2JKGA

Plasmodium falciparum profilin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
165
structure length
165
Chain Sequence
YSWDSYLNDRLLATNQVSGAGLASEEDGVVYACVAQGEESDPNFDKWSLFYKEDYDIEVEDENGTKTTKTINEGQTILVVFNEGYAPDGVWLGGTKYQFINIERDLEFEGYNFDVATCAKLKGGLHLVKVPGGNILVVLYDEEKEQDRGNSKIAALTFAKELAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN
publication title Structural Basis for Parasite-Specific Functions of the Divergent Profilin of Plasmodium Falciparum.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Protein binding
total genus 45
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2jkgA00
1J3WA 1F2KA 3UB5P 3T12B 2VK3A 2E8JA 3MSHA 1CF0A 1VEUA 3CPTA 1CJFA 2PRFA 1VETB 1SZVA 4QWOA 2PBDP 5EVEA 3LGOA 3U4LP 1FILA 3NULA 4FTXA 3T1QB 1PFLA 5EM1A 4X25A 3L7HA 2ZL1B 1VEUB 5FDSA 3CPTB 1HLUP 3D9YA 1K0KA 2JKGA 3CHWP 1Y4OA 1FIKA 3T1XA 2JKFA 2V8CA 2ACGA 1A0KA 1AWIA 5EM0A 5FEFA 3L9KA 4FUWA 1CQAA 2PAVP 2V8FA 2B95A 2HZ5A 4X1MA 1SKOA 5FEGA 3T1RA 1PRQA 4ESPA 1PNEA 2ZL1A 1D1JA 1ACFA 2BTFP 3DAVA 3T1SA 3NECA 1YPRA 3KYEA 1SKOB 5EV0A 3MS6A 3LEQA 4D60A 1Z09A 4X1LA 1G5UA 1VETA
chains in the Genus database with same CATH superfamily
4RVAA 2W3HA 1TS7A 1F2KA 4HQAA 1W7FA 1CF0A 3HLWA 4GCZA 2ZM0A 3NY4A 3UE1A 2HP5A 2WYXA 3TJZC 1BYWA 1CJFA 1M40A 1SZVA 3ZG9B 4IJGA 2GJ3A 3HLDA 2XSSA 5FI6A 2VGLS 3FPWA 4R3JA 2C6WB 4LLOB 3C30A 1CEGA 1H3QA 4WMCD 1Q2QA 5I94A 1Z6FA 2WADA 4KZ7A 1ZKJA 3E2KA 4OOMA 1ZTUA 1G6OA 2RCXA 3B3XA 3QP8A 2QWSA 4DF6A 4AFIA 3DWKA 5CERA 5E2HA 3OPPA 3QP4A 1C3BA 4HY8A 1J9MA 2EA9A 3ZDJA 2EX8A 1FR1A 1TVFA 4P6ZS 3PAGA 4UHUA 3QP1A 1TS0A 2NUPC 3VP3A 4JF5A 4LRYC 4B93A 4E3IA 3HUOA 1T1AA 4L9EA 4IVIA 1K38A 1XA1A 5M19A 5E43A 4EUZA 1ES4A 2Y2HA 1OTAA 4MBHA 4QPRA 3UE3A 1LI9A 2XD1A 3ZG5A 5EVID 3PBTA 3BW6A 2GX5A 2VK3A 4ZAMA 4FH2A 5G4ZA 4GLQA 1K25A 1LSXA 3EEAA 4LRZE 3UB9A 1TS6A 5HX9A 4OLGA 5C5KA 4QWOA 3T4OA 5F69A 1HZOA 2FH5A 2ZQ9A 4DDSA 1MWTA 5EVIC 3MZFA 4MN5A 5DFYA 2P9VA 2FFYA 2RL3A 4Y13A 2JKGA 2KOIA 2PR6A 4M4XA 4DE2A 2B02A 1TEMA 3UMEA 3D4FA 1OTDA 4EU0A 5GHXA 1KOUA 3H9WA 4Y7PA 3LIDA 2HDSA 3D72A 4E3NA 1TS8A 4KZ8A 4WZ4A 5AQAA 4X56A 4O7DA 2DRWA 3F1PB 1BTLA 3VP1A 4WELA 1VB6A 4GD8A 4PM9A 3I7JA 3DTKA 2Z6CA 3JVUA 2HGVA 4BQMA 1F9IA 5HDDA 4ZDXA 2HZ5A 3GQZA 1KGEA 1G28A 1XJ3A 1N9LA 1PNEA 5DTTA 2OOLA 1PZPA 2PHYA 1ACFA 2O0YA 4S2JA 4R3BA 2QZ6A 1YPRA 4EEUA 3CUEC 4II7A 2QKPA 4C6YA 2QMIA 4MNRA 3P7NA 1DY6A 5FQIA 1YSQA 2ZM2A 1MXOA 1WYBA 1FOFA 3IWQA 3RTYA 3N4IA 1LLBA 3W4PA 4B4ZA 4HP4A 1W8QA 1P9RA 3LIAA 1D7EA 1FSWA 5FQMA 3VSKA 2A24B 5A8BA 3IWIA 1JNUA 3NULA 1OT9A 3A0SA 3GR2A 3L7HA 2WGIA 4EBNA 5EUAA 4IBXA 4IUKA 3T1XA 2XH9A 1FCMA 2ZBBA 2ZQ7A 2V9AA 1ES2A 4N1HA 2V2FF 2VA0A 1K4FA 3U2AA 2K31A 5EVIB 3EWKA 4ZJ3A 5F5YA 3WS0A 3M2KA 1XX2A 1RP5A 2VJWA 2R78A 1Y54A 4K0WA 2C5WB 2H10A 4S2NA 3IT9A 2EX6A 1RGZA 3QP6A 4KG6A 4IUHA 2W3EA 4N9LA 4B88A 2P7JA 2EXAA 4OPQA 3F1OA 4EEPA 1NY0A 2P9VB 1EWZA 3HLEA 1XA7A 2J3WA 4P0MA 4EETB 2XFTA 1K56D 4QD4A 4OONA 4S2NC 4X1MA 3FG8A 3T1RA 2JKTM 2HP9A 4PPRA 3UO9A 3Q7ZA 4HH3A 3G6OA 2WGWA 2ZC6B 5CGWA 1UWNX 5E2FA 4MEZA 3SS5A 3HLBA 1NRJA 4FH4A 2ZM8A 1ALQA 4X69A 4JGRA 1BLHA 3Q1FA 3PXPA 1LI0A 1E4DA 4DE3A 4E04A 5TBMB 1SCWA 1JWVA 4F94A 3T50A 4PKYA 4Q0HA 1PW1A 1ERMA 3H7WB 3N8LA 4E3MA 3TW8A 3LY3A 5CGXA 2OSUA 2J80A 5CHUA 2XGNA 3HVFA 3T4TA 4HHDA 5EECA 2A49A 4N9KA 5GLDA 5HWTA 3ZFZA 3GMWA 1H8MA 2Q9NA 1LL9A 2W0NA 3AGFA 4CLCE 4Y0UA 1CK3A 3IX3A 4GS9A 3Q82A 2K7SA 3C2WA 3Q7VA 4IHQA 3MFDA 4CLCD 3CAXA 4P6BA 2OV5A 2D01A 4EBPA 5GLAA 3LR5A 1NXYA 2H5SA 2JCHA 4HESA 2R9WA 5FATA 4MLLA 