1A 5L07A 3U2AA 2VZWA 2PYRA 3N8SA 1Z6FA 4BJPA 3NY4A 2HP6A 3T4JA 3UB9A 2Y79A 3UB5P 5CGWA 1NXYA 5J7EA 2CMNA 1K54C 1L2SA 2VGKA 2EXAA 4ZJ3A 1FCOA 2A3UA 4ZTKA 1TD5A 1LL9A 2ZC3B 1WA9A 1VEUA 3AGDA 3GV9A 2IWDA 1I2SA 4MDZA 1PWCA 3UPNA 2JN7A 4EXOA 4EW7A 3BECA 1F98A 5CTMA 2J80A 3VFFA 2J3TD 5FQJA 1GHMA 3VOLA 4P6ZS 1FILA 1T1AA 4DE0A 3ZG5A 5EV0A 5AVFA 4RX2A 2ZQ7A 3LIBA 3OPHA 4MCWA 1QMEA 3O88A 3S7PA 1YAXA 1YLPA 5GHYA 3VOZA 4OQGA 5HDCA 3H82B 3OCLA 4HJ3A 3DBAA 3UDIA 4N92A 2W3EA 4HNBA 2WK0A 2Y2JA 4ARZB 4GD8A 2FFFB 2PR5A 5JYPA 1OTEA 2DNSA 4KZ3A 2XR0A 2P9VB 4PM8A 4WLAA 4G3WA 2Y2PA 3PBQA 4QU3A 2XEPA 4LENA 4H8RA 4I3AA 1OMEA 1GA0A 1HZOA 1M6KA 3LR3A 4S2JA 1L3LA 4DDSA 2XFTA 5F82A 5TGFA 1BYWA 5CEDA 5FQIA 4IUHA 1ERMA 3BW6A 1OPXA 3MJQA 4LGWA 3B47A 2HDQA 3KYEA 1GHIA 5GHZA 1PNEA 1L0DA 2FH5A 2Y2OA 3SH7A 1IOUA 5CHMA 1KE4A 5MC7A 4PKYA 1BLCA 3R7WA 3OPRA 3UMEA 2G2UA 5E43A 3FV7A 2ZMVA 1MXOA 4E6WA 2OWJA 3LIFA 4Y0UA 1ZTUA 1PWDA 4LV0A 5HSQA 2IWCA 1VQQA 5EE8A 2BG1A 4KUKA 3GRJA 1KVLA 1PIOA 1RCJA 1SDNA 2W3DA 2EXBA 2VV7A 3K2NA 3V5MA 2H0YA 4L9EA 1L0GA 3ULFA 3EGXC 3CPTA 5M18A 4S2KA 4ZJ1A 2J3TC 3BQAA 4C3QA 5G4ZA 2ZMAA 1KVMA 1H3QA 1SHVA 3VP0A 4R38A 3ZVWA 1T18A 4E04A 1X0OA 5DTTA 5CX7A 5EOOA 2INWA 1ES2A 2PT7A 3FG8A 2WUQA 4RVAA 1FSWA 1IELA 4GS9B 1STZA 4OOMA 4LCLA 2DMWA 4HEFA 2R9XA 2CC1A 2PU2A 4NETA 1T1BA 3S7NA 1MWTA 4B4ZA 1JTGA 2ZC5B 5TJJA 3IF6C 1S67L 4O7DA 1IYPA 1BZAA 3HLCA 1DJAA 2ZJ9A 3P98A 3VE3A 4E3NA 1VETA 2J3WA 2JBFA 2XFSA 4NXFA 1YSPA 1MKMA 2UV0E 1YLTA 4DN0A 4E3JA 1G6AA 1P9WA 4HOIA 1RP5A 4CLCE 5FI2A 5U47A 3D72A 3HLEA 1VETB 2QPNA 4OPQA 4MN5A 4KUOA 3MXSA 1K6SA 1LHYA 4Y7PA 2W0NA 4GNUA 2VGLS 5G4YA 4I38A 5EVIA 5JYOA 3GQZA 5A91A 4ZAMA 2JKRI 2B02A 3NHQA 1BT5A 3W2ZA 4GD6A 3OLOA 1DJBA 2O9CA 4NG2A 1TEMA 3UDFA 3PYPA 4KZAA 2Y2HA 4KENB 4JXGA 2JKTI 5HD5A 4WM9A 1N9LA 5AQAA 3EEAA 4NXGA 4K0XA 3G6OA 3DWKA 3G34A 1MWUA 1TS7A 3OBFA 3WS5A 4BD0A 4EBPA 1SDEA 1ALQA 1A0KA 4KZ9A 3WS4A 2WYXA 2ZOIA 4EBNA 5AQ9A 1W63M 1K0KA 2OOLA 5FQ9A 3G2YA 1SZVA 1FCNA 3NI9A 3UMDA 4P0MA 1F9IA 2ZL1B 1TF1A 3Q07A 4ESPA 4OVDA 4M4XA 1NYYA 1IKGA 5AQ7A 5D3OA 3C4OA 3HLGA 3QNBA 5DTKA 5GL9A 1KGGA 4BLMA 3A0RA 2J8YA 2ZC4B 3IH8A 2PYPA 4E3KA 1P9RA 1K4FA 3KX0X 4QY6A 1D7EA 2QJ7A 1S4RA 1OT9A 4E3OA 4DXBA 2WGWA 4EUZA 1FCMA 5KMWA 5HL1A 4KG2A 5HD3A 5FQMA 2WKQA 4CJNA 3KSGA 1EI5A 1N9NA 2PBDP 3BFDA 3IQAA 4GKUA 2A24A 3A0VA 1CEGA 3A3IA 3MFDA 1DY6A 2B18A 2PAVP 3EOIA 3T12B 3PBSA 4MBFA 4QY5A 3KSHA 4S2MA 5F6AA 2V0WA 3IWQA 3OZHA 5E2EA 5EVEA 1F2KA 1P97A 5J3WA 1L0EA 2WKIA 3HLDA 3RTYA 1UWPX 4ME4A 1NY0A 1DP9A 4BQMA 5HAIA 4GCZA 3ZNTA 1W5DA 1HVBA 3E0YA 3C2WA 3CITA 1PZPA 2WZZA 1SKOA 4E3IA 4EU0A 2H0TA 4HP9A 3SS4A 5HW3A 4OPYA 5EVLA 3T50A 2V20A 4HIAA 2XRNA 2V8CA 3NDEA 5GLAA 2BTFP 4AFIA 3JVUA 5GLBA 4OLGA 4Y3IA 3V39A 2WADA 2EX6A 4BMWA 4QJGA 3PBOA 1UGUA 2XD5A 1MKIA 4CPKA 3R4KA 1C3BA 3CI6A 4BL2A 1LSVA 4BWIA 3BQ8A 4P6BA 