2JKMA

Focal adhesion kinase catalytic domain in complex with bis-anilino pyrimidine inhibitor
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
274
structure length
260
Chain Sequence
RDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FOCAL ADHESION KINASE 1
publication title Crystal Structures of the Fak Kinase in Complex with Tae226 and Related Bis-Anilino Pyrimidine Inhibitors Reveal a Helical Dfg Conformation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 82
structure length 260
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2jkmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2jkmA01
3TNWA 4W9XA 4O81A 4EQCA 4HVIA 5CZIA 2WMTA 4C8BA 4HYIA 1CDKA 2X4ZA 3ORTA 4Q9SA 4TYHA 5TOZA 3TZMA 5HIEA 4IAIA 4FKVA 4QMYA 2IWIA 4EOMA 1ZOHA 4GRBA 3IONA 3LIJA 4WNPA 5E7RA 2XMYA 3NUXA 2BROA 4F9CA 1Q3WA 2OFVA 3BU6A 2ETKA 2R3HA 2RFDA 1YDSE 2V62A 4X0MA 4C7TA 3U9CA 4W8EA 5CWZA 5AUYA 4WUNA 3MI9A 1PKDA 5D41A 1JOWB 2GNFA 1GAGA 1LR4A 1KE8A 2OU7A 4YZNA 4BDCA 1ATPE 3OWJA 3ZDUA 4IB0A 4OAVB 2Z7LA 3I1AA 5HORA 4O7VA 2W96B 4A4OA 2HY81 4GT3A 2BRGA 3FLZA 3MIAA 3O0GA 4YMJA 5AR7A 1M52A 3G51A 3Q53A 4XRJA 3SXFA 3HMMA 3OROA 3FLQA 3ZRKA 3UPXA 3KY2A 4FTIA 1Q3DA 1PYEA 3RNIA 2B52A 4FZ6A 2YCFA 3FYKX 3QTSA 4OAUC 4B99A 3KK8A 4RVMA 3ZM9A 3GVUA 4X2FA 5HNBA 2R7BA 3Q4CA 3VUTA 4BBMA 1XWSA 3R8MA 2GFCA 3DGKA 3IQ7A 3DJ5A 4FSTA 4A07A 5CF4A 3CTHA 5DPVA 3VO3A 3A4PA 3PJ1A 3KXNA 3ZUVA 3BV2A 4DITA 4GH2A 3QCSA 4DFBA 5HE1A 3QTZA 2WQMA 3FKOA 4FVQA 2PZIA 4JBPA 5CEMA 3SXRA 3ZO3A 3HRBA 4MKCA 4QQ5A 4RFZA 2GFSA 3REPA 3OT8A 3D5VA 3D2KA 5KMKA 2W7XA 4YJOA 5HEZA 4APCA 5HQ0A 1GJOA 3DFAA 3OUNB 4QT1A 2VO3A 2C5XA 2FVDA 3L8SA 3VUHA 3FZPA 4F70A 1V0BA 3LQ3A 3RHKA 3TZ7A 3D4QA 4ZEGA 4FSNA 3VHEA 5HBJA 3UE4A 3C5UA 3QRTA 4I22A 4MVFA 4YO4A 2OJGA 5HG9A 5AV4A 5KNJA 1KE6A 2C47A 2RG6A 3DK3A 4XYFA 4MQ2A 5EDQA 4FOCA 5LARA 3RKBA 3RPVA 4ARKA 4AW5A 5HLWA 5I3RA 1PMVA 3DA6A 5HTCA 3BQCA 1JKTA 3IDBA 3W18A 1NVQA 2BALA 5LCJA 4X21A 5J5TA 1M7QA 4DFYA 3A8XA 3DNEA 2XF0A 3FPQA 4ENXA 2A1AB 3GT8A 4RIOA 5D12A 4BIEA 3AGLA 5HIDA 4A9RA 3GCUA 4YLJA 4FTTA 2VO6A 3C0IA 2QKWB 3FLYA 1BL6A 2WELA 4WOVA 3DQWA 1YWNA 3PXFA 4FYNA 4BDEA 3PFQA 2CGWA 4DGNA 2H96A 1H4LA 3IECA 5GJDA 1XH6A 3ZLXA 2CKQA 2C1AA 4DH3A 3M42A 3U4WA 4X3FB 3DXPA 2YDJA 3E8CA 3ZDIA 5KX8A 3DKCA 4NCTA 1NXKA 4FZ7A 3QD2B 4B4LA 4NM0A 3KULB 2O8YA 1O6KA 1U4DA 4ALUA 1YRPA 3SLSA 3BWFA 4F6SA 2YZAA 2Z8CA 4YJSA 4ENYA 3QC4A 1Q8WA 5EHYA 1UWJA 5CU3A 3IW5A 5GZ9A 1G3NA 1OECA 3VBQA 1NT2A 4I6QA 3HV5A 4MD9E 3HV6A 3FJQE 3ORMA 4ID7A 3S0OA 3KXXA 3QQJA 4RJ4A 4WBOA 4RWJA 3A7GA 4NL0A 3IW8A 3JPVA 4BDDA 2W1IA 3WOWA 3E93A 4FL1A 5I4NA 4X7QA 4RC4A 1W98A 4FSYA 3R28A 2CSNA 4XHKB 5HCZA 2XM9A 3PG1A 1XR1A 3MVJA 2ITUA 3ORLA 2YCSA 4BIDA 4DAWA 4ZAUA 4ITIA 5J7HA 3LOKA 3D5UA 4F6UA 3VBXA 4C62A 3HL7A 5JQ5A 3CGOA 4TKSA 3GU4A 5T6KA 5CT7A 1CKIA 4J8NA 3VUMA 3OT3A 5AP6A 1H24A 2OG8A 5FDPA 4O22A 3GC8A 3VAPA 3DDQA 4L01A 4GCJA 3A99A 3QC9A 2PMOX 4JXFA 5CU0A 3GU7A 2GPHA 3A2CA 3EJ1A 2W05A 5JKGA 1IASA 2PE1A 2WQOA 4ZK5A 4IJPA 4XJ0A 5LQFA 1OL1A 2UW5A 4BDFA 3MVLA 4ZSLA 3N4UA 4DEBA 3EL7A 3C13A 