2ZC5B 3ZG0A 5MC7A 3RXXA 4E6WA 1UGUA 3BLSA 3ZGAB 2Z6DA 4WUJA 5HD3A 3ULFA 4HH2A 5FEGA 3MQOA 3F1NB 2WKQA 4CLCC 4MBKA 4S2OA 3S4XA 4LPZA 3TG9A 1JTDA 4MDZA 1SDNA 3UE6A 3ZNYA 3LEQA 1W63Q 3BECA 5KSCA 2V1AA 5E2GA 4EESA 3HJKA 2XA7M 4B4XA 5IU1A 4YNRA 3RXWA 3VSLA 3TE8A 3IX4A 3SZTA 4HJ4A 4EQ1A 2PRFA 4WEJA 4PMAA 1CI9A 3QNBA 1YMSA 2WKRA 1YLWA 5F83A 3A0VA 3DTEA 4XT2B 4DE1A 4KQDA 2YKFA 3EQVA 4Y15A 2ZC3B 1Y4OA 1HVBA 2KX6A 4OP5A 3FWLA 2Y79A 2HJEA 2ZC4B 4GDNA 2ACGA 2CMNA 1U60A 4E6XA 1MBLA 5J3WA 1GCEA 4F3LB 3SH7A 3UY6A 3CJMA 1H8YA 4L9FA 3S7PA 3Q81A 3OPRA 4BENA 1MKIA 4EWFA 3W8KA 4KZAA 5FEFA 2W27A 5HPFA 4HNBA 3IQAA 3E4QA 4GJ4A 1YLYA 2J7VA 3G32A 4BL3A 1CQAA 2WZZA 3BQAA 4NKPA 4RYEA 3EGDC 2OAP1 3NC8A 4UAAA 5DKKA 5F68A 1BLCA 3KSHA 2B18A 4R3AA 2O9BA 4JPMA 3V39A 1K54C 1BUEA 2JN7A 2NUTC 2PU4A 4U0TA 1EROA 3NOPC 3PTEA 1K55C 2HJ9C 1OJGA 4L0LA 2VGLM 4R0QA 5L09A 4CLCB 4JF4A 4BWIA 4S2LA 5FASA 3FYZA 4EERA 4FSFA 2G2UA 4LENA 4BLMA 4KENB 5DJUA 3N8RA 3C4OA 3UPPA 2ZD8A 2L4RA 2FZ0A 2XFSA 3HLCA 4ARZA 5FDSA 3W2ZA 3WRTA 1L0FA 1EI5A 2Y2KA 3ZCZA 3HREA 5AQ9A 3WS4A 5CTNA 1IYOA 4GKUA 4BBUA 3F1PA 3JVVA 4GZBA 5GL9A 4HOIA 4P6ZM 2WZXA 4PM7A 4R70A 2ZQDA 3HL9A 5AQBA 2VEAA 4GOGA 3UDXA 4WMCA 1ONHA 1ZG4A 2H0TA 5DKLA 1PWGA 4FD8A 1X0OA 3CI6A 1ESUA 3BFGA 1I2WA 2IWBA 1BLPA 5FSRA 4UA7A 3LEZA 3ITAA 3VOZA 2BTFP 2X01A 3T1SA 4LRXC 1XJ6A 4RX2A 4OQIA 1PI5A 2PR5A 5FA7A 5F82A 2I72A 3BJNA 4E3LA 5BOHA 4XUXA 2A24A 4KZBA 4XUZA 1G5UA 1RCJA 2W3DA 1DJAA 3PBSA 3OPHA 3TRCA 3MXRA 1FCOA 3D3OA 5HDCA 1LSWA 4LCMA 3TOIA 5JYPA 2Y2GA 1ERQA 4GW9A 4RX3A 4LFUA 3MXQA 5CHMA 5J8XA 5HZHA 5EVEA 4NEED 3KSFA 4JGPA 4KQOA 3NDEA 3T1QB 3IH8A 1S4SA 4BBVA 2L0WA 4GN2A 4QU3A 3CPTB 5EVIA 1YLTA 5TGFA 4QY6A 2PU2A 5CEDA 3FV7A 5A90A 1GSVA 2G7UA 4MN6A 1N9OA 1YSPA 4EQIA 1BSGA 3K2NA 1PWCA 2WK0A 1XKZA 4OPRA 4NXEA 4DE0A 1IKGA 1LL8A 3VFHA 4IVKA 1TD5A 1KVMA 4JLFA 1GSWA 1IEMA 2HPBA 1HD8A 3SW1A 1ES5A 2P08A 3S7NA 2M7UA 4K0XA 4JXWA 4ARZB 1F98A 1PWDA 4FOFA 3IBRA 2R9XA 3MQQA 2QYBA 2Y91A 3N8SA 2WKEA 3A3FA 3O88A 5TBMA 3DWZA 5K5BA 3EOIA 3IXBA 2O9CA 2MJ6A 1JTGA 1XPBA 3H7WA 3UE0A 3OBFA 4K08A 1RGYA 1L0DA 4LV1A 3CUEA 3E4PA 4EV4A 1W5DA 5EFWA 2P74A 4YINA 4B9OA 3QP5A 4PM6A 3ISGA 3IF6A 3O87A 4NXFA 4R1GA 3MR0A 2PT7A 3CZDA 3UNWA 2ZOHA 1ZG6A 1VEUB 3IF6C 3S7QA 3P01A 2DNSA 3GVBA 5AVEA 2V8CA 3C38A 3VOYA 5D3OA 1KGFA 3NIAA 4E3JA 3HJIA 1YQSA 1A0KA 5IHVA 4ETZA 2X71A 1WE4A 4NETA 4O8GA 3E4OA 1JVJA 5HL1A 3W4QA 2XROA 3T4KA 2Q9MA 1L2SA 5CRFA 5FI2A 2H28A 5HAIA 2Y2LA 2OLUA 4DKIA 3F1NA 4BJPA 5CHJA 1IELA 3E2LA 2JKRM 4KZ6A 2V8FA 1GA9A 4K91A 4U0XA 2ZQCA 2UWXA 1YLZA 4JXSA 5IS1A 5U47A 1DP9A 3UPOA 1NLZA 3AGEA 2PDRA 1K6RA 5EOEA 5HWVA 1T1BA 2HDRA 1O7EA 4ZJ2A 5M18A 4GNUA 5EPHA 2GNXA 2WAFA 3H82A 1SHVA 4GDBA 2VKSA 4KG5A 4R6LA 3PAEA 5CEBA 2DMWA 2Y2OA 3P98A 4EXOA 1K56A 4XT2A 5GLBA 3FPVA 1N9NA 2X02A 2WKPA 2W1TB 2V1ZA 4X68A 3OCNA 1NZUA 5HFOA 1FILA 4I39A 5AVFA 4HBUA 4F3LA 3BWLA 1LSVA 1ESIA 1HLUP 3MXSA 3NI9A 4ZTKA 3GSGA 4Z1WA 3T4LA 2JKRI 5HSQA 3BY8A 3K3CA 3GRJA 5IT5A 5L2FA 5EM0A 4DN0A 2I9VA 3JYIA 3MJQA 3JPUA 1YLJA 4BMWA 3O5YA 3EGXC 4I3IA 3IXHA 3IF6B 4ETXA 4DXCA 4JBFA 4LCLA 5HW3A 3HBRA 3TSGA 4MMNA 3M2JA 5DVAA 1ONGA 1OJ5A 5CX7A 2GDNA 3T4QA 1YT4A 5HPIA 3A3EA 3E0YA 3LY4A 3IX8A 4QB8A 2ZQAA 4R4RA 3LIBA 1NLYA 3UMDA 3B33A 2V1BA 1PRQA 2ZMAA 1LL5A 5CGSA 1L0GA 5FI7A 4DMZA 3DAVA 3R7WB 4CLCA 5GHZA 3LCEA 1GHIA 5KSHA 4FCFA 5AJGA 2P04A 4I5SA 4OPYA 3ZYTA 4X1LA 1KGGA 4EUVA 4X6TA 4H6JA 4UA6A 3A0RA 3ZG7B 2BG1A 4LV0A 5DF8A 3GV9A 1P9WA 4JKTA 2V0UA 3B42A 3U4LP 3KYZA 2PD8A 3NOUC 1VM1A 5EM1A 4QJGA 2EFXA 1OTIA 3OCLA 