3JVVA 3GMWA 2ZQCA 2PBYA 5CXWA 3EGDC 3UDXA 4B9OA 3CPTB 1DJCA 1YPRA 3LR5A 3N8RA 2OLUA 4B88A 1ERQA 4EQ1A 3QP1A 5HZHA 3NECA 3PBTA 2W1TA 4PM7A 3B3XA 2WGIA 3NULA 5FI6A 3G30A 3WWXA 2QZ6A 1YMXA 4HJ6A 1ZKJA 3WS0A 4OOLA 4GDNA 4OLDA 2V2FF 3GSGA 3S7OA 3WRTA 2Q9NA 1MWRA 1LL8A 2EWVA 3DTKA 2WGWB 4Q8IA 2XA7S 4WEKA 3BFEA 4R3BA 4DMZA 4NXEA 4UEYA 5HWWA 2IWBA 3BLSA 3ZG9B 4PM9A 3TSGA 4S2OA 1H8ZA 4U0XA 3DTIA 5TR7A 3B42A 3ICYA 2AVXA 3IWOA 4JGPA 1OTAA 3Q7VA 4JPMA 1LI0A 1W8QA 3GDIA 3SH9A 3AGEA 1PRQA 4GHIA 2HP5A 2P74A 5CGSA 3FYZA 2Q9MA 2HV1A 3A3DA 4N1XA 2ZL1A 4HP4A 2ZBBA 3C5AA 3NDGA 3RXXA 2PRFA 1GHPA 1TDGA 1XX2A 5CERA 3PHYA 2OWHA 2HP9A 3MMHA 4P6ZM 3E4PA 3TW8A 3HBRA 3VFHA 2VGJA 3ZFZA 5FATA 4DRTA 3HUOA 2XLNA 3VP4A 4LPZA 3BFFA 1PW1A 2L4RA 1FR6A 4KQOA 2QWSA 4IVKA 4N9KA 3C7VA 4CQHA 3LI8A 3WS1A 3L9KA 3IX3A 4YWZA 1K55C 4P85A 5FEGA 4WZ5A 2W3FA 3R7WB 3LUQA 3C7UA 2EA9A 3DTMA 5HAPA 4I39A 3OPLA 2ZOHA 4F3LB 4O01A 1NZUA 2ZM8A 3LCEA 3NCKA 2X01A 3E98A 4IEDA 2KOIA 4FTXA 2Y2NA 1JWPA 2LB5A 3H7WA 4ZRRA 5EFWA 1VEUB 3V3SA 3HVFA 3WRZA 4JBFA 3MR0A 3BLMA 2WZXA 3IF6A 2W27A 2H28A 1EROA 3F1OA 5A93A 2JKFA 3M6BA 3H9WA 4N9LA 3VV4A 4LCMA 4MN7A 4HESA 3MBZA 4YINA 4ETZA 1CI8A 4NXBA 3ZYTA 1K56A 3PXPA 2O9AA 4IVIA 4GJ4A 3LEQA 3LY3A 3UNWA 4QHCA 4Y0OA 4FOFA 4OPRA 3MZEA 3A3FA 4OPZA 5CTNA 3V67A 2GNXA 2HJEA 3MQQA 1N9OA 3CHWP 2HJ9C 3Q7ZA 4BENA 3MS6A 2ZLYA 2V1ZA 5M1AA 1BLHA 1AXBA 2GZAA 4C6YA 2K7SA 4DJ3A 3S1YA 3IX4A 3LIDA 4BL3A 3UE1A 4IUKA 2HDUA 1I2WA 3G2ZA 2GJ3A 3UB8A 4FCFA 3GR2A 1IEMA 1XGJA 2W1RA 2EX2A 2EFUA 2XF3A 4U3TA 5L10A 4L0LA 4HY8A 3FKVA 4HQAA 4HI4A 2XGNA 4ID4A 2PDRA 3NBLA 5AJGA 1QMFA 3IXGA 4E3MA 1JNUA 3VP1A 1WYCA 1NWZA 4O8GA 2VK3A 4U0TA 3BFGA 2HDSA 4WYYA 3IHAA 3MZDA 4X53A 2Y4AA 4FH2A 4MNRA 4FSFA 5I5LA 3W4OA 3W8KA 3T4QA 2V8FA 2PR6A 3CWFA 3ZG8B 5HPIA 3UE3A 2Y2IA 1FQGA 4PHTA 3RFBA 4KZ4A 3BY8A 3TOIA 1FR1A 2QKPA 5DKKA 4XUXA 2KDKA 4X68A 4B93A 4LV3A 3IX8A 3CAXA 2Q0OA 3Q81A 1JWZA 4YFMA 2EX8A 4WUJA 1TVFA 5F83A 1MPLA 1OTIA 1PI4A 1G68A 2D01A 1V9YA 5G18A 3O87A 4IJGA 5E2HA 4KZBA 1MBLA 1O7EA 1BTLA 1CK3A 4I5SA 1Q2QA 4EEUA 1BLPA 2HF6A 3Q1FA 1N9BA 5L2FA 1NYMA 3MQOA 3PBRA 3TG9A 2HPBA 5FAOA 2J9OA 2M7VA 4WEJA 5HX9A 5TBMB 1XJ6A 3ISGA 2O9BA 5HWTA 4EESA 1HD8A 4UA9A 1XA1A 3ZNYA 3P7NA 4LRZE 2QMIA 1JTDA 1F5MA 4P87A 3FC7A 3FKWA 4JXSA 4UQIM 5A92A 3BRMA 1NJ4A 4HBUA 1TS0A 2KX6A 4IBRA 1ZG6A 3BM6A 5EVIC 4UA6A 3SH8A 2XD1A 1E3UA 4ZBEA 1H0MA 1NRJA 2J7VA 4JF4A 1NRFA 1KE0A 1ZHHB 3MSHA 5DJUA 5FEFA 4MMNA 2Y8HA 1YKDA 2W1TB 4GW9A 5FAPA 1OJ5A 5GHXA 4EBLA 1XGIA 2OAQ1 3V3RA 1PYYA 3G35A 1MWSA 1VM1A 3NC8A 3TJZC 5DJTA 3C8CA 3SW1A 5GLDA 1N4OA 4PPRA 4R6LA 4OP5A 2JKTM 5FQKA 3HREA 1W63Q 4CLCC 4RQ9A 3BFCA 4X25A 1YT4A 1Y54A 3PAGA 3BEBA 3V50A 1OJGA 4R0QA 3DW0A 1HTZA 4R4RA 3W4PA 1H8YA 3D3OA 1XXMA 5EUAA 4LV1A 5IU1A 2VJWA 3SOIA 4KQRA 4O0PA 4PM5A 1UWNX 2J9PA 2NUPC 1RGYA 1LT0A 1KGFA 2ACGA 3IT9A 1K57A