3N4TA 3FSFA 4EHVA 3PZHA 2ZMDA 1KSWA 2HCKA 4ACHA 4UWBA 1E1VA 4A9SA 3LE6A 1OMWA 2NO3A 3BKBA 4JOAA 5E8SA 3EL8A 3F61A 2YM3A 3C50A 3GC9A 3AC1A 4XNEA 3NCZA 4C4FA 3AC2A 2ITZA 4FUYA 4O7ZA 3QD3A 4O91A 1LPUA 2AUHA 3V5QA 2XNBA 4IX4A 2W4JA 2BPMA 1YKRA 3NGAA 2OWBA 4APPA 5IDPA 4O0UA 3VRYA 3NMUF 4JS8A 3P23A 2QQ7A 4WG5A 4UY9A 1GZKA 3IOKA 4H3PA 5HBEA 3UYSA 4NW5A 3OWKA 5T3QA 3FEGA 4GKHA 3LFSA 4S32A 3PG3A 3A60A 4YR8A 5D7AA 3RPOA 3JXWA 3ANQA 3H4JA 4U44A 5C4LA 5FGKA 4FNYA 4RA5A 4ZTQA 2XIZA 4FKTA 5M53A 1FINA 2VWWA 5D1JA 4YBKA 5HI2A 3SDJA 2CDZA 5L6OA 1UKIA 3JUHA 4S33A 3COHA 3E88A 3ENHA 4KWPA 1FVVA 3EQPA 4XBUA 3RINA 1V0OA 2O5KA 1PXNA 1UVRA 4JT3A 3IG7A 1JKLA 3DDPA 4FSZA 1V1KA 2X2KA 4NTSA 2WGJA 3GU8A 4XRLA 4CTBA 1XH8A 4I92A 2VTHA 4CCBA 4UMUA 5DEYA 4G2FA 2J4ZA 2WHBA 4FG7A 5FWKK 3UO4A 1PRYA 4U45A 2PWLA 3SRVA 4EK8A 4ITHA 2LGCA 3RCDA 3VHKA 4G9CA 3HMPA 4WG3A 5BQ0A 5HO8A 4D0WA 4UBAA 2BDWA 3RBWA 2C5YA 2W9FB 3ZSIA 2X2LA 3Q9XA 4MCVA 1YOMA 5LVLA 3CP9A 2C30A 4CEGA 4LMUA 4AZEA 5E1EA 1JSVA 4Q5HA 2XS0A 5ETFA 3V8WA 1XBAA 3U87A 1A06A 2PUIA 4I5PA 5CU4A 2BZIB 3C4XA 3FL4A 4PDYA 5ANEA 4ZTNA 3BYOA 5LXMA 3U4UA 4ZY5A 2YABA 4S34A 5JN2A 4HZRA 1GIHA 4RIXA 4EZ5A 1YHVA 4IBMA 2XK9A 4M0ZA 5CI7A 4AE6A 4EK3A 1F5QA 3ID6C 5IQIA 5E8VA 5TF9A 3VBYA 1MRUA 2OIBA 4IB5A 3E5AA 4M12A 2CN5A 2PUUA 1R1WA 4KD1A 4O2ZA 3DBDA 5AP7A 4F9YA 3DKOA 5HO6A 3D7TB 3HMIA 3PRFA 5LWNA 3UQFA 3C0GA 3DU8A 2E9UA 4NEUA 1ZMUA 3SOAA 2JIVA 5AV1A 4BL1A 3V6SA 3BZ3A 3ZONA 3QKLA 2GS6A 1BX6A 2YJRA 3E7OA 4J53A 4QP6A 2VUWA 2IZSA 3OXZA 4XUFA 1WBWA 2R64A 3QWJA 3HDMA 2PL0A 4Z9LA 3QQFA 4M15A 2XNOA 5TKDA 1WAKA 1H00A 3QUEA 4O0SA 5GHVA 5CT0A 2BHHA 3FI3A 2CPKE 2F2UA 4I0RA 5A14A 4XP3A 4CFXA 1R3CA 4MWIA 4E6QA 4EHEA 4UWYA 4XG4A 1FQ1B 2J50A 3R00A 2W5AA 2FSTX 3QXPA 4HGSA 5KMIA 5I0BA 4JVGA 4IAAA 5IA5A 4QMVA 5A4TA 2XM8A 4EORA 2QG7A 3R9OA 3DBFA 3KMWA 3A7JA 5HG8A 4YO6A 2X81A 3BEAA 4GK4A 3WIGA 5DMZA 3LQ8A 5J9LA 3FYJX 4E4LA 3ZC6A 4ONAA 1SVEA 5EQEA 1P14A 3ZLWA 3KFAA 1FVTA 4EHGA 5EHOA 1PMEA 2UZDA 2VRXA 1J7LA 5AUTA 3U55A 4ZLZA 3AG9A 3F69A 2X39A 3PIZA 3PSBA 4EZ3A 5F9EA 4XG6A 3AGMA 4F64A 4C2WA 2RFNA 2R5TA 2YHVA 2W4KA 4RIYB 5FTQA 5I9UA 1T45A 1TKIA 4G5PA 4BCPA 2I7QA 4MX9A 5JQ8A 2CKEA 2O63A 4C4IA 4UEUA 5JZJA 5AR4A 5J1WA 2OZAB 2R3RA 1YXSA 4EH3A 3FZOA 4FVPA 4WSQA 4O0RA 4IZ7A 4CFFA 4GVJA 4RJ3A 3ODYX 3TXOA 3ZEWA 1BUHA 4FEQA 3QTUA 3SVVA 2G2IA 3LFFA 4XV2A 4I4FA 2XBAA 3SAYA 3D14A 3UTOA 4CFWA 2UZUE 3BEGA 5IUHA 4EH7A 1WBVA 4ZMEA 5IZFA 1I09A 4D2WA 2CN8A 5FD2A 3C4EA 3ZXTA 5CAQA 1VEBA 5JT2A 5FXQA 3F6XA 3VIDA 1OVEA 1YDTE 2ERZE 4K33A 3VUKA 1WBNA 2VTJA 3D5WA 4NWMA 2JBOA 3WILA 4G16A 3E8DA 1QCFA 2VGPA 4MYGA 4BR3A 3MFSA 3R2BA 2YEXA 3RWPA 4EI4A 4QOXA 2V5QA 3NNUA 2UZVA 3DKFA 3C51A 4NFMA 2VN9A 4TYJA 3R7IA 3F5XA 1QPDA 4PRJA 2Q83A 1UWHA 2PE2A 3MESA 2GHLA 1FMKA 2X2MA 5KKRB 4FV3A 3E7VA 4B8LA 3QKKA 1SVHA 4RX8A 2WOTA 1HOWA 2A0CX 2VTOA 3PPZA 5FP6A 1U5RA 3MH1A 3SD0A 5IKWA 2X8DA 1ZLTA 4O21A 4YPDA 3BGPA 4FK3A 4HVSA 3F5UA 3PXZA 2HXQA 4FTOA 4AT4A 1P2AA 2FO0A 5A9UA 3AT4A 5CEQA 2GHMA 2I0EA 2XBJA 4O7WA 4D5HA 2J9MA 3KVWA 5HLPA 3FC1X 4WT6A 3R1SA 1OUYA 3QRUA 3UIUA 4E5BA 