3OOVA 1QMFA 2JKFA 3H82B 3PBNA 2D02A 3UB8A 3HCYA 3DTIA 1S1YA 5LBRA 5CECA 1LT0A 3C7VA 4RA7A 1KE0A 4KQRA 4ME4A 4PM5A 4G3VA 1K57A 4S2KA 4NK3A 4PAUA 1AXBA 3PR6A 2Z2MB 4S2MA 4E3OA 1XGJA 1O07A 3RJUA 2K2NA 4DRTA 3R4KA 4MN7A 1N4OA 3VP4A 1GSXA 4ZBEA 1K57C 4JXVA 1S0WA 3T4JA 1KE4A 3A3IA 3M6HA 4OOLA 4UA9A 5E2EA 3OPLA 3G35A 4MCWA 2ZMFA 4HJ6A 3MS6A 3B47A 3O3VA 1IYSA 1K54A 3BFDA 1KDWA 1I5QA 3PBQA 4GD6A 1Q2PA 3UDFA 1H0MA 1G68A 2EWVA 2UV0E 3PYPA 2JBFA 5A92A 1K55A 2EX2A 5CTMA 3CPTA 1VETB 4OH0A 3BFCA 4BL2A 2QJ5A 4Z9QA 1ODVA 4UQIS 1PFLA 1VHMA 1PI4A 4R4SA 1SKFA 4XXRA 3V3RA 3LI8A 1STZA 4NXBA 2XLNA 3CMZA 5F1FA 2CC1A 4H6JB 3RFBA 3OC2A 3OLOA 1Y28A 3V50A 5HWWA 3ZQ5A 1F5MA 1NZOA 1HTZA 1DRMA 1OPXA 4OLDA 1ES3A 3BM6A 3ZHHA 4MBFA 2Z2LB 1P0ZA 3N6IA 3IS2B 2EFUA 3RH8B 1L0EA 4Y2FA 5DF7A 1K6SA 3S7OA 1MC0A 4WZ5C 2O99A 3VE4A 3VOLA 2XDMA 4OQ0A 5DTKA 4PKYG 2ZOIA 3MKEA 4N1XA 2JE5A 3MZEA 3GTCA 5TR7A 3A3DA 4X55A 3UDIA 4JGQA 2ZQ8A 3QHYA 3ZG8B 4IEDA 3NECA 4Y0OA 3VFFA 3SOIA 4I38A 2WKIA 3BEBA 1MPLA 5HARA 4KZ5A 4G3KA 3VP2A 4X53A 1WA9A 2IWDA 3MSHA 2E8JA 1PYYA 3SS4A 3EQUA 3MFXA 4OKPA 4QY5A 1NWZA 3LO7A 1VEUA 1FQGA 1M6KA 3V5MA 3KYQA 3S1YA 1T18A 3FKVA 2VX8A 3C4PA 1MWUA 2XR0A 1MZUA 2PD7A 4Q8IA 4X25A 4OQGA 3PBOA 2OAQ1 5KIZA 4HEFA 2KDKA 3D9YA 2M1CA 5F1GA 4I3JA 5AQ7A 2Y2NA 3K3DA 1W79A 4Y3IA 4HIAA 1D06A 5EOOA 4S2PA 5HAPA 4GHIA 4M3KA 3MZDA 2YKHA 5J4EA 4Y5FA 1TDGA 3LR3A 1VQQA 4OP8A 4EBLA 4KG2A 2HP6A 1OMEA 1E25A 2XF3A 3NBLA 3UB6A 1IYPA 4DJ2A 1OTBA 3MMHA 4Q0JA 2XK1A 1S4RA 2EX9A 3G2YA 4Q0IA 4OPZA 4WYYA 3IF5A 3KYEA 1SKOB 4YFMA 2A2LA 3HUMA 1K4EA 1PZOA 3MF0A 2Y4AA 3OZHA 1UWPX 4L9GA 2W1TA 1FR6A 3IHBA 4HBTA 3UB5P 2Y55A 4PHTA 3G2ZA 3G30A 4WM9A 1IOUA 3KO6A 1PIOA 3WRZA 5L07A 2V20A 3W4OA 2B5RA 5EE8A 5A91A 1I2SA 4LV2A 4FTXA 4RQ9A 3IWOA 3DW0A 1P97A 3IBJA 3FC7A 2PBYA 5HDSA 2VV8A 3BFFA 1KE3A 4KUKA 1DP8A 3N7WA 2IWCA 4EW7A 3MKFA 5DJTA 1AWIA 3FZCA 3VE3A 5G18A 5TFQA 3KX0X 2WAEA 2ZJ9A 4NXGA 1BT5A 1QMEA 1XFNA 1MWSA 3ICYA 5KMWA 1XP4A 1NRFA 3T4SA 5FQQA 2EXBA 1YKDA 5EVLA 4NG2A 4S2IA 4C75A 2J9OA 2QPNA 2B95A 3R7WA 3VP0A 1W8YA 4P85A 4IBRA 4WBGA 1SDEA 2Y2IA 1GHMA 1PW8A 3GDIA 2VV7A 2Y2PA 2JHEA 1IYQA 2V0WA 1D1JA 3C5AA 3LR0A 1BULA 2ZMVA 3FKWA 4WN5A 4OQHA 1NJ4A 3LIEA 4GHIB 3HUNA 3C7UA 1Z09A 4LGWA 1NYYA 1YMXA 3C8CA 2EWWA 2O9AA 5DTSA 3BQ8A 4OVDA 2XD5A 4KZ9A 2Y2JA 3ZVWA 3UPNA 2HF6A 1V9ZA 1NYMA 4HP9A 2PBDP 3Q07A 3QP2A 1E3UD 5L8MA 2G2WA 3LICA 1H8ZA 1GHPA 2H0YA 1E3UA 1K0KA 4KQQA 2VLGA 3NHQA 1MKMA 1TF1A 4WEKA 4G3WA 4BD1A 1N9BA 1KVLA 4U3TA 5CXWA 1CI8A 2PYRA 5L10A 3ITBA 3LYXA 2J9PA 1YLPA 1YAXA 4YWZA 3CLOA 3ZNTA 2ZLYA 2VGKA 3SS3A 1T19A 4FUWA 2M7VA 4BD0A 3G4PA 1EW0A 3LIFA 3LR4A 1TDLA 2AVXA 3LFVA 4ZJ1A 2PAVP 3DBAA 1S67L 4CJNA 3WS1A 2Y59A 3BFEA 5FAPA 5DFXA 3G34A 4A5RA 1FSYA 2VGJA 2VZWA 2XQZA 2Y2MA 2ZL1A 1V9YA 5HD5A 5FQ9A 4N92A 2W3FA 3DTMA 4D60A 3HLFA 1MY8A 1VETA 1J3WA 1BLSA 3MQ0A 2BLSA 4BBTA 2HDUA 4JF6A 4Y0TA 4KZ4A 1DJBA 5JYOA 3SH8A 3A3JA 3WWXA 1L3LA 5TJJA 5FL3A 2JKTI 3SH9A 2HV1A 1IKIA 2XEPA 2HDQA 5J7EA 3VV4A 2GZAA 1FIKA 4HI4A 3PHYA 2E8IA 4ZRRA 1CEFA 2W3GA 2Q0OA 4O01A 3IS2A 2WUQA 2W1RA 3M6BA 5HL6A 3VMAA 4UEYA 2OLVA 2WKHA 5FQKA 4I3AA 2PYPA 4R38A 4P87A 5FAOA 5M1AA 4E3KA 4KUOA 2DCFA 2J3TD 3HLGA 3L9KA 3AGDA 5GLCA 3ZVTA 1GA0A 4WF0A 1S6RA 2LB5A 3NOTC 1KDSA 3BY9A 2FFFB 4CQHA 3NDGA 5F6AA 5G4YA 5A93A 4CPKA 3WS2A 3CITA 3IXDA 2J3TC 1BZAA 4R23A 2INWA 1OT6A 3BRMA 3F1OB 2IA2A 4LV3A 3LI9A 3MBZA 2J8YA 2WGWB 3NJAA 2XRNA 4UQIM 3EEHA 3V3SA 3T12B 1YM1A 3PBRA 3UB7A 1DJCA 1JWPA 3QNCA 1XFQA 4OOYA 5GHYA 3CG5A 4ID4A 3LGOA 3BLMA 5FQJA 2XA7S 2ZL1B 1ZHHB 3O86A 3CHWP 1DP6A 4HJ3A 2ZC7A 3GECA 1S66L 1ZC2A 2Y2QA 4YOFA 4GB7A 1XJ4A 4DXBA 3UN7A 3V67A 2WGVA 4DDYA 5FAQA 5I5LA 4DJ3A 1WYCA 2QJ7A 1H5XA 2OWHA 2VV6A 5HAQA 2OWJA 1XGIA 4QHCA 4C3QA 1XXMA 3IXGA 4KZ3A 4H8RA 2L1MA 1MWRA 1LHYA 2LB9A 2KLIA 3LUQA 1OTEA 5DF9A 4GS9B 3Q7VB 2JC7A 3BYDA 4JXGA 3P09A 4WZ5A 3NCKA 3G31A 1SKOA 1JWZA 4D2OA 4ESPA 3KSIA 1XJ2A 2QHKA 3E98A 3WS5A 3CWFA 4WL9A 1G6AA 1W63M 2BASA 3IHAA 3IH9A 4WLAA 5EV0A 2Y8HA 1FCNA 5KZHA 1T1CA 4PM8A 4O0PA 5FDHA 3S22A 3KSGA 1S1ZA 2A3UA 4JGOA 4Y17A 1IFQA