chains in the Genus database with same CATH topology
1VEUB 1PNEA 3CPTB 2BTFP 1ACFA 1YPRA 2PRFA 3T12B 3U4LP 1FILA 3T1QB 1PFLA 1A0KA 1VETB 2B95A 1FIKA 3MSHA 5EV0A 5FEFA 2V8FA 1D1JA 2V8CA 1AWIA 1SKOB 1HLUP 1Y4OA 2E8JA 3D9YA 4X1MA 3CPTA 1VEUA 3NECA 1CJFA 1K0KA 2JKGA 2VK3A 3DAVA 1PRQA 2HZ5A 1SZVA 3L7HA 3UB5P 2PBDP 3CHWP 3L9KA 4QWOA 5EM0A 1Z09A 1SKOA 3T1XA 5EM1A 1G5UA 4X25A 1VETA 2ZL1B 3LGOA 3LEQA 3MS6A 3NULA 2JKFA 5EVEA 4ESPA 3T1SA 1F2KA 2ZL1A 3T1RA 4X1LA 2ACGA 1CQAA 1J3WA 4FTXA 4D60A 4FUWA 2PAVP 5FDSA 3KYEA 5FEGA 1CF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VEU B;  1PNE A;  3CPT B;  2BTF P;  1ACF A;  1YPR A;  2PRF A;  3T12 B;  3U4L P;  1FIL A;  3T1Q B;  1PFL A;  1A0K A;  1VET B;  2B95 A;  1FIK A;  3MSH A;  5EV0 A;  5FEF A;  2V8F A;  1D1J A;  2V8C A;  1AWI A;  1SKO B;  1HLU P;  1Y4O A;  2E8J A;  3D9Y A;  4X1M A;  3CPT A;  1VEU A;  3NEC A;  1CJF A;  1K0K A;  2JKG A;  2VK3 A;  3DAV A;  1PRQ A;  2HZ5 A;  1SZV A;  3L7H A;  3UB5 P;  2PBD P;  3CHW P;  3L9K A;  4QWO A;  5EM0 A;  1Z09 A;  1SKO A;  3T1X A;  5EM1 A;  1G5U A;  4X25 A;  1VET A;  2ZL1 B;  3LGO A;  3LEQ A;  3MS6 A;  3NUL A;  2JKF A;  5EVE A;  4ESP A;  3T1S A;  1F2K A;  2ZL1 A;  3T1R A;  4X1L A;  2ACG A;  1CQA A;  1J3W A;  4FTX A;  4D60 A;  4FUW A;  2PAV P;  5FDS A;  3KYE A;  5FEG A;  1CF0 A; 
#chains in the Genus database with same CATH topology
 2ZC6 B;  5GLC A;  1W8Y A;  1IYS A;  4M3K A;  4H6J A;  2HGV A;  2C6W B;  2PU4 A;  1CI9 A;  1K57 C;  4IHQ A;  3QP2 A;  4F3L A;  2X71 A;  3TE8 A;  4DF6 A;  3N4I A;  3IBJ A;  5F69 A;  3UE6 A;  4CLC D;  2D02 A;  4QPR A;  4UHU A;  2DRW A;  3LIA A;  2A24 B;  4DJ2 A;  1JWV A;  5E2G A;  2Y2G A;  3HLW A;  3VE4 A;  3T1R A;  2VA0 A;  5FA7 A;  2JCH A;  4Z9Q A;  2H10 A;  4KZ6 A;  1S1Y A;  4JLF A;  2PD8 A;  5J4E A;  2A49 A;  2Z2M B;  2PHY A;  3C38 A;  3VSL A;  3HJK A;  3IS2 B;  2JE5 A;  4BBV A;  3T1S A;  3ZG0 A;  1K38 A;  3UB7 A;  3ZHH A;  2EX9 A;  3A3E A;  2QYB A;  4OON A;  1YSQ A;  4GDB A;  1OTB A;  4GHI B;  2WAE A;  4JKT A;  5HDS A;  1XFQ A;  2WGV A;  3P01 A;  4K08 A;  3Q7V B;  4LRX C;  2BAS A;  2LB9 A;  4K91 A;  3LGO A;  5HDD A;  3CMZ A;  4MLL A;  3RXW A;  1IFQ A;  3NOU C;  3PTE A;  3U4L P;  2Y59 A;  3MQ0 A;  3N8L A;  1XJ4 A;  5CGX A;  3E2K A;  1L0F A;  2Y2K A;  4X6T A;  3M2K A;  1MZU A;  1H8M A;  4WN5 A;  4F94 A;  4UQI S;  3GEC A;  1J9M A;  3ITB A;  3QP4 A;  4WZ5 C;  5FDH A;  1BUL A;  1CF0 A;  4CLC B;  4HH3 A;  1LLB A;  3CLO A;  4LV2 A;  4FH4 A;  2Y2Q A;  4UA7 A;  1VHM A;  1DP8 A;  1EWZ A;  2HDR A;  5HWV A;  5J8X A;  1S0W A;  2H5S A;  3QNC A;  2VKS A;  5BOH A;  3PAE A;  5HPF A;  4E3L A;  4ZJ2 A;  1Y4O A;  3FPW A;  3FPV A;  1CJF A;  2RL3 A;  2RCX A;  3ZDJ A;  2O0Y A;  4Q0H A;  2ZM2 A;  4WF0 A;  2L1M A;  2Z6C A;  4RYE A;  4B4X A;  5FAQ A;  4JGQ A;  3C30 A;  4X56 A;  2E8I A;  4YOF A;  4EUV A;  5EOE