2YLEA 3HV7A 3V5LA 4U40A 3QRKA 5I5ZA 1F0QA 3RNYA 3OXTA 4G6NA 1T46A 3H10A 2WIPA 4HJOA 4IM2A 2ZDTA 3BHUA 4JG8A 4GW8A 4O6EA 4NH1A 2EU9A 2WMXA 3VRZA 3ZEPA 4GS6A 4CNHA 2OJIA 4BRXA 3KK9A 4FV8A 1Y6AA 4E3CA 2VTLA 4MF0A 2GQSA 3ZSGA 5EOBA 1P4OA 4RC2A 2C3KA 1A9UA 1BMKA 2BHEA 2I40A 2PTKA 3R0TA 4IXPA 4KKEA 4P4CA 4R3RA 3G9LX 2X9FA 5GIOE 2J5EA 3II5A 2SRCA 1SVGA 4IACA 3A7FA 3ORKA 4XOYA 2OF4A 4LI5A 4RRVA 1V0PA 3C4CA 4FEVA 2BAKA 2RL5A 3B8RA 3IDPA 1URWA 4MBIA 3PJ2A 4KA3A 4O27B 4XG8A 4C35A 4DN5A 2A27A 3LZBA 3QQHA 5EDRA 3EFWA 3EQDA 4YPSA 5FTOA 3D94A 3C0HA 3POOA 4X2NA 4L44A 2PVKA 3CEKA 4CV8A 1GIJA 4C36A 2FSMX 5E90A 3QU0A 4R1VA 2XJ1A 1Q8UA 3FY2A 2EXCX 4TWPA 2OXYA 1IAHA 4O96A 1LEWA 3OEFX 2BZHB 4L3PA 4UYNA 2JKQA 4EYJA 5CANA 1WBSA 1MUOA 3WF7A 5FDXA 4BHZA 1IR3A 4AW2A 4AGUA 4ZTMA 5BX0A 2J0KA 4O6LA 3UJGA 1E9HA 5DT3A 3L9LA 5L2IA 5EH0A 4WNOA 1OKWA 1REKA 4E5AX 3LFEA 3AQVA 4JL9A 4LV5A 4M13A 5J9YA 1Y8YA 2VX3A 3PTGA 5K0XA 1LUFA 2R3NA 4L7SA 1H01A 4ITJA 4L00A 5E9EA 1CM8A 5AADA 4A06A 1SNUA 4JDJA 2PU8A 2ETMA 2QO7A 4F0IA 3EN9A 1IA9A 3QQUA 1O9UA 2BZJA 5E4HA 2PMLX 3PDTA 5LJJA 2ITQA 5AWMA 2YM5A 2BTSA 3UPZA 2BMCA 1AGWA 2HY0A 3K3JA 5C8MA 4MQ1A 3COMA 5AR5A 2RGPA 4GUEA 3F66A 4R8QA 5M56A 3LCOA 5EYDA 5J87A 4LRJA 3GNIB 4G31A 4BDIA 4F0GA 2OIDA 5C1QB 3EKNA 3FHRA 3R01A 4AX8A 5JK3A 3ROCA 3EN7A 4TWCA 3KA0A 3SHEA 3TNPC 5HESA 3NIEA 5E91A 3DB6A 3AT2A 4RA4A 4R6VA 5GNKA 4HVDA 2W17A 4X3FA 1OBDA 4KB8A 1OIUA 1ZYJA 4BCJA 1OL2A 1WBTA 4EK6A 4E6CA 3LCSA 4M67A 3KULA 4TZRA 4YZDA 3R8UA 4XG2A 3V8SA 4IEBA 5A46A 4G6LA 4V0GB 4YTIA 1IA8A 4PL5A 1UNHA 3EB0A 4O0YA 3TL8A 4YTCA 4QTDA 5B2MA 5CEPA 2F49A 3W8QA 5CSHA 5M57A 3LLAA 3NS9A 4HCVA 4K8AA 4I41A 4AT5A 4CZYB 4GV1A 2QHMA 3MPAA 4MXZA 3FKNA 4YBJA 4CKRA 2JEDA 3H0ZA 4RZWA 5FEQA 3FHIA 5AIRA 1ZYLA 3SW4A 3VVHA 5LOHA 3MY0A 3O23A 4UB7A 4RGJA 1PHKA 2B0QA 3D9VA 4O82A 5HIBA 5ANGA 4Y5QA 3EOCA 3TEIA 1OI9A 5AM7A 4YNOA 3BX5A 1Q8ZA 3ZH8A 4PMMA 4A9TA 4N6ZA 2PVYA 4XV3A 3R8VA 4PTEA 2R3KA 5KMMA 2EB3A 4A9YA 3IW6A 5I9VA 4HZSA 2ZM3A 2ZVAA 3CD8A 4QO9A 4UXQA 3NVMB 3ZS5A 1NVSA 2QOHA 1Y91A 2WOUA 4E7WA 4F1TA 3ALNA 5CXZA 3R9NA 1MRYA 3ZLYA 3NUUA 5FEDA 3ERKA 5BMSA 5EM5A 1YOJA 4MAOA 3G0FA 3OEZA 2GS7A 1OPKA 3H30A 2JC6A 2R3MA 3FBVA 4XS2A 4AFJA 3EFKA 5KMOA 4A4LA 5FM2A 2QO2A 3F3ZA 4UMQA 3LM5A 4HVGA 2WO6A 4TWNA 1XJDA 3UQCA 4OLIA 3UIXA 1YWRA 2FA2A 2XNGA 2CKOA 2VNYA 2QR7A 4JBOA 2JKOA 3OMVA 4G3FA 4KIKA 3OOGA 4LRKA 5K3YA 4CQGA 4BCFA 3O8TA 1MQBA 4WHZA 3W16A 4YLLA 4IJ9A 5L6WL 2HK5A 4RVLA 4G3EA 2RSVA 3PYYA 4E20A 3BPRA 5E8UA 5M09A 4AWIA 2Y8OA 4AZFA 5DLSA 4NM7A 5I9WA 5JZNA 2YITA 4PDOA 5LMBA 4G3DA 4BGHA 3RPSA 4GJ3A 2Y0AA 1BI8A 4PL3A 2WD1A 4F6WA 3DAKA 5M4CA 2VO7A 4GIIA 1YDRE 5CY3A 3VUGA 2R3PA 2ZV7A 2GDOA 3DLSA 5IG1A 3LFAA 3RZFA 3S2PA 5EKNA 2W1ZA 5DR6A 2WAJA 3VUIA 4R5SA 3R9RA 3U6HA 3I79A 1H1SA 4GJ2A 5EM6A 4CTCA 4KKHA 4C4JA 4L9IA 5H2UA 5H3QA 5C4KA 2QU5A 3SW7A 4E1ZA 3LFDA 1M2PA 2BZKB 1XHAA 2W1HA 2R3OA 3Q4ZA 3R02A 1Q4LA 3B2WA 3OXIA 4NYEA 4KRDA 4RVTA 4N57A 2OICA 3NW6A 3EFJA 3QCQA 3NUPA 4ZZOA 5B2LA 5EM7A 3U8WA 3V5WA 2BAJA 4LM5A 5M51A 4BGQA 2GTNA 1BYGA 3GC0A 4QMLA 2HOGA 5DBXA 2X0GA 