chains in the Genus database with same CATH topology
1J3WA 1F2KA 3UB5P 3T12B 2VK3A 2E8JA 3MSHA 1CF0A 1VEUA 3CPTA 1CJFA 2PRFA 1VETB 1SZVA 4QWOA 2PBDP 5EVEA 3LGOA 3U4LP 1FILA 3NULA 4FTXA 3T1QB 1PFLA 5EM1A 4X25A 3L7HA 2ZL1B 1VEUB 5FDSA 3CPTB 1HLUP 3D9YA 1K0KA 2JKGA 3CHWP 1Y4OA 1FIKA 3T1XA 2JKFA 2V8CA 2ACGA 1A0KA 1AWIA 5EM0A 5FEFA 3L9KA 4FUWA 1CQAA 2PAVP 2V8FA 2B95A 2HZ5A 4X1MA 1SKOA 5FEGA 3T1RA 1PRQA 4ESPA 1PNEA 2ZL1A 1D1JA 1ACFA 2BTFP 3DAVA 3T1SA 3NECA 1YPRA 3KYEA 1SKOB 5EV0A 3MS6A 3LEQA 4D60A 1Z09A 4X1LA 1G5UA 1VETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J3W A;  1F2K A;  3UB5 P;  3T12 B;  2VK3 A;  2E8J A;  3MSH A;  1CF0 A;  1VEU A;  3CPT A;  1CJF A;  2PRF A;  1VET B;  1SZV A;  4QWO A;  2PBD P;  5EVE A;  3LGO A;  3U4L P;  1FIL A;  3NUL A;  4FTX A;  3T1Q B;  1PFL A;  5EM1 A;  4X25 A;  3L7H A;  2ZL1 B;  1VEU B;  5FDS A;  3CPT B;  1HLU P;  3D9Y A;  1K0K A;  2JKG A;  3CHW P;  1Y4O A;  1FIK A;  3T1X A;  2JKF A;  2V8C A;  2ACG A;  1A0K A;  1AWI A;  5EM0 A;  5FEF A;  3L9K A;  4FUW A;  1CQA A;  2PAV P;  2V8F A;  2B95 A;  2HZ5 A;  4X1M A;  1SKO A;  5FEG A;  3T1R A;  1PRQ A;  4ESP A;  1PNE A;  2ZL1 A;  1D1J A;  1ACF A;  2BTF P;  3DAV A;  3T1S A;  3NEC A;  1YPR A;  3KYE A;  1SKO B;  5EV0 A;  3MS6 A;  3LEQ A;  4D60 A;  1Z09 A;  4X1L A;  1G5U A;  1VET A; 
#chains in the Genus database with same CATH topology
 4RVA A;  2W3H A;  1TS7 A;  1F2K A;  4HQA A;  1W7F A;  1CF0 A;  3HLW A;  4GCZ A;  2ZM0 A;  3NY4 A;  3UE1 A;  2HP5 A;  2WYX A;  3TJZ C;  1BYW A;  1CJF A;  1M40 A;  1SZV A;  3ZG9 B;  4IJG A;  2GJ3 A;  3HLD A;  2XSS A;  5FI6 A;  2VGL S;  3FPW A;  4R3J A;  2C6W B;  4LLO B;  3C30 A;  1CEG A;  1H3Q A;  4WMC D;  1Q2Q A;  5I94 A;  1Z6F A;  2WAD A;  4KZ7 A;  1ZKJ A;  3E2K A;  4OOM A;  1ZTU A;  1G6O A;  2RCX A;  3B3X A;  3QP8 A;  2QWS A;  4DF6 A;  4AFI A;  3DWK A;  5CER A;  5E2H A;  3OPP A;  3QP4 A;  1C3B A;  4HY8 A;  1J9M A;  2EA9 A;  3ZDJ A;  2EX8 A;  1FR1 A;  1TVF A;  4P6Z S;  3PAG A;  4UHU A;  3QP1 A;  1TS0 A;  2NUP C;  3VP3 A;  4JF5 A;  4LRY C;  4B93 A;  4E3I A;  3HUO A;  1T1A A;  4L9E A;  4IVI A;  1K38 A;  1XA1 A;  5M19 A;  5E43 A;  4EUZ A;  1ES4 A;  2Y2H A;  1OTA A;  4MBH A;  4QPR A;  3UE3 A;  1LI9 A;  2XD1 A;  3ZG5 A;  5EVI D;  3PBT A;  3BW6 A;  2GX5 A;  2VK3 A;  4ZAM A;  4FH2 A;  5G4Z A;  4GLQ A;  1K25 A;  1LSX A;  3EEA A;  4LRZ E;  3UB9 A;  1TS6 A;  5HX9 A;  4OLG A;  5C5K A;  4QWO A;  3T4O A;  5F69 A;  1HZO A;  2FH5 A;  2ZQ9 A;  4DDS A;  1MWT A;  5EVI C;  3MZF A;  4MN5 A;  5DFY A;  2P9V A;  2FFY A;  2RL3 A;  4Y13 A;  2JKG A;  2KOI A;  2PR6 A;  4M4X A;  4DE2 A;  2B02 A;  1TEM A;  3UME A;  3D4F A;  1OTD A;  4EU0 A;  5GHX A;  1KOU A;  3H9W A;  4Y7P A;  3LID A;  2HDS A;  3D72 A;  4E3N A;  1TS8 A;  4KZ8 A;  4WZ4 A;  5AQA A;  4X56 A;  4O7D A;  2DRW A;  3F1P B;  1BTL A;  3VP1 A;  4WEL A;  1VB6 A;  4GD8 A;  4PM9 A;  3I7J A;  3DTK A;  2Z6C A;  3JVU A;  2HGV A;  4BQM A;  1F9I A;  5HDD A;  4ZDX A;  2HZ5 A;  3GQZ A;  1KGE A;  1G28 A;  