A;  4BD1 A;  3CJM A;  5A8B A;  5FI7 A;  1GA9 A;  1D1J A;  3OC2 A;  3VP3 A;  3HUM A;  4EWF A;  3DAV A;  1K56 D;  3LI9 A;  1ONH A;  2XDM A;  4GB7 A;  1ES3 A;  4PMA A;  4XUZ A;  3HLB A;  3CUE C;  4OKP A;  4Q0J A;  1LL5 A;  2JHE A;  2OAP 1;  3NIA A;  5FL3 A;  3BWL A;  2BLS A;  1KDW A;  1T19 A;  1H5X A;  1YLJ A;  4K0W A;  3W4Q A;  3LYX A;  2ZQD A;  1IYO A;  4G3V A;  2OLV A;  2WKH A;  1XP4 A;  3M2J A;  2ZC7 A;  2EFX A;  3SZT A;  3Q82 A;  1RGZ A;  2XSS A;  5CEC A;  1G28 A;  1V9Z A;  3CG5 A;  4H6J B;  5EEC A;  3IXD A;  1S6R A;  1GSV A;  4JXW A;  3MKF A;  1IKI A;  4EET B;  3LIC A;  2B5R A;  1JVJ A;  2OV5 A;  4ETX A;  2K31 A;  5FAS A;  1NZO A;  4NK3 A;  3ZG7 B;  4UAA A;  4I3J A;  3LR4 A;  4S2I A;  3LR0 A;  4JXV A;  4E6X A;  4WMC D;  4Y5F A;  4RX3 A;  2QHK A;  2QJ5 A;  2OSU A;  4FD8 A;  4LFU A;  2P7J A;  1KE3 A;  5HFO A;  1K55 A;  5KZH A;  3VP2 A;  3C4P A;  3H7W B;  4L9F A;  2P04 A;  3HUN A;  4OOY A;  3BJN A;  3GTC A;  3F1N B;  2R78 A;  4S2L A;  2A2L A;  3FWL A;  3L7H A;  3ITA A;  3UY6 A;  5KIZ A;  5C5K A;  2VV6 A;  4X1L A;  4CLC A;  3MXQ A;  1PZO A;  3T4T A;  3LEZ A;  1U60 A;  4R70 A;  1IYQ A;  2GX5 A;  1PFL A;  1WYB A;  4XT2 A;  4KG6 A;  4KQQ A;  3KYQ A;  4MEZ A;  1LSW A;  1OTD A;  3IBR A;  4Z1W A;  2WKR A;  3S22 A;  4R23 A;  1E4D A;  2JKG A;  1Z09 A;  5DTS A;  1O07 A;  2GDN A;  3OOV A;  5AVE A;  1S1Z A;  3RH8 B;  3E4O A;  1PWG A;  3UB6 A;  3T4K A;  4BBU A;  3OCN A;  1CEF A;  1T1C A;  1YLZ A;  3WS2 A;  2Y55 A;  4DDY A;  3EEH A;  3QP8 A;  1EW0 A;  1GSX A;  3HL9 A;  5TFQ A;  3MXR A;  1YMS A;  1ODV A;  3EWK A;  4GZB A;  3LFV A;  4HHD A;  4OQI A;  3G4P A;  4PKY G;  1FSY A;  1MC0 A;  4HJ4 A;  2B95 A;  1W79 A;  3IHB A;  3TRC A;  3NOP C;  4OQ0 A;  4EEP A;  4S2P A;  3F1P B;  1KGE A;  2IA2 A;  4KZ7 A;  3VOY A;  4Y13 A;  3MF0 A;  4JF6 A;  4DKI A;  1GSW A;  4WZ4 A;  1E25 A;  4EQI A;  4JGR A;  5F68 A;  3M6H A;  4RA7 A;  5I94 A;  5CRF A;  2VLG A;  1XJ2 A;  1DRM A;  4DE1 A;  5K5B A;  4WEL A;  2E8J A;  5CEB A;  5L8M A;  3UN7 A;  5DFX A;  4ARZ A;  5KSC A;  2HZ5 A;  3UE0 A;  3QHY A;  4PM6 A;  1LSX A;  4EER A;  1VB6 A;  4R1G A;  2XRO A;  5LBR A;  3N7W A;  4ZDX A;  3K3D A;  2W3H A;  2R9W A;  3EQV A;  3LY4 A;  3T1Q B;  4KQD A;  3FZC A;  3D9Y A;  2Z6D A;  3DWZ A;  2FZ0 A;  1PW8 A;  4OP8 A;  4MN6 A;  3CUE A;  3F1N A;  3KYZ A;  3KSF A;  1XJ3 A;  5IHV A;  5DKL A;  4FUW A;  5DVA A;  5FDS A;  4X69 A;  3HCY A;  4NEE D;  4QB8 A;  1ZG4 A;  5DFY A;  3MFX A;  1YLY A;  1FIK A;  1XA7 A;  2Y2M A;  3ZCZ A;  2O99 A;  3O3V A;  3PBN A;  1OT6 A;  1XKZ A;  4DE2 A;  5DF9 A;  2M7U A;  3T4S A;  5FSR A;  3GVB A;  2XA7 M;  3VSK A;  4YNR A;  5L09 A;  1ES5 A;  4Y2F A;  2ZQ8 A;  4Y0T A;  1AWI A;  5F5Y A;  1XPB A;  2G7U A;  3EQU A;  2C5W B;  1K25 A;  1D06 A;  5IS1 A;  4XXR A;  3K3C A;  1Y28 A;  3LO7 A;  3F1P A;  1E3U D;  3KSI A;  3PR6 A;  