4QRCA 4AZVA 4KSPA 3F2RA 3N4VA 3F9NA 4EOLA 4YJPA 4LG4A 4YJNA 3D2IA 5DH3A 4ANBA 4R77A 1XBBA 2B7AA 4V01A 3BQRA 2GSFA 3NYXA 3A8WA 4QMWA 3CY2A 3LMIA 2WMAA 3GUBA 2RF9A 3Q9YA 4FSUA 4FTNA 4FT3A 3K2LA 2QCSA 4LL5A 2GNHA 4YZMA 5DN3A 5FXSA 2C6TA 3QA8A 4IE9A 3NAYA 5EYMA 4Y73A 4WUAA 5C03A 4YURA 5K5XA 3QYWA 5ANDA 5DR9A 4IM0A 2UW3A 5ETAA 3TUBA 4RWLA 2BTRA 2GMXA 2C0TA 2P55A 4RFYA 4YUQA 1R78A 3R71A 5FTGA 2DQ7X 1Q62A 5LVNA 3FQSA 2P0CA 4JJRA 3AC4A 3AMYA 5EK7A 3NW7A 2W5BA 3EQCA 4L67A 4MXYA 4I5MA 2OW3A 3BE9A 2J90A 1U54B 2XKCA 2UZEA 5BUIA 5DGZA 4Q5EA 4FKRA 4AGCA 2OJJA 5FBOA 4EOJA 3R30A 2ONLA 4O7NA 3HZTA 5CAVA 4RQKA 2NRYA 4QP3A 5IA1A 2HWOA 5EYCA 1OL5A 4D9TA 4R3CA 3Q9WA 2VTTA 3Q3BA 4C2VA 3FI2A 4ZOGA 4QP4A 3VUDA 5HG7A 4WG4A 1ZMVA 1YXUA 2C6KA 1SNXA 4FV5A 4L52A 3HAMA 5J79A 3MTLA 2R0IA 3E64A 4JIKA 3ETAA 3GXLA 3CD3A 1PXLA 4F7LA 1CTPE 2O2UA 3QGYA 4TW9A 5AP0A 3CKXA 4L8MA 4EL9A 5CF5A 3HV3A 4Z3VA 5IH4A 1W83A 4G17A 4FTAA 4U79A 2C6MA 5BVEA 3MPTA 2HZ4A 5HHWA 3ULIA 5GZAA 4Y46A 4K18A 2AC5A 4FKQA 3JVSA 4F7SA 3C1XA 2B53A 3KREA 4FTMA 3ORNA 4FK6A 4BDKA 2YAKA 3NR9A 4JR3A 3NNWA 3QAME 4YSJA 4AA4A 3CCNA 2VAGA 4Z7HA 3G6GA 4GFGA 2ZAZA 4QQJA 3ROYA 3W1FA 4GUBA 4MXOA 4RIYA 3CS9A 1BI7A 3Q2MA 4XV9A 4E4MA 3PPKA 3QYZA 4I4EA 3QTWA 3TKUA 2VD5A 3ATSA 5AP5A 2UZNA 4DH5A 4F4PA 2EVAA 3ZCLA 3U6JA 2QNJA 4D4VA 3MA6A 3GI3A 4P7EA 3VS7A 3ZZWA 3VJNA 1OIQA 4BYIA 4FKUA 4ZIMA 1PXOA 4RC3A 4FEXA 4NFNA 3DZOA 2C1BA 2C69A 4OTQA 2A2AA 5CNOA 4EOQA 4Z16A 3ZUUA 5L2SA 4I0TA 1ZAOA 5AAGA 3RJCA 4D2PA 1TQMA 2YM4A 4AQCA 4AZSA 3IGGA 5IMXA 3HVCA 2CLQA 3UOJA 1OUKA 4FIGA 2W1DA 2QOBA 4XP2A 3LXNA 4IB1A 3R7VA 2EB2A 4F1OA 3BYSA 3F3WA 1TVOA 3QZHA 3QA0A 4EQUA 4PMTA 5IA0A 5AUXA 1J7IA 2CHLA 4PTGA 3A7IA 5FBNC 4BZDA 3ZOSA 5M44A 3E63A 4TTHB 3FV8A 3VF8A 4ANMA 4XLVA 2P2IA 3G0EA 4C3PA 3A4OX 2XIKA 2Y9QA 3BYVA 3FZRA 2Q0NA 4FC0A 4MD8E 4RJ5A 3W2QA 3W8LA 1CMKE 3PP1A 4FTJA 4TYEA 2R3GA 5KBQA 4BICA 4M68A 4UYAA 4QP8A 4ZTLA 4PDSA 5HTBA 4C61A 2RG5A 3VF9A 3ZFXA 2WKMA 4J96A 1REJA 3QGWA 4OT6A 4NKSA 2PUNA 1OKYA 4UV0A 3IK3A 5LWMA 5EFQA 2VZ6A 4JAJA 2V22A 4KIQA 3ENMA 4CG8A 2W1GA 2W06A 2ZV9A 5LMKA 4ERWA 2QLUA 3UO6A 3UVQA 1PXMA 4GIHA 2X7OA 5AAFA 3ZBXA 5ETCA 2ITVA 4UMPA 5IA3A 5IQHA 2C6IA 1K9AA 2EXMA 2NPQA 3QTIA 3L1SA 1LP4A 4G3CA 5TE0A 4MXXA 4CD0A 3LPBA 3UOHA 1H1PA 3BU5A 5EKOA 3RK9A 4BZNA 3D83A 4AGWA 4F63A 3QHWA 1KE7A 2PPQA 3DAEA 2JD5A 3VS4A 3B2TA 3N9XA 4FTUA 3IW7A 3RHXA 3UZRA 4J97A 2PK9A 3EYHA 2GCDA 3DT1A 4QPAA 5CAPA 5EI6A 4YC8A 1ERKA 4UWCA 4H36A 4MNEA 1BKXA 3GB2A 2WU7A 4JDHA 2OH0E 4AN2A 4FKGA 5L8LA 3EHAA 3EQIA 4KINA 2VWXA 4CZUA 4WBBB 3PVWA 3Q52A 4DH8A 5AUUA 1Q8YA 4FV7A 2B1PA 2UW0A 1KE5A 2WTKB 2V0DA 2CCIA 5KO1A 2E9OA 2XEYA 4I5CA 4FT9A 3BHVA 3EQFA 2J0LA 4BBEA 2GNGA 2OGVA 4HPUE 1B38A 4KIOA 5E8ZA 4C3RA 1OM1A 4MEDA 3GQIA 5DR2A 4QP7A 4QMTA 2CMWA 4JDKA 3K3IA 2QC6A 4AG8A 3DTCA 5CEIA 3HRFA 3I0OA 5HLNA 3QF9A 2VWIA 3CBLA 4F0FA 2H34A 3ITZA 5KUPA 4NIFA 4YTFA 4CT1A 2YFXA 4RSSA 5G6VA 4AT3A 3DAJA 4O7RA 4BVUA 2BKZA 5JGAA 5CASA 2YZLA 3PJ8A 4HOKA 5TR6A 1P4FA 3CGFA 2BRMA 2FYSA 4OTHA 4JX7A 1UKHA 5ANOA 5AP1A 3ZSHA 2GNLA 4CXAA 2XNNA 3VS0A 3FL5A 5K0KA 