1XJ3 A;  1N9L A;  1PNE A;  5DTT A;  2OOL A;  1PZP A;  2PHY A;  1ACF A;  2O0Y A;  4S2J A;  4R3B A;  2QZ6 A;  1YPR A;  4EEU A;  3CUE C;  4II7 A;  2QKP A;  4C6Y A;  2QMI A;  4MNR A;  3P7N A;  1DY6 A;  5FQI A;  1YSQ A;  2ZM2 A;  1MXO A;  1WYB A;  1FOF A;  3IWQ A;  3RTY A;  3N4I A;  1LLB A;  3W4P A;  4B4Z A;  4HP4 A;  1W8Q A;  1P9R A;  3LIA A;  1D7E A;  1FSW A;  5FQM A;  3VSK A;  2A24 B;  5A8B A;  3IWI A;  1JNU A;  3NUL A;  1OT9 A;  3A0S A;  3GR2 A;  3L7H A;  2WGI A;  4EBN A;  5EUA A;  4IBX A;  4IUK A;  3T1X A;  2XH9 A;  1FCM A;  2ZBB A;  2ZQ7 A;  2V9A A;  1ES2 A;  4N1H A;  2V2F F;  2VA0 A;  1K4F A;  3U2A A;  2K31 A;  5EVI B;  3EWK A;  4ZJ3 A;  5F5Y A;  3WS0 A;  3M2K A;  1XX2 A;  1RP5 A;  2VJW A;  2R78 A;  1Y54 A;  4K0W A;  2C5W B;  2H10 A;  4S2N A;  3IT9 A;  2EX6 A;  1RGZ A;  3QP6 A;  4KG6 A;  4IUH A;  2W3E A;  4N9L A;  4B88 A;  2P7J A;  2EXA A;  4OPQ A;  3F1O A;  4EEP A;  1NY0 A;  2P9V B;  1EWZ A;  3HLE A;  1XA7 A;  2J3W A;  4P0M A;  4EET B;  2XFT A;  1K56 D;  4QD4 A;  4OON A;  4S2N C;  4X1M A;  3FG8 A;  3T1R A;  2JKT M;  2HP9 A;  4PPR A;  3UO9 A;  3Q7Z A;  4HH3 A;  3G6O A;  2WGW A;  2ZC6 B;  5CGW A;  1UWN X;  5E2F A;  4MEZ A;  3SS5 A;  3HLB A;  1NRJ A;  4FH4 A;  2ZM8 A;  1ALQ A;  4X69 A;  4JGR A;  1BLH A;  3Q1F A;  3PXP A;  1LI0 A;  1E4D A;  4DE3 A;  4E04 A;  5TBM B;  1SCW A;  1JWV A;  4F94 A;  3T50 A;  4PKY A;  4Q0H A;  1PW1 A;  1ERM A;  3H7W B;  3N8L A;  4E3M A;  3TW8 A;  3LY3 A;  5CGX A;  2OSU A;  2J80 A;  5CHU A;  2XGN A;  3HVF A;  3T4T A;  4HHD A;  5EEC A;  2A49 A;  4N9K A;  5GLD A;  5HWT A;  3ZFZ A;  3GMW A;  1H8M A;  2Q9N A;  1LL9 A;  2W0N A;  3AGF A;  4CLC E;  4Y0U A;  1CK3 A;  3IX3 A;  4GS9 A;  3Q82 A;  2K7S A;  3C2W A;  3Q7V A;  4IHQ A;  3MFD A;  4CLC D;  3CAX A;  4P6B A;  2OV5 A;  2D01 A;  4EBP A;  5GLA A;  3LR5 A;  1NXY A;  2H5S A;  2JCH A;  4HES A;  2R9W A;  5FAT A;  4MLL A;  2ZC5 B;  3ZG0 A;  5MC7 A;  3RXX A;  4E6W A;  1UGU A;  3BLS A;  3ZGA B;  2Z6D A;  4WUJ A;  5HD3 A;  3ULF A;  4HH2 A;  5FEG A;  3MQO A;  3F1N B;  2WKQ A;  4CLC C;  4MBK A;  4S2O A;  3S4X A;  4LPZ A;  3TG9 A;  1JTD A;  4MDZ A;  1SDN A;  3UE6 A;  3ZNY A;  3LEQ A;  1W63 Q;  3BEC A;  5KSC A;  2V1A A;  5E2G A;  4EES A;  3HJK A;  2XA7 M;  4B4X A;  5IU1 A;  4YNR A;  3RXW A;  3VSL A;  3TE8 A;  3IX4 A;  3SZT A;  4HJ4 A;  4EQ1 A;  2PRF A;  4WEJ A;  4PMA A;  1CI9 A;  3QNB A;  1YMS A;  2WKR A;  1YLW A;  5F83 A;  3A0V A;  3DTE A;  4XT2 B;  4DE1 A;  4KQD A;  2YKF A;  3EQV A;  4Y15 A;  2ZC3 B;  1Y4O A;  1HVB A;  2KX6 A;  4OP5 A;  3FWL A;  2Y79 A;  2HJE A;  2ZC4 B;  4GDN A;  2ACG A;  2CMN A;  1U60 A;  4E6X A;  1MBL A;  5J3W A;  1GCE A;  4F3L B;  3SH7 A;  3UY6 A;  3CJM A;  1H8Y A;  4L9F A;  3S7P A;  3Q81 A;  3OPR A;  4BEN A;  1MKI A;  4EWF A;  3W8K A;  4KZA A;  5FEF A;  2W27 A;  5HPF A;  4HNB A;  3IQA A;  3E4Q A;  4GJ4 A;  1YLY A;  2J7V A;  3G32 A;  4BL3 A;  1CQA A;  2WZZ A;  3BQA A;  4NKP A;  4RYE A;  3EGD C;  2OAP 1;  3NC8 A;  4UAA A;  5DKK A;  5F68 A;  1BLC A;  3KSH A;  2B18 A;  4R3A A;  2O9B A;  4JPM A;  3V39 A;  1K54 C;  1BUE A;  2JN7 A;  2NUT C;  2PU4 A;  4U0T A;  1ERO A;  3NOP C;  3PTE A;  1K55 C;  2HJ9 C;  1OJG A;  4L0L A;  2VGL M;  4R0Q A;  5L09 A;  4CLC B;  4JF4 A;  4BWI A;  4S2L A;  5FAS A;  3FYZ A;  4EER A;  4FSF A;  2G2U A;  4LEN A;  4BLM A;  4KEN B;  5DJU A;  3N8R A;  3C4O A;  3UPP A;  2ZD8 A;  2L4R A;  2FZ0 A;  2XFS A;  3HLC A;  4ARZ A;  5FDS A;  3W2Z A;  3WRT A;  1L0F A;  1EI5 A;  2Y2K A;  3ZCZ A;  3HRE A;  5AQ9 A;  3WS4 A;  5CTN A;  1IYO A;  