2K2N A;  4OH0 A;  4OQH A;  4Y15 A;  1YM1 A;  2ZMF A;  1KDS A;  1DP6 A;  2XH9 A;  5TBM A;  2FFY A;  4PAU A;  1K4E A;  3S4X A;  4R3J A;  1PI5 A;  2VGL M;  1W7F A;  4LRY C;  3I7J A;  1J3W A;  5EVI D;  1SCW A;  2ZQA A;  4BBT A;  1ESU A;  4C75 A;  3MZF A;  3CZD A;  1P0Z A;  4L9G A;  1KOU A;  1YQS A;  3E2L A;  3UO9 A;  1TDL A;  2YKH A;  1FOF A;  2I9V A;  1TS6 A;  3LIE A;  4R3A A;  2X02 A;  1NLZ A;  1GCE A;  1Q2P A;  1TS8 A;  2I72 A;  3BYD A;  3P09 A;  2PD7 A;  2WKP A;  2MJ6 A;  1BUE A;  4Y17 A;  5EVI B;  4XT2 B;  3H82 A;  4IBX A;  1S66 L;  4Q0I A;  2V9A A;  5HL6 A;  2VEA A;  4II7 A;  4DXC A;  2ZM0 A;  3BY9 A;  1G5U A;  5M19 A;  3HLF A;  2WAF A;  5FQQ A;  3DTE A;  3T4O A;  2JKR M;  3AGF A;  5KSH A;  3O5Y A;  3IH9 A;  5AQB A;  2Z2L B;  3G31 A;  5E2F A;  2KLI A;  5HAR A;  2V1B A;  4DE3 A;  3HJI A;  2VV8 A;  4D2O A;  2YKF A;  5DF8 A;  2UWX A;  4S2N C;  4A5R A;  2V0U A;  3UPO A;  2DCF A;  1MY8 A;  2G2W A;  3IS2 A;  2Y2L A;  3D4F A;  4S2N A;  1ESI A;  5EPH A;  1ACF A;  3IF6 B;  4GN2 A;  1LI9 A;  1SKO B;  1HLU P;  4R4S A;  4N1H A;  4NKP A;  4LLO B;  4MBK A;  4JGO A;  3QP6 A;  1ZC2 A;  1BSG A;  2ZQ9 A;  4WMC A;  3IXH A;  3A0S A;  4D60 A;  5IT5 A;  3T4L A;  5F1G A;  2V1A A;  4EV4 A;  3UPP A;  1M40 A;  4MBH A;  3O86 A;  1WE4 A;  3ZVT A;  3MKE A;  4HH2 A;  5CHJ A;  3G32 A;  1G6O A;  3JYI A;  1K6R A;  3QP5 A;  1YLW A;  3KO6 A;  3ZQ5 A;  1SKF A;  2Y91 A;  2JC7 A;  4X1M A;  5CHU A;  2XK1 A;  3NOT C;  3IWI A;  2P08 A;  2XQZ A;  3VMA A;  4G3K A;  4X55 A;  1CQA A;  4WL9 A;  4GOG A;  4HBT A;  1S4S A;  2P9V A;  1ES4 A;  1K54 A;  4GS9 A;  2NUT C;  5A90 A;  4KZ8 A;  3N6I A;  4WBG A;  3F1O B;  4QD4 A;  2M1C A;  2WKE A;  2W3G A;  3IF5 A;  3JPU A;  5EM0 A;  3SS3 A;  2EWW A;  3SS5 A;  5DF7 A;  1I5Q A;  3E4Q A;  3ZGA B;  4KG5 A;  4KZ5 A;  2VX8 A;  3IXB A;  5HAQ A;  3OPP A;  1ONG A;  2L0W A;  1BLS A;  2ZD8 A;  3A3J A;  4I3I A;  3RJU A;  3B33 A;  5F1F A;  4GLQ A;  4JF5 A;  1NLY A;  3S7Q A;  1XFN A;  4QWO A;  3NJA A;  3T1X A;  5EM1 A;  5L07 A;  3U2A A;  2VZW A;  2PYR A;  3N8S A;  1Z6F A;  4BJP A;  3NY4 A;  2HP6 A;  3T4J A;  3UB9 A;  2Y79 A;  3UB5 P;  5CGW A;  1NXY A;  5J7E A;  2CMN A;  1K54 C;  1L2S A;  2VGK A;  2EXA A;  4ZJ3 A;  1FCO A;  2A3U A;  4ZTK A;  1TD5 A;  1LL9 A;  2ZC3 B;  1WA9 A;  1VEU A;  3AGD A;  3GV9 A;  2IWD A;  1I2S A;  4MDZ A;  1PWC A;  3UPN A;  2JN7 A;  4EXO A;  4EW7 A;  3BEC A;  1F98 A;  5CTM A;  2J80 A;  3VFF A;  2J3T D;  5FQJ A;  1GHM A;  3VOL A;  4P6Z S;  1FIL A;  1T1A A;  4DE0 A;  3ZG5 A;  5EV0 A;  5AVF A;  4RX2 A;  2ZQ7 A;  3LIB A;  3OPH A;  4MCW A;  1QME A;  3O88 A;  3S7P A;  1YAX A;  1YLP A;  5GHY A;  3VOZ A;  4OQG A;  5HDC A;  3H82 B;  3OCL A;  4HJ3 A;  3DBA A;  3UDI A;  4N92 A;  2W3E A;  4HNB A;  2WK0 A;  2Y2J A;  4ARZ B;  4GD8 A;  2FFF B;  2PR5 A;  5JYP A;  1OTE A;  2DNS A;  4KZ3 A;  2XR0 