3EQHA 3GCPA 4YJTA 4IB3A 1A48A 3P7CA 4FVRA 5GJGA 2XNMA 4H1MA 4P5ZA 2UVZA 3IPHA 4JBVA 4TY1A 4OTDA 1S9IA 3H9FA 4OTWA 4BI2A 3PIXA 1LEZA 4U3ZA 1QL6A 3RAWA 3SV0A 3TM0A 3NNVA 3R8LA 4AAAA 3ALOA 4TYGA 4BWPA 4Z7GA 2C0IA 3EN4A 4I93A 4O1PA 3HDNA 4I6BA 5AV2A 3R7EA 5IMEA 3QZIA 4V0GA 3LHJA 4CCUA 4PP7A 2I0HA 3PRIA 4DEDA 3I4BA 1DM2A 3L9MA 4IVBA 5CSVA 4FV6A 2HZ0A 3PY1A 2X4FA 3F2AA 3MYGA 4YZ9A 3TTIA 2DWBA 5D10A 3FQEA 2IW8A 2KTYA 1F3MC 2X8EA 5H8GA 3SC1A 3TJCA 1WBPA 3MY5A 4XG3A 3WF6A 3QKMA 4QMPA 2BRNA 3E92A 3QCXA 3UO5A 3F2NA 2YLFA 3R83A 1K3AA 3W2CA 4XG7A 5J9ZA 4B9DA 4CMOA 3RZBA 5HNIX 5BNJA 5FP5A 4B8MA 4OBPA 3WZJA 4NK9A 4DA5A 3U51A 2AC3A 4MH7A 4TXCA 4JR7A 4FKPA 5AM6A 2YACA 4U0IA 3PLAE 3R21A 3ORXA 2OKRA 3Q5ZA 3ZC5A 1AD5A 3L9PA 2X8IA 3GCSA 3R7UA 4CZTA 4QMSA 4OR5A 4TYHB 2QODA 2IVUA 3UG2A 3UZPA 4BWKA 5HCYA 3KKVA 4JX3A 1ZZ2A 2CLXA 5CF6A 4JQEA 4TNDA 2OIQA 4HW7A 3R73A 1PW2A 4JAIA 4NT4A 3TACA 3R8ZA 1Q24A 2IJMA 4L3LA 4Q2AA 5HVJA 3AXWA 4YNEA 1O6YA 2ZYBA 4EJNA 4DG2E 4LOQA 2XZSA 3QZGA 3AD4A 4WSYA 3NCGA 5IEXA 3KC3A 3SG9A 3UQGA 5FLFA 2XNPA 4C4GA 2JBPA 3DQXA 2UVYA 3VS2A 2XRWA 3BBWA 3DLZA 4H1JA 5GJFA 2NNWB 3FMNA 3R22A 5HVYA 3F82A 3ZFMA 5DOSA 3TZ8A 3IKAA 5EOLA 4OTRA 4TRLA 1JBPE 4FV0A 5FG8A 4MF1A 3W33A 4YJRA 5HKMA 4UMRA 3R1YA 2VX1A 4R7BA 4YC6A 3FXZA 3S3IA 3GCVA 3W55A 5IUIA 5ICPA 3KU2A 4A9UA 3GFEA 3K5UA 4CGAA 3DBQA 4I5HA 4MD7E 3RTPA 2ETRA 2GS2A 4EOSA 2F57A 5BVOA 3L8VA 3QCYA 3HKOA 3KN5A 3UOKA 3MV5A 4PX6A 5K4IA 4E4NA 4DEIA 4M7IA 2WZJA 1YI4A 3NPCA 4ANSA 3IW4A 3UIMA 2ZB1A 5CYIA 2VTQA 4LUEA 4DFXE 2J6MA 4NM5A 4D58A 3MS9A 3TNHA 3TT0A 3CKWA 5IH6A 4UX9A 1XH4A 4TN6A 4ZTRA 5M08A 4YSMA 3C4ZA 1H1WA 3DB8A 2FSOX 3BLHA 3V5PA 3S1HA 4UZHA 1H8FA 3HAVA 3NUSA 2GNJA 5KZIA 5AA9A 4HGTA 5HNGA 4QP1A 3MB7A 3VC4A 3QHRA 3EZRA 3BYMA 4F7JA 1SMHA 2BRBA 2EWAA 4FTLA 2BIKB 4I6HA 5L2QA 3CQUA 4U6RA 1JSTA 4I94A 5K4JA 1PXJA 4QMUA 4IVCA 5HE3A 2W5HA 4AOJA 2ZV8A 3TNQB 3ODZX 5BPYA 2CJMA 5GZ8A 3CQEA 4ZTSA 2WTCA 3WARA 4GK3A 3TI1A 4OUCA 2YWVA 3LQ5A 3UOLA 2PVHA 2OF2A 5ACBC 3WI6A 4EWQA 2UV2A 4FF8A 3LVPA 3W2SA 3FAAA 2ESMA 3QX2A 3VBTA 2RFEA 1L3RE 1M17A 3DOGA 3Q96A 4JQ8A 4C4HA 4E6DA 2ZM1A 5AMNA 3DY7A 5C8KA 4FIIA 1CKPA 4LMNA 4DFUA 3NUAA 2XK3A 4LGGA 1EH4A 3PPJA 3KMUA 2BILB 1I44A 3DS6A 2VWBA 4IWDA 5H8BA 4AXAA 4O7TA 3I60A 4AUAA 2F9GA 3MJ1A 2WQBA 4J99A 4IZ5A 3NIZA 4KBCA 4X2GA 3ZRMA 3HV4A 4EK4A 2Y4PA 5JFVA 1YXXA 4QTEA 5J7BA 3BHYA 3MVHA 5C26A 1U54A 4PWNA 1P5EA 4NZWB 4N70A 2B54A 1JKSA 3CPCA 2WEIA 4JG6A 1OB3A 4C38A 3ZFYA 3EQRA 3V5TA 1U5QA 4RX9A 3T3VA 3MW1A 2Z60A 5D7VA 2YISA 3R7OA 4IANA 4BTMA 4P90A 2FH9A 3PY3A 4LQMA 1YQJA 3ORIA 3RM6A 3T9IA 2UZWE 4F9WA 5I3OA 5B2KA 4OTPA 3OC1A 4YC3A 3NNXA 1JLUE 2W99B 4BF2A 1YHWA 3NWWA 4ZJVA 2QOIA 3HLLA 5D9HA 4RFMA 4M69B 5GIPE 1KV1A 3BELA 5AR3A 2QOOA 4G1WA 3PE1A 4H3BA 5LVMA 4RBLA 3D7ZA 2YM7A 4N4SA 2WTKC 1FGKA 2YIXA 3P79A 3MPMA 3KRLA 3ZYAA 5JFWA 4JDIA 2OSCA 3O96A 3FQHA 3LCKA 4DBNA 4ZS0A 3OHTA 3VNTA 4I0SA 4CT2A 5IA2A 3ZZEA 2BDJA 5EM8A 1QPCA 2JDTA 2XNEA 3P08A 4TPTA 4C0TA 2XKDA 1H1QA 4O7SA 4HYSA 3JY9A 3HRCA 2O64A 3NX8A 4FSWA 4O0TA 2UW7A 4FNWA 4FIEA 4AN3A 3UP2A 1OKVA 5IDNA 