4GKU A;  4BBU A;  3F1P A;  3JVV A;  4GZB A;  5GL9 A;  4HOI A;  4P6Z M;  2WZX A;  4PM7 A;  4R70 A;  2ZQD A;  3HL9 A;  5AQB A;  2VEA A;  4GOG A;  3UDX A;  4WMC A;  1ONH A;  1ZG4 A;  2H0T A;  5DKL A;  1PWG A;  4FD8 A;  1X0O A;  3CI6 A;  1ESU A;  3BFG A;  1I2W A;  2IWB A;  1BLP A;  5FSR A;  4UA7 A;  3LEZ A;  3ITA A;  3VOZ A;  2BTF P;  2X01 A;  3T1S A;  4LRX C;  1XJ6 A;  4RX2 A;  4OQI A;  1PI5 A;  2PR5 A;  5FA7 A;  5F82 A;  2I72 A;  3BJN A;  4E3L A;  5BOH A;  4XUX A;  2A24 A;  4KZB A;  4XUZ A;  1G5U A;  1RCJ A;  2W3D A;  1DJA A;  3PBS A;  3OPH A;  3TRC A;  3MXR A;  1FCO A;  3D3O A;  5HDC A;  1LSW A;  4LCM A;  3TOI A;  5JYP A;  2Y2G A;  1ERQ A;  4GW9 A;  4RX3 A;  4LFU A;  3MXQ A;  5CHM A;  5J8X A;  5HZH A;  5EVE A;  4NEE D;  3KSF A;  4JGP A;  4KQO A;  3NDE A;  3T1Q B;  3IH8 A;  1S4S A;  4BBV A;  2L0W A;  4GN2 A;  4QU3 A;  3CPT B;  5EVI A;  1YLT A;  5TGF A;  4QY6 A;  2PU2 A;  5CED A;  3FV7 A;  5A90 A;  1GSV A;  2G7U A;  4MN6 A;  1N9O A;  1YSP A;  4EQI A;  1BSG A;  3K2N A;  1PWC A;  2WK0 A;  1XKZ A;  4OPR A;  4NXE A;  4DE0 A;  1IKG A;  1LL8 A;  3VFH A;  4IVK A;  1TD5 A;  1KVM A;  4JLF A;  1GSW A;  1IEM A;  2HPB A;  1HD8 A;  3SW1 A;  1ES5 A;  2P08 A;  3S7N A;  2M7U A;  4K0X A;  4JXW A;  4ARZ B;  1F98 A;  1PWD A;  4FOF A;  3IBR A;  2R9X A;  3MQQ A;  2QYB A;  2Y91 A;  3N8S A;  2WKE A;  3A3F A;  3O88 A;  5TBM A;  3DWZ A;  5K5B A;  3EOI A;  3IXB A;  2O9C A;  2MJ6 A;  1JTG A;  1XPB A;  3H7W A;  3UE0 A;  3OBF A;  4K08 A;  1RGY A;  1L0D A;  4LV1 A;  3CUE A;  3E4P A;  4EV4 A;  1W5D A;  5EFW A;  2P74 A;  4YIN A;  4B9O A;  3QP5 A;  4PM6 A;  3ISG A;  3IF6 A;  3O87 A;  4NXF A;  4R1G A;  3MR0 A;  2PT7 A;  3CZD A;  3UNW A;  2ZOH A;  1ZG6 A;  1VEU B;  3IF6 C;  3S7Q A;  3P01 A;  2DNS A;  3GVB A;  5AVE A;  2V8C A;  3C38 A;  3VOY A;  5D3O A;  1KGF A;  3NIA A;  4E3J A;  3HJI A;  1YQS A;  1A0K A;  5IHV A;  4ETZ A;  2X71 A;  1WE4 A;  4NET A;  4O8G A;  3E4O A;  1JVJ A;  5HL1 A;  3W4Q A;  2XRO A;  3T4K A;  2Q9M A;  1L2S A;  5CRF A;  5FI2 A;  2H28 A;  5HAI A;  2Y2L A;  2OLU A;  4DKI A;  3F1N A;  4BJP A;  5CHJ A;  1IEL A;  3E2L A;  2JKR M;  4KZ6 A;  2V8F A;  1GA9 A;  4K91 A;  4U0X A;  2ZQC A;  2UWX A;  1YLZ A;  4JXS A;  5IS1 A;  5U47 A;  1DP9 A;  3UPO A;  1NLZ A;  3AGE A;  2PDR A;  1K6R A;  5EOE A;  5HWV A;  1T1B A;  2HDR A;  1O7E A;  4ZJ2 A;  5M18 A;  4GNU A;  5EPH A;  2GNX A;  2WAF A;  3H82 A;  1SHV A;  4GDB A;  2VKS A;  4KG5 A;  4R6L A;  3PAE A;  5CEB A;  2DMW A;  2Y2O A;  3P98 A;  4EXO A;  1K56 A;  4XT2 A;  5GLB A;  3FPV A;  1N9N A;  2X02 A;  2WKP A;  2W1T B;  2V1Z A;  4X68 A;  3OCN A;  1NZU A;  5HFO A;  1FIL A;  4I39 A;  5AVF A;  4HBU A;  4F3L A;  3BWL A;  1LSV A;  1ESI A;  1HLU P;  3MXS A;  3NI9 A;  4ZTK A;  3GSG A;  4Z1W A;  3T4L A;  2JKR I;  5HSQ A;  3BY8 A;  3K3C A;  3GRJ A;  5IT5 A;  5L2F A;  5EM0 A;  4DN0 A;  2I9V A;  3JYI A;  3MJQ A;  3JPU A;  1YLJ A;  4BMW A;  3O5Y A;  3EGX C;  4I3I A;  3IXH A;  3IF6 B;  4ETX A;  4DXC A;  4JBF A;  4LCL A;  5HW3 A;  3HBR A;  3TSG A;  4MMN A;  3M2J A;  5DVA A;  1ONG A;  1OJ5 A;  5CX7 A;  2GDN A;  3T4Q A;  1YT4 A;  5HPI A;  3A3E A;  3E0Y A;  3LY4 A;  3IX8 A;  4QB8 A;  2ZQA A;  4R4R A;  3LIB A;  1NLY A;  3UMD A;  3B33 A;  2V1B A;  1PRQ A;  2ZMA A;  1LL5 A;  5CGS A;  1L0G A;  5FI7 A;  4DMZ A;  3DAV A;  3R7W B;  4CLC A;  5GHZ A;  3LCE A;  1GHI A;  5KSH A;  4FCF A;  5AJG A;  2P04 A;  4I5S A;  4OPY A;  3ZYT A;  4X1L A;  1KGG A;  4EUV A;  4X6T A;  4H6J A;  4UA6 A;  3A0R A;  3ZG7 B;  2BG1 A;  4LV0 A;  5DF8 A;  3GV9 