A;  2P9V B;  4PM8 A;  4WLA A;  4G3W A;  2Y2P A;  3PBQ A;  4QU3 A;  2XEP A;  4LEN A;  4H8R A;  4I3A A;  1OME A;  1GA0 A;  1HZO A;  1M6K A;  3LR3 A;  4S2J A;  1L3L A;  4DDS A;  2XFT A;  5F82 A;  5TGF A;  1BYW A;  5CED A;  5FQI A;  4IUH A;  1ERM A;  3BW6 A;  1OPX A;  3MJQ A;  4LGW A;  3B47 A;  2HDQ A;  3KYE A;  1GHI A;  5GHZ A;  1PNE A;  1L0D A;  2FH5 A;  2Y2O A;  3SH7 A;  1IOU A;  5CHM A;  1KE4 A;  5MC7 A;  4PKY A;  1BLC A;  3R7W A;  3OPR A;  3UME A;  2G2U A;  5E43 A;  3FV7 A;  2ZMV A;  1MXO A;  4E6W A;  2OWJ A;  3LIF A;  4Y0U A;  1ZTU A;  1PWD A;  4LV0 A;  5HSQ A;  2IWC A;  1VQQ A;  5EE8 A;  2BG1 A;  4KUK A;  3GRJ A;  1KVL A;  1PIO A;  1RCJ A;  1SDN A;  2W3D A;  2EXB A;  2VV7 A;  3K2N A;  3V5M A;  2H0Y A;  4L9E A;  1L0G A;  3ULF A;  3EGX C;  3CPT A;  5M18 A;  4S2K A;  4ZJ1 A;  2J3T C;  3BQA A;  4C3Q A;  5G4Z A;  2ZMA A;  1KVM A;  1H3Q A;  1SHV A;  3VP0 A;  4R38 A;  3ZVW A;  1T18 A;  4E04 A;  1X0O A;  5DTT A;  5CX7 A;  5EOO A;  2INW A;  1ES2 A;  2PT7 A;  3FG8 A;  2WUQ A;  4RVA A;  1FSW A;  1IEL A;  4GS9 B;  1STZ A;  4OOM A;  4LCL A;  2DMW A;  4HEF A;  2R9X A;  2CC1 A;  2PU2 A;  4NET A;  1T1B A;  3S7N A;  1MWT A;  4B4Z A;  1JTG A;  2ZC5 B;  5TJJ A;  3IF6 C;  1S67 L;  4O7D A;  1IYP A;  1BZA A;  3HLC A;  1DJA A;  2ZJ9 A;  3P98 A;  3VE3 A;  4E3N A;  1VET A;  2J3W A;  2JBF A;  2XFS A;  4NXF A;  1YSP A;  1MKM A;  2UV0 E;  1YLT A;  4DN0 A;  4E3J A;  1G6A A;  1P9W A;  4HOI A;  1RP5 A;  4CLC E;  5FI2 A;  5U47 A;  3D72 A;  3HLE A;  1VET B;  2QPN A;  4OPQ A;  4MN5 A;  4KUO A;  3MXS A;  1K6S A;  1LHY A;  4Y7P A;  2W0N A;  4GNU A;  2VGL S;  5G4Y A;  4I38 A;  5EVI A;  5JYO A;  3GQZ A;  5A91 A;  4ZAM A;  2JKR I;  2B02 A;  3NHQ A;  1BT5 A;  3W2Z A;  4GD6 A;  3OLO A;  1DJB A;  2O9C A;  4NG2 A;  1TEM A;  3UDF A;  3PYP A;  4KZA A;  2Y2H A;  4KEN B;  4JXG A;  2JKT I;  5HD5 A;  4WM9 A;  1N9L A;  5AQA A;  3EEA A;  4NXG A;  4K0X A;  3G6O A;  3DWK A;  3G34 A;  1MWU A;  1TS7 A;  3OBF A;  3WS5 A;  4BD0 A;  4EBP A;  1SDE A;  1ALQ A;  1A0K A;  4KZ9 A;  3WS4 A;  2WYX A;  2ZOI A;  4EBN A;  5AQ9 A;  1W63 M;  1K0K A;  2OOL A;  5FQ9 A;  3G2Y A;  1SZV A;  1FCN A;  3NI9 A;  3UMD A;  4P0M A;  1F9I A;  2ZL1 B;  1TF1 A;  3Q07 A;  4ESP A;  4OVD A;  4M4X A;  1NYY A;  1IKG A;  5AQ7 A;  5D3O A;  3C4O A;  3HLG A;  3QNB A;  5DTK A;  5GL9 A;  1KGG A;  4BLM A;  3A0R A;  2J8Y A;  2ZC4 B;  3IH8 A;  2PYP A;  4E3K A;  1P9R A;  1K4F A;  3KX0 X;  4QY6 A;  1D7E A;  2QJ7 A;  1S4R A;  1OT9 A;  4E3O A;  4DXB A;  2WGW A;  4EUZ A;  1FCM A;  5KMW A;  5HL1 A;  4KG2 A;  5HD3 A;  5FQM A;  2WKQ A;  4CJN A;  3KSG A;  1EI5 A;  1N9N A;  2PBD P;  3BFD A;  3IQA A;  4GKU A;  2A24 A;  3A0V A;  1CEG A;  3A3I A;  3MFD A;  1DY6 A;  2B18 A;  2PAV P;  3EOI A;  3T12 B;  3PBS A;  4MBF A;  4QY5 A;  3KSH A;  4S2M A;  5F6A A;  2V0W A;  3IWQ A;  3OZH A;  5E2E A;  5EVE