3TNIA 2F7ZE 3DK6A 4UXLA 2J2IB 3HA8A 4DEGA 3M11A 3EQBA 3CE3A 3MWUA 5EQYA 4BCHA 5CU2A 1W7HA 1WMKA 3V51A 4FKOA 2Q0BA 3UODA 1OGUA 2E2BA 1UNGA 5AV0A 2NRUA 3LXKA 3WYYA 4BBFA 5E8YA 4NJ3A 4EC8A 4F1MA 4X6QC 3ACKA 3TCPA 4RIWB 3FC2A 4DYMA 4TT7A 4FI1A 4ACMA 3BE2A 1JKKA 1J91A 1ZXEA 5IQBA 2XP2A 3FDNA 4L68A 3WF9A 5FQDC 1DAWA 2V7OA 4WD5A 3UNKA 4PNKA 2H8HA 3EH9A 5L2WA 4DFNA 4DH7A 4GKIA 1G5SA 3PY0A 4DLIA 2XJ0A 3VS6A 2WMQA 4BCNA 1ZRZA 4AN9A 1MQ4A 3CC6A 5AEPA 4U5JA 5LMAA 4J8MA 4RLLA 4J1RA 4U3YA 2VTAA 5C01A 1O6LA 3WIKA 4EH4A 3LMHA 4Y5HA 4AF3A 4IH8A 5J8IA 3Q60A 4PQNA 3NUNA 4W4VA 5HTIA 5IQAA 3R9DA 2XRUA 4FNZA 1MRVA 4JRVA 4M97A 4TL0A 2WTWA 2YDKA 3MH2A 4H39A 4AOIA 4BDAA 2J0JA 2OO8X 4IHPA 5B0XA 4ZLYA 4UALA 2QR8A 4JIAA 5IUGA 4BDBA 3PIYA 4DH1A 4FG9A 3VQUA 4QMMA 4XG9A 2OFUA 4DTKA 4FV2A 5IU2A 2PZ5A 4PPCA 2R2PA 2QVSE 2ACXA 3HEGA 4BYJA 5J1VA 4JBQA 3AT3A 4IX3A 5JRSA 4HYUA 1XQZA 3E87A 3GOPA 3NYOA 3OCSA 4LV8A 2XK6A 1FMOE 3F3TA 3QUPA 3RK5A 4ASXA 1Y8GA 4D1XA 2YIWA 3R04A 4NTTA 3UGCA 5BMMA 3RPRA 5CNNA 5AUWA 5AR8A 4Q9ZA 1J7UA 3FWQA 5AAEA 2XK4A 5I9XA 2OK1A 1NVRA 2WIHA 1SYKA 4G3GA 5CTPA 3R2YA 3Q5IA 4FGRA 1Q99A 2REIA 4BB4A 1GZ8A 2YWPA 3COIA 4I6FA 2GNIA 3UMXA 1UU3A 1Y57A 5BVDA 5HD4A 2W4OA 1SM2A 2BCJA 2C5VA 2VU3A 3A61A 4XBRA 3KVXA 3RAHA 1STCE 3ZO2A 2HWPA 5I9ZA 1JNKA 3JYAA 3BRBA 3TUCA 2UZOA 4FL3A 4QQCA 4BY9E 4IW0A 4RJ7A 1XKKA 4PV0A 4E93A 3T9TA 2B9HA 2R4BA 2IZTA 1WCCA 3GCQA 2A19B 3H3CA 1YW2A 2JKMA 2R3FA 2PVRA 1PXIA 5HE0A 2BUJA 4CLIA 1Q41A 2ONLC 4D4RA 4ZXTA 3M2WA 4YZCA 1PJKA 2Z7QA 2PVLA 1J1BA 1RDQE 3CPBA 4XOZA 5G1XA 4FKLA 3V04A 3KEXA 4ZP5A 1XH7A 1UNLA 3PLSA 3RWQA 2HENA 5FUTA 3RP9A 3AD5A 4FZDB 3ZM4A 4BGGA 3LKMA 1KUTA 4LOPA 3O7LB 4L3JA 5IA4A 4L6QA 3PWDA 4FGBA 4BDHA 3W2RA 4JQ7A 2B9JA 3LW0A 5A6NA 3QRIA 4CVAA 5KHXA 4DF3A 3KRXA 4B0GA 4D2VA 4MK0A 4NKAA 4FIJA 3SQQA 2J7TA 4DGMA 1VJYA 3UBDA 3EN6A 2JFLA 4CV9A 3DV3A 3H9OA 3Q04A 3UMWA 3QTXA 5AUVA 4FSRA 4AU8A 2JIUA 4FIHA 3FZ1A 3QTQA 5F4NA 3DBEA 4DG3E 3NYNA 5K9IA 5EW3A 1Z9XA 5BVWA 3DJ7A 3PXRA 5BVNA 4YLKA 5A3XA 1MP8A 3F7WA 4XH6A 4O83A 3MVMA 1OIYA 4DHFA 4DGGA 5CEOA 3BWJA 3LFCA 5J95A 2C68A 3MSSA 3W32A 1Z57A 4UZDA 4EJ7A 1JQHA 4W4XA 1H0VA 4L42A 5D11A 2R9SA 3NW5A 4IFGA 2CKPA 3CY3A 1UA2A 4E6AA 5A4LA 2YERA 3GP0A 3H0YA 4FZFB 1FGIA 2IZRA 3MGYA 1ND4A 1XH5A 3U9NA 4CQEA 2IVTA 4L53A 4ZZMA 4HVHA 1S9JA 4E26A 2CCHA 3P1AA 2QG5A 4FODA 4QD6A 4E4XA 3LJ2A 1TQPA 3BLQA 4BCMA 5KMLA 4DGLC 5M4UA 4PMSA 5FXRA 4D55A 4LOOA 3MH0A 5IQDA 1PXPA 5KHWA 1OL7A 2WMUA 4QPMA 5AUZA 4YZBA 3UVPA 3VS3A 5AV3A 4K77A 4EBWA 4ACCA 4EKLA 4GFOA 5JH6A 4K2RA 2PULA 4OTGA 2F2CB 5IF1A 3R7GA 1M2RA 4USDA 4RPVA 1OL6A 2QONA 2Y7JA 3KL8A 5IISA 2P3GX 3FMJA 1J3HA 2FUMA 1W82A 5HBHA 4C58A 3QQGA 1JSUA 3SX9A 2JDSA 3BIZA 4IWPA 1B6CB 3KN6A 3EIDA 4ANOA 4ZJIA 4EUUA 3OCBA 3PE2A 4EHZA 4NCTC 3HNGA 3G9NA 4KBAA 4Y85A 5DT4A 5E92A 5ITAA 1U46A 4IVDA 3V01A 3DBCA 5B7VA 2QKRA 5CU6A 2X7GA 5HOAA 1RJBA 3KQ7A 4W4WA 1WVYA 3QTRA 3WYXA 2XIXA 3Q6WA 3GU5A 3COKA 2GHGA 4EOPA 1VYZA 3EMGA 3D7TA 4L7FA 3E62A 4IZYA 4B6LA 5JGBA 4QMZA 3ZU7A 4J7BA 2BRHA 1OITA 3N51A 3C7QA 3IS5A 4DT8A 4O0XA 5FM3A 4YHFA 3FXXA 2PVFA 4CFVA 