A;  1P9W A;  4JKT A;  2V0U A;  3B42 A;  3U4L P;  3KYZ A;  2PD8 A;  3NOU C;  1VM1 A;  5EM1 A;  4QJG A;  2EFX A;  1OTI A;  3OCL A;  3OOV A;  1QMF A;  2JKF A;  3H82 B;  3PBN A;  2D02 A;  3UB8 A;  3HCY A;  3DTI A;  1S1Y A;  5LBR A;  5CEC A;  1LT0 A;  3C7V A;  4RA7 A;  1KE0 A;  4KQR A;  4ME4 A;  4PM5 A;  4G3V A;  1K57 A;  4S2K A;  4NK3 A;  4PAU A;  1AXB A;  3PR6 A;  2Z2M B;  4S2M A;  4E3O A;  1XGJ A;  1O07 A;  3RJU A;  2K2N A;  4DRT A;  3R4K A;  4MN7 A;  1N4O A;  3VP4 A;  1GSX A;  4ZBE A;  1K57 C;  4JXV A;  1S0W A;  3T4J A;  1KE4 A;  3A3I A;  3M6H A;  4OOL A;  4UA9 A;  5E2E A;  3OPL A;  3G35 A;  4MCW A;  2ZMF A;  4HJ6 A;  3MS6 A;  3B47 A;  3O3V A;  1IYS A;  1K54 A;  3BFD A;  1KDW A;  1I5Q A;  3PBQ A;  4GD6 A;  1Q2P A;  3UDF A;  1H0M A;  1G68 A;  2EWV A;  2UV0 E;  3PYP A;  2JBF A;  5A92 A;  1K55 A;  2EX2 A;  5CTM A;  3CPT A;  1VET B;  4OH0 A;  3BFC A;  4BL2 A;  2QJ5 A;  4Z9Q A;  1ODV A;  4UQI S;  1PFL A;  1VHM A;  1PI4 A;  4R4S A;  1SKF A;  4XXR A;  3V3R A;  3LI8 A;  1STZ A;  4NXB A;  2XLN A;  3CMZ A;  5F1F A;  2CC1 A;  4H6J B;  3RFB A;  3OC2 A;  3OLO A;  1Y28 A;  3V50 A;  5HWW A;  3ZQ5 A;  1F5M A;  1NZO A;  1HTZ A;  1DRM A;  1OPX A;  4OLD A;  1ES3 A;  3BM6 A;  3ZHH A;  4MBF A;  2Z2L B;  1P0Z A;  3N6I A;  3IS2 B;  2EFU A;  3RH8 B;  1L0E A;  4Y2F A;  5DF7 A;  1K6S A;  3S7O A;  1MC0 A;  4WZ5 C;  2O99 A;  3VE4 A;  3VOL A;  2XDM A;  4OQ0 A;  5DTK A;  4PKY G;  2ZOI A;  3MKE A;  4N1X A;  2JE5 A;  3MZE A;  3GTC A;  5TR7 A;  3A3D A;  4X55 A;  3UDI A;  4JGQ A;  2ZQ8 A;  3QHY A;  3ZG8 B;  4IED A;  3NEC A;  4Y0O A;  3VFF A;  3SOI A;  4I38 A;  2WKI A;  3BEB A;  1MPL A;  5HAR A;  4KZ5 A;  4G3K A;  3VP2 A;  4X53 A;  1WA9 A;  2IWD A;  3MSH A;  2E8J A;  1PYY A;  3SS4 A;  3EQU A;  3MFX A;  4OKP A;  4QY5 A;  1NWZ A;  3LO7 A;  1VEU A;  1FQG A;  1M6K A;  3V5M A;  3KYQ A;  3S1Y A;  1T18 A;  3FKV A;  2VX8 A;  3C4P A;  1MWU A;  2XR0 A;  1MZU A;  2PD7 A;  4Q8I A;  4X25 A;  4OQG A;  3PBO A;  2OAQ 1;  5KIZ A;  4HEF A;  2KDK A;  3D9Y A;  2M1C A;  5F1G A;  4I3J A;  5AQ7 A;  2Y2N A;  3K3D A;  1W79 A;  4Y3I A;  4HIA A;  1D06 A;  5EOO A;  4S2P A;  5HAP A;  4GHI A;  4M3K A;  3MZD A;  2YKH A;  5J4E A;  4Y5F A;  1TDG A;  3LR3 A;  1VQQ A;  4OP8 A;  4EBL A;  4KG2 A;  2HP6 A;  1OME A;  1E25 A;  2XF3 A;  3NBL A;  3UB6 A;  1IYP A;  4DJ2 A;  1OTB A;  3MMH A;  4Q0J A;  2XK1 A;  1S4R A;  2EX9 A;  3G2Y A;  4Q0I A;  4OPZ A;  4WYY A;  3IF5 A;  3KYE A;  1SKO B;  4YFM A;  2A2L A;  3HUM A;  1K4E A;  1PZO A;  3MF0 A;  2Y4A A;  3OZH A;  1UWP X;  4L9G A;  2W1T A;  1FR6 A;  3IHB A;  4HBT A;  3UB5 P;  2Y55 A;  4PHT A;  3G2Z A;  3G30 A;  4WM9 A;  1IOU A;  3KO6 A;  1PIO A;  3WRZ A;  5L07 A;  2V20 A;  3W4O A;  2B5R A;  5EE8 A;  5A91 A;  1I2S A;  4LV2 A;  4FTX A;  4RQ9 A;  3IWO A;  3DW0 A;  1P97 A;  3IBJ A;  3FC7 A;  2PBY A;  5HDS A;  2VV8 A;  3BFF A;  1KE3 A;  4KUK A;  1DP8 A;  3N7W A;  2IWC A;  4EW7 A;  3MKF A;  5DJT A;  1AWI A;  3FZC A;  3VE3 A;  5G18 A;  5TFQ A;  3KX0 X;  2WAE A;  2ZJ9 A;  4NXG A;  1BT5 A;  1QME A;  1XFN A;  1MWS A;  3ICY A;  5KMW A;  1XP4 A;  1NRF A;  3T4S A;  5FQQ A;  2EXB A;  1YKD A;  5EVL A;  4NG2 A;  4S2I A;  4C75 A;  2J9O A;  2QPN A;  2B95 A;  3R7W A;  3VP0 A;  1W8Y A;  4P85 A;  4IBR A;  4WBG A;  1SDE A;  2Y2I A;  1GHM A;  1PW8 A;  3GDI A;  2VV7 A;  2Y2P A;  2JHE A;  1IYQ A;  2V0W A;  1D1J A;  3C5A A;  3LR0 A;  1BUL A;  2ZMV A;  3FKW A;  4WN5 A;  4OQH A;  1NJ4 A;  3LIE A;  4GHI B;  3HUN A;  3C7U A;  1Z09 A;  4LGW A;  1NYY A;  1YMX A;  3C8C A;  2EWW A;  