A;  1F2K A;  1P97 A;  5J3W A;  1L0E A;  2WKI A;  3HLD A;  3RTY A;  1UWP X;  4ME4 A;  1NY0 A;  1DP9 A;  4BQM A;  5HAI A;  4GCZ A;  3ZNT A;  1W5D A;  1HVB A;  3E0Y A;  3C2W A;  3CIT A;  1PZP A;  2WZZ A;  1SKO A;  4E3I A;  4EU0 A;  2H0T A;  4HP9 A;  3SS4 A;  5HW3 A;  4OPY A;  5EVL A;  3T50 A;  2V20 A;  4HIA A;  2XRN A;  2V8C A;  3NDE A;  5GLA A;  2BTF P;  4AFI A;  3JVU A;  5GLB A;  4OLG A;  4Y3I A;  3V39 A;  2WAD A;  2EX6 A;  4BMW A;  4QJG A;  3PBO A;  1UGU A;  2XD5 A;  1MKI A;  4CPK A;  3R4K A;  1C3B A;  3CI6 A;  4BL2 A;  1LSV A;  4BWI A;  3BQ8 A;  4P6B A;  3JVV A;  3GMW A;  2ZQC A;  2PBY A;  5CXW A;  3EGD C;  3UDX A;  4B9O A;  3CPT B;  1DJC A;  1YPR A;  3LR5 A;  3N8R A;  2OLU A;  4B88 A;  1ERQ A;  4EQ1 A;  3QP1 A;  5HZH A;  3NEC A;  3PBT A;  2W1T A;  4PM7 A;  3B3X A;  2WGI A;  3NUL A;  5FI6 A;  3G30 A;  3WWX A;  2QZ6 A;  1YMX A;  4HJ6 A;  1ZKJ A;  3WS0 A;  4OOL A;  4GDN A;  4OLD A;  2V2F F;  3GSG A;  3S7O A;  3WRT A;  2Q9N A;  1MWR A;  1LL8 A;  2EWV A;  3DTK A;  2WGW B;  4Q8I A;  2XA7 S;  4WEK A;  3BFE A;  4R3B A;  4DMZ A;  4NXE A;  4UEY A;  5HWW A;  2IWB A;  3BLS A;  3ZG9 B;  4PM9 A;  3TSG A;  4S2O A;  1H8Z A;  4U0X A;  3DTI A;  5TR7 A;  3B42 A;  3ICY A;  2AVX A;  3IWO A;  4JGP A;  1OTA A;  3Q7V A;  4JPM A;  1LI0 A;  1W8Q A;  3GDI A;  3SH9 A;  3AGE A;  1PRQ A;  4GHI A;  2HP5 A;  2P74 A;  5CGS A;  3FYZ A;  2Q9M A;  2HV1 A;  3A3D A;  4N1X A;  2ZL1 A;  4HP4 A;  2ZBB A;  3C5A A;  3NDG A;  3RXX A;  2PRF A;  1GHP A;  1TDG A;  1XX2 A;  5CER A;  3PHY A;  2OWH A;  2HP9 A;  3MMH A;  4P6Z M;  3E4P A;  3TW8 A;  3HBR A;  3VFH A;  2VGJ A;  3ZFZ A;  5FAT A;  4DRT A;  3HUO A;  2XLN A;  3VP4 A;  4LPZ A;  3BFF A;  1PW1 A;  2L4R A;  1FR6 A;  4KQO A;  2QWS A;  4IVK A;  4N9K A;  3C7V A;  4CQH A;  3LI8 A;  3WS1 A;  3L9K A;  3IX3 A;  4YWZ A;  1K55 C;  4P85 A;  5FEG A;  4WZ5 A;  2W3F A;  3R7W B;  3LUQ A;  3C7U A;  2EA9 A;  3DTM A;  5HAP A;  4I39 A;  3OPL A;  2ZOH A;  4F3L B;  4O01 A;  1NZU A;  2ZM8 A;  3LCE A;  3NCK A;  2X01 A;  3E98 A;  4IED A;  2KOI A;  4FTX A;  2Y2N A;  1JWP A;  2LB5 A;  3H7W A;  4ZRR A;  5EFW A;  1VEU B;  3V3S A;  3HVF A;  3WRZ A;  4JBF A;  3MR0 A;  3BLM A;  2WZX A;  3IF6 A;  2W27 A;  2H28 A;  1ERO A;  3F1O A;  5A93 A;  2JKF A;  3M6B A;  3H9W A;  4N9L A;  3VV4 A;  4LCM A;  4MN7 A;  4HES A;  3MBZ A;  4YIN A;  4ETZ A;  1CI8 A;  4NXB A;  3ZYT A;  1K56 A;  3PXP A;  2O9A A;  4IVI A;  4GJ4 A;  3LEQ A;  3LY3 A;  3UNW A;  4QHC A;  4Y0O A;  4FOF A;  4OPR A;  3MZE A;  3A3F A;  4OPZ A;  5CTN A;  3V67 A;  2GNX A;  2HJE A;  3MQQ A;  1N9O A;  3CHW P;  2HJ9 C;  3Q7Z A;  4BEN A;  3MS6 A;  2ZLY A;  2V1Z A;  5M1A A;  1BLH A;  1AXB A;  2GZA A;  4C6Y A;  2K7S A;  4DJ3 A;  3S1Y A;  3IX4 A;  3LID A;  4BL3 A;  3UE1 A;  4IUK A;  2HDU A;  1I2W A;  3G2Z A;  2GJ3 A;  3UB8 A;  4FCF A;  3GR2 A;  1IEM A;  1XGJ A;  