1X8BA 4U42A 1ZWSA 4F99A 1JVPP 5LMKC 2W1CA 2GQGA 3QD0A 4RX7A 4IM3A 2JGZA 3AC5A 4YP8A 2BAQA 1RE8A 3AD6A 3H9RA 4JI9A 4MXCA 3VW8A 5AIKA 4FA2A 2YDIA 2XIYA 4R1YA 3HMOA 4U9AA 5CQWA 3VWAA 2G1TA 4XV1A 3K54A 4QP2A 3DFCB 4C57A 4G6OA 4QPSA 5TT7A 4AW0A 4WA9A 2W0JA 3ZRLA 4ALWA 1FVRA 2XCKA 2ZDUA 4QYYA 4EH9A 2V55A 1GOLA 4DT9A 3PXKA 3Q9ZA 3QRJA 3EWHA 5HD7A 4BTFA 4U81A 2EUFB 4FL2A 2DS1A 4I23A 1R0PA 2J0MB 1Q8TA 3BBTB 5CZHA 5H9BA 4DEAA 4J95A 1YI6A 2ZB0A 4MBLA 1UU7A 4O86A 4ZSJA 4IAKA 3I5NA 3PVBA 1UV5A 4I3ZA 4EWHA 1BL7A 2WMBA 3K5VA 3VQHA 2OZAA 4WIHA 4C4EA 5CLPA 3NDMA 4YHJA 4GL9A 4MNFA 2YAAA 2IPXA 1CSNA 2GTMA 5AJQA 5E1SA 3LJ0A 5E8TA 2VWZA 3LFBA 3MFUA 4IADA 3FI8A 4LL0A 4ACGA 2X7FA 3WBLA 3MIYA 3F3VA 2ZJWA 3OUKA 4CFMA 2OZOA 4KS7A 2RKUA 3P0MA 3AC3A 4WNKA 4FV4A 1JWHA 2VTMA 4IDTA 4IWOA 4S30A 4Y8DA 4BI0A 2C6DA 1APME 4PNIA 2XYUA 4USFA 3ORZA 3LAUA 5DT0A 4CRSA 1PKGA 3R1QA 5M4FA 4IDVA 1ZOEA 2Y4IC 3OG7A 4MXAA 3O50A 3EYGA 2GU8A 3QWKA 1WVXA 5BVKA 3E3BX 4EOIA 5BYYA 5H8EA 1OKZA 2YIQA 5AP2A 5AX9A 2LAVA 2KULA 4H05A 3KF4A 2OLCA 4HCTA 1NW1A 4HPTE 4IX6A 4M8TA 3HGKA 4BKZA 2B55A 4GYIA 4PDPA 4M3QA 5BYZA 2OJFE 3TV7A 3LMGA 3O2MA 4P5QA 3WZUA 5CAUA 1PMNA 3IDCA 2XH5A 3PVUA 3BCEA 5CEKA 2G15A 3NSZA 5LVPA 1YWVA 2F7XE 4EQMA 3S4QA 2I6LA 2VTNA 5JSMA 1JAMA 4F08A 2I0YA 2PMNX 3L9NA 3OY1A 4IVAA 2WMVA 3FLSA 4HNIA 5EG3A 3I7CA 3KF7A 2P4IA 2RIOA 4DEHA 3BLRA 5AR2A 3DKGA 4D1ZA 3EKKA 4CYIA 3P4KA 5LVOA 1UU9A 3BI6A 3ZHPC 1ZMWA 3HUCA 3LXPA 3F88A 4E73A 3DNDA 4KRCA 4EYMA 1M2QA 4WRGA 3FZSA 3R8PA 3Q32A 4QYHA 3SXSA 1Y6BA 4EBVA 3AMBA 3BU3A 4QYEA 3HP2A 2HW7A 4XX9A 2HELA 4ZJJA 1DI8A 4FNXA 5EQPA 3ANRA 4M69A 2Y6MA 4LRMA 4QQTA 1KE9A 3WF8A 1RW8A 5BUJA 4EC9A 5IPJA 3PZEA 5J5SA 5K5NA 3NZ0A 4G5JA 4R5YA 2JKKA 3MJ2A 4KSQA 2VWUA 5DHJA 2QOQA 4K6ZA 2ITPA 4NSTA 4R7HA 4Y72A 4ZZNA 4M14A 2YM8A 3OVVA 4TNBA 3V3VA 3D5XA 5JFSA 3QX4A 3AMAA 2ITNA 3FXWA 4QYFA 3UNJA 1ZYSA 4BHNA 3OOMA 4BN1A 2YCRA 5L8JA 4EOKA 2OJ9A 5AX3A 4U80A 2VTPA 3QBNA 5DNRA 4DTAA 5IQGA 5DEWA 3WE8A 2FB8A 1W0XC 2W1FA 3A62A 4FIFA 2FGIA 4FT5A 4NM3A 5HGIA 4X2KA 4QMNA 5IQEA 3CXWA 5CVFA 5CX9A 1IEPA 3R1NA 2H6DA 4RIWA 3OCTA 4AA0A 2PVNA 4PUZA 5AA8A 2UZTA 5KZ0A 3V8TA 1DAYA 5EDPA 3P7AA 2WPAA 1E1XA 2W1EA 3DK7A 4FTKA 4ANNA 2IVSA 3CIKA 4KIKB 4F09A 4YU2A 3CTQA 3PA4A 5T68A 3KCFA 4K9YA 4D2RA 4FKSA 3PVGA 2X1NA 5DIAA 3NYVA 4FICA 4FV1A 4XMOA 3OF0A 5M4IA 4U7ZA 3O71A 4AZWA 3HYHA 2Z7SA 4YJQA 2UW6A 3W10A 3PA5A 3I81A 4GFMA 5DWRA 2ZM4A 2QHNA 5CSXA 5EI2A 4GK2A 2VNWA 3RAIA 4QTAA 3TJDA 1IG1A 2XVDA 2VTSA 3LLTA 3Q4UA 3BYUA 3DZQA 5A4CA 5DRBA 4USEA 2CNQA 4O84A 3MDYA 5LCKA 2IO6A 3OW4A 2C6OA 1L8TA 4AZTA 2OH4A 2ITXA 4PP9A 3SG8A 2YCQA 3NUYA 3KXZA 3TZ9A 4BIBA 1R39A 3MFTA 2WMWA 1OZ1A 2ERKA 3T3UA 4BKJA 3UNZA 5IEVA 3VS1A 3MFRA 2X9EA 4BCQA 2PSQA 2WQEA 4FT0A 4GU6A 3FPMA 3LM0A 3FSKA 4DBXA 2XKFA 2XUUA 3SOCA 3GGFA 5KMJA 1VYWA 4DEEA 5L3AA 3LFNA 4XP0A 5KMNA 4RX5A 3UYTA 1UU8A 5BYLA 4YGAA 1KV2A 4D28A 1PF8A 2B9FA 3F5PA 3RMFA 2VGOA 3BHHA 2G2FA 4FG8A 1BLXA 2O3PA 2C5OA 2HIWA 3OFMA 4GG5A 4PTCA 3SGCA 2Z02A 3SKCA 3P9JA 4HYHA 3S95A 4YJUA 2R3JA 4IC8A 3VJOA 3OZ6A 4PY1A 2XK7A 4EOOA 5A4QA 1G8AA 