2O9A A;  5DTS A;  3BQ8 A;  4OVD A;  2XD5 A;  4KZ9 A;  2Y2J A;  3ZVW A;  3UPN A;  2HF6 A;  1V9Z A;  1NYM A;  4HP9 A;  2PBD P;  3Q07 A;  3QP2 A;  1E3U D;  5L8M A;  2G2W A;  3LIC A;  1H8Z A;  1GHP A;  2H0Y A;  1E3U A;  1K0K A;  4KQQ A;  2VLG A;  3NHQ A;  1MKM A;  1TF1 A;  4WEK A;  4G3W A;  4BD1 A;  1N9B A;  1KVL A;  4U3T A;  5CXW A;  1CI8 A;  2PYR A;  5L10 A;  3ITB A;  3LYX A;  2J9P A;  1YLP A;  1YAX A;  4YWZ A;  3CLO A;  3ZNT A;  2ZLY A;  2VGK A;  3SS3 A;  1T19 A;  4FUW A;  2M7V A;  4BD0 A;  3G4P A;  1EW0 A;  3LIF A;  3LR4 A;  1TDL A;  2AVX A;  3LFV A;  4ZJ1 A;  2PAV P;  3DBA A;  1S67 L;  4CJN A;  3WS1 A;  2Y59 A;  3BFE A;  5FAP A;  5DFX A;  3G34 A;  4A5R A;  1FSY A;  2VGJ A;  2VZW A;  2XQZ A;  2Y2M A;  2ZL1 A;  1V9Y A;  5HD5 A;  5FQ9 A;  4N92 A;  2W3F A;  3DTM A;  4D60 A;  3HLF A;  1MY8 A;  1VET A;  1J3W A;  1BLS A;  3MQ0 A;  2BLS A;  4BBT A;  2HDU A;  4JF6 A;  4Y0T A;  4KZ4 A;  1DJB A;  5JYO A;  3SH8 A;  3A3J A;  3WWX A;  1L3L A;  5TJJ A;  5FL3 A;  2JKT I;  3SH9 A;  2HV1 A;  1IKI A;  2XEP A;  2HDQ A;  5J7E A;  3VV4 A;  2GZA A;  1FIK A;  4HI4 A;  3PHY A;  2E8I A;  4ZRR A;  1CEF A;  2W3G A;  2Q0O A;  4O01 A;  3IS2 A;  2WUQ A;  2W1R A;  3M6B A;  5HL6 A;  3VMA A;  4UEY A;  2OLV A;  2WKH A;  5FQK A;  4I3A A;  2PYP A;  4R38 A;  4P87 A;  5FAO A;  5M1A A;  4E3K A;  4KUO A;  2DCF A;  2J3T D;  3HLG A;  3L9K A;  3AGD A;  5GLC A;  3ZVT A;  1GA0 A;  4WF0 A;  1S6R A;  2LB5 A;  3NOT C;  1KDS A;  3BY9 A;  2FFF B;  4CQH A;  3NDG A;  5F6A A;  5G4Y A;  5A93 A;  4CPK A;  3WS2 A;  3CIT A;  3IXD A;  2J3T C;  1BZA A;  4R23 A;  2INW A;  1OT6 A;  3BRM A;  3F1O B;  2IA2 A;  4LV3 A;  3LI9 A;  3MBZ A;  2J8Y A;  2WGW B;  3NJA A;  2XRN A;  4UQI M;  3EEH A;  3V3S A;  3T12 B;  1YM1 A;  3PBR A;  3UB7 A;  1DJC A;  1JWP A;  3QNC A;  1XFQ A;  4OOY A;  5GHY A;  3CG5 A;  4ID4 A;  3LGO A;  3BLM A;  5FQJ A;  2XA7 S;  2ZL1 B;  1ZHH B;  3O86 A;  3CHW P;  1DP6 A;  4HJ3 A;  2ZC7 A;  3GEC A;  1S66 L;  1ZC2 A;  2Y2Q A;  4YOF A;  4GB7 A;  1XJ4 A;  4DXB A;  3UN7 A;  3V67 A;  2WGV A;  4DDY A;  5FAQ A;  5I5L A;  4DJ3 A;  1WYC A;  2QJ7 A;  1H5X A;  2OWH A;  2VV6 A;  5HAQ A;  2OWJ A;  1XGI A;  4QHC A;  4C3Q A;  1XXM A;  3IXG A;  4KZ3 A;  4H8R A;  2L1M A;  1MWR A;  1LHY A;  2LB9 A;  2KLI A;  3LUQ A;  1OTE A;  5DF9 A;  4GS9 B;  3Q7V B;  2JC7 A;  3BYD A;  4JXG A;  3P09 A;  4WZ5 A;  3NCK A;  3G31 A;  1SKO A;  1JWZ A;  4D2O A;  4ESP A;  3KSI A;  1XJ2 A;  2QHK A;  3E98 A;  3WS5 A;  3CWF A;  4WL9 A;  1G6A A;  1W63 M;  2BAS A;  3IHA A;  3IH9 A;  4WLA A;  5EV0 A;  2Y8H A;  1FCN A;  5KZH A;  1T1C A;  4PM8 A;  4O0P A;  5FDH A;  3S22 A;  3KSG A;  1S1Z A;  2A3U A;  4JGO A;  4Y17 A;  1IFQ A; 
#chains in the Genus database with same CATH homology
 1J3W A;  1F2K A;  3UB5 P;  3T12 B;  2VK3 A;  2E8J A;  3MSH A;  1CF0 A;  1VEU A;  3CPT A;  1CJF A;  2PRF A;  1VET B;  1SZV A;  4QWO A;  2PBD P;  5EVE A;  3LGO A;  3U4L P;  1FIL A;  3NUL A;  4FTX A;  3T1Q B;  1PFL A;  5EM1 A;  4X25 A;  3L7H A;  2ZL1 B;  1VEU B;  5FDS A;  3CPT B;  1HLU P;  3D9Y A;  1K0K A;  2JKG A;  3CHW P;  1Y4O A;  1FIK A;  3T1X A;  2JKF A;  2V8C A;  2ACG A;  1A0K A;  1AWI A;  5EM0 A;  5FEF A;  3L9K A;  4FUW A;  1CQA A;  2PAV P;  2V8F A;  2B95 A;  2HZ5 A;  4X1M A;  1SKO A;  5FEG A;  3T1R A;  1PRQ A;  4ESP A;  1PNE A;  2ZL1 A;  1D1J A;  1ACF A;  2BTF P;  3DAV A;  3T1S A;  3NEC A;  1YPR A;  3KYE A;  1SKO B;  5EV0 A;  3MS6 A;  3LEQ A;  4D60 A;  1Z09 A;  4X1L A;  1G5U A;  1VET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...