2W1R A;  2EX2 A;  2EFU A;  2XF3 A;  4U3T A;  5L10 A;  4L0L A;  4HY8 A;  3FKV A;  4HQA A;  4HI4 A;  2XGN A;  4ID4 A;  2PDR A;  3NBL A;  5AJG A;  1QMF A;  3IXG A;  4E3M A;  1JNU A;  3VP1 A;  1WYC A;  1NWZ A;  4O8G A;  2VK3 A;  4U0T A;  3BFG A;  2HDS A;  4WYY A;  3IHA A;  3MZD A;  4X53 A;  2Y4A A;  4FH2 A;  4MNR A;  4FSF A;  5I5L A;  3W4O A;  3W8K A;  3T4Q A;  2V8F A;  2PR6 A;  3CWF A;  3ZG8 B;  5HPI A;  3UE3 A;  2Y2I A;  1FQG A;  4PHT A;  3RFB A;  4KZ4 A;  3BY8 A;  3TOI A;  1FR1 A;  2QKP A;  5DKK A;  4XUX A;  2KDK A;  4X68 A;  4B93 A;  4LV3 A;  3IX8 A;  3CAX A;  2Q0O A;  3Q81 A;  1JWZ A;  4YFM A;  2EX8 A;  4WUJ A;  1TVF A;  5F83 A;  1MPL A;  1OTI A;  1PI4 A;  1G68 A;  2D01 A;  1V9Y A;  5G18 A;  3O87 A;  4IJG A;  5E2H A;  4KZB A;  1MBL A;  1O7E A;  1BTL A;  1CK3 A;  4I5S A;  1Q2Q A;  4EEU A;  1BLP A;  2HF6 A;  3Q1F A;  1N9B A;  5L2F A;  1NYM A;  3MQO A;  3PBR A;  3TG9 A;  2HPB A;  5FAO A;  2J9O A;  2M7V A;  4WEJ A;  5HX9 A;  5TBM B;  1XJ6 A;  3ISG A;  2O9B A;  5HWT A;  4EES A;  1HD8 A;  4UA9 A;  1XA1 A;  3ZNY A;  3P7N A;  4LRZ E;  2QMI A;  1JTD A;  1F5M A;  4P87 A;  3FC7 A;  3FKW A;  4JXS A;  4UQI M;  5A92 A;  3BRM A;  1NJ4 A;  4HBU A;  1TS0 A;  2KX6 A;  4IBR A;  1ZG6 A;  3BM6 A;  5EVI C;  4UA6 A;  3SH8 A;  2XD1 A;  1E3U A;  4ZBE A;  1H0M A;  1NRJ A;  2J7V A;  4JF4 A;  1NRF A;  1KE0 A;  1ZHH B;  3MSH A;  5DJU A;  5FEF A;  4MMN A;  2Y8H A;  1YKD A;  2W1T B;  4GW9 A;  5FAP A;  1OJ5 A;  5GHX A;  4EBL A;  1XGI A;  2OAQ 1;  3V3R A;  1PYY A;  3G35 A;  1MWS A;  1VM1 A;  3NC8 A;  3TJZ C;  5DJT A;  3C8C A;  3SW1 A;  5GLD A;  1N4O A;  4PPR A;  4R6L A;  4OP5 A;  2JKT M;  5FQK A;  3HRE A;  1W63 Q;  4CLC C;  4RQ9 A;  3BFC A;  4X25 A;  1YT4 A;  1Y54 A;  3PAG A;  3BEB A;  3V50 A;  1OJG A;  4R0Q A;  3DW0 A;  1HTZ A;  4R4R A;  3W4P A;  1H8Y A;  3D3O A;  1XXM A;  5EUA A;  4LV1 A;  5IU1 A;  2VJW A;  3SOI A;  4KQR A;  4O0P A;  4PM5 A;  1UWN X;  2J9P A;  2NUP C;  1RGY A;  1LT0 A;  1KGF A;  2ACG A;  3IT9 A;  1K57 A; 
#chains in the Genus database with same CATH homology
 1VEU B;  1PNE A;  3CPT B;  2BTF P;  1ACF A;  1YPR A;  2PRF A;  3T12 B;  3U4L P;  1FIL A;  3T1Q B;  1PFL A;  1A0K A;  1VET B;  2B95 A;  1FIK A;  3MSH A;  5EV0 A;  5FEF A;  2V8F A;  1D1J A;  2V8C A;  1AWI A;  1SKO B;  1HLU P;  1Y4O A;  2E8J A;  3D9Y A;  4X1M A;  3CPT A;  1VEU A;  3NEC A;  1CJF A;  1K0K A;  2JKG A;  2VK3 A;  3DAV A;  1PRQ A;  2HZ5 A;  1SZV A;  3L7H A;  3UB5 P;  2PBD P;  3CHW P;  3L9K A;  4QWO A;  5EM0 A;  1Z09 A;  1SKO A;  3T1X A;  5EM1 A;  1G5U A;  4X25 A;  1VET A;  2ZL1 B;  3LGO A;  3LEQ A;  3MS6 A;  3NUL A;  2JKF A;  5EVE A;  4ESP A;  3T1S A;  1F2K A;  2ZL1 A;  3T1R A;  4X1L A;  2ACG A;  1CQA A;  1J3W A;  4FTX A;  4D60 A;  4FUW A;  2PAV P;  5FDS A;  3KYE A;  5FEG A;  1CF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...