4DFZE 3LCTA 1CKJA 3RI1A 2UUEA 3D0EA 3ZO4A 2PY3A 5JEBA 2XIRA 2WTDA 5EYKA 4KNBA 1H07A 4FYOA 4N6YA 2FSLX 4OTFA 5HO7A 1FPUA 2YA9A 4EH2A 4OBOA 3LXLA 2QOKA 3OBGA 4I20A 2F4JA 4GYGA 3UG1A 4CMUA 5A54A 4D5KA 4GT4A 3TIZA 2E9NA 4GEOA 4HGLA 4YHTA 2C6LA 4D2SA 1NY3A 3KXHA 4X2JA 5CQUA 3BHTA 3QZFA 4JG7A 3HP5A 1W8CA 1AQ1A 3PXQA 3KRWA 2XEZA 2Z2WA 2PZYA 5HZNA 3TN8A 3UIBA 3GC7A 4JLCA 2WEVA 3KB7A 1YI3A 3C4WA 3IO7A 4FKIA 4II5A 5HE2A 2IVVA 3T8OA 1PYXA 1H26A 1KOAA 5CSWA 2ZMCA 5F95A 3OWLA 4NU1A 5CENA 4DC2A 4ZS4A 4CLJA 5JRQA 4FSMA 3LFQA 4B7TA 1IRKA 4U8ZA 2DYLA 4NW6A 3O7LD 4QTBA 4ZMFA 4ZSGA 4D9UA 1K2PA 2WXVA 3QALE 4FE2A 5GINE 1M7NA 2YIRA 4RZVA 3FY0A 2JFMA 4IQ6A 4BC6A 2CNUA 3ZBFA 3TV6A 2R3QA 2C3JA 5F20A 5ACKA 3TWJA 2ITWA 2WMRA 1QPJA 4AFEA 5A6OA 3F5GA 5EHLA 2VTIA 4K0YA 5DRDA 3NVKI 1B39A 3FMLA 4ZLOA 1WZYA 4KS8A 5IH5A 3PXYA 2J0IA 4RWIA 3W2OA 1URCA 2JIIA 4IC7A 4RWKA 2VWYA 3ZMMA 4KIPA 3KCKA 5ETIA 2V7AA 3ULZA 1W84A 3MBLA 2IW6A 2JAVA 4WKQA 3O17A 3OY3A 2O0UA 2O65A 4QNAA 4FT7A 2QD9A 4LGDA 3EFLA 4D0XA 4DE4A 1VZOA 3KRJA 4BWXA 2XB7A 2XCHA 5DE2A 5DG5A 4K1BA 2C6EA 3FMKA 4PMPA 1Q97A 2HAKA 2CNVA 3PUPA 4C33A 2YN8A 3OCGA 4FOBA 5CF8A 1PMUA 2NP8A 3M1SA 3PSDA 2VWVA 4R7IA 1OBGA 2UW4A 3FE3A 3ZUTA 1ZZLA 4RT7A 1PXKA 3R7YA 3FMHA 3G15A 3TDWA 4RJ6A 3P7BA 4EH8A 2BKKA 4IFCA 3GBZA 3MA3A 4Y83A 2UZLA 4U97A 5CALA 4O7LA 2IN6A 3QFVA 5M55A 4CMTA 4U43A 3C9WA 4BDGA 5ANIA 4X6RA 4L43A 4X3FC 2CGVA 4Y95A 4KAOA 5CXHA 3EQGA 1XH9A 2C4GA 3FLWA 5E8WA 4EK5A 2QOFA 4FTQA 4PPBA 2C3LA 4KUJA 2JAMA 4FUXA 2QLQA 4FR4A 2BDFA 2QO9A 2VV9A 4ANQA 4CFNA 3CTJA 4IAZA 3WE4A 4WO5A 3PP0A 4KBKA 1ZOGA 5AP3A 4FEWA 4QYGA 3A7HA 1G8SA 4M84A 4AA5A 3OTVA 3QXOA 1GY3A 2IZUA 3FZTA 2PHKA 2X6EA 4ASEA 2C0OA 2J5FA 4O1OA 4L46A 3ZTXA 2JDOA 3MH3A 3IGOA 4N0SA 2RFSA 4RLKA 4O2PA 3ZO1A 4F9AA 3TUDA 3BGQA 2QOCA 1GNGA 4G9RA 3HECA 5CVGA 1U59A 1YXVA 2VTRA 4YTHA 5C27A 3WZDA 4D2TA 4OGRA 2HZIA 1M14A 3C4FA 1KWPA 4AW1A 2WU6A 3NRMA 4FMQA 3DJ6A 2WTIA 5HX8A 3R9HA 4FKJA 2XK8A 4C3FA 3HMNA 3TTJA 3RPYA 3JVRA 2B4SB 3Q2JA 3GOKA 2VX0A 5BUEA 4HNFA 2YM6A 3KXGA 2QI8A 2R0UA 5DA3A 2PUPA 4DLJA 2AYPA 4AE9A 4DINA 4ZSAA 2E9PA 5CAOA 4DG0E 1H0WA 3I7BA 4EZ7A 4FEUA 2XA4A 3EZVA 3UP7A 1OPJA 5L2TA 1YVJA 1QPEA 4QTCA 3L8PA 4JNWA 3EN5A 3QUDA 5E8XA 1H27A 3QD4A 2I1MA 4ALVA 5HU3A 4S31A 4BI1A 4EH6A 2IW9A 2XKEA 2JDVA 4FX3A 4R3PA 4AP7A 4BDJA 4BZOA 1DI9A 4G34A 4MNEB 5JGDA 2JLDA 3F7ZA 4AGDA 4J71A 4F9BA 3I0QA 5EW9A 5HVKA 4GVAA 4WRSA 3TIYA 3L8XA 3P5KA 1H28A 5HICA 2PMIA 3HX4A 3FMDA 3MB6A 3OS3A 4IIRA 3FI4A 1H1RA 4QP9A 2QURA 3E3PA 2JITA 4LYNA 4IAFA 4RQVA 3DTWA 2G2HA 1YOLA 2C5NA 3V5JA 3WF5A 3U6IA 4AACA 4BKYA 4EEVA 3I5ZA 3MY1A 4AS0A 4CFUA 4FZAB 4CKJA 3C5IA 2VO0A 4RMZA 4GG7A 1QMZA 4E5WA 5AP4A 4MTAA 3ZXZA 4NIFB 3F3UA 5HX6A 2P2HA 5CSPA 3RVGA 4CYJA 5EW8A 4M66A 4FTCA 5HG5A 5JFXA 5F1ZA 4BTKA 3PSCA 5KBRA 4FBXA 4ZY6A 3TKHA 3TG1A 2GQRA 2Y4IB 5EI8A 1ZY5A 3CSVA 2F7EE 4JRNA 5FEEA 3VBVA 1VR2A 2R3LA 4OW8A 4BTJA 1SZMA 1YXTA 4F7NA 1IAJA 4UMTA 3SA0A 1WFCA 3E8NA 3S00A 4ORKA 3QLFA 2WFYA 4CKIA 4LUDA 4DTBA 2HW6A 4X3JA 3TV4A 2BR1A 3G6HA 5A4EA 3BV3A 2PZRA 5JMSA 1GZNA 4O0VA 5KE0A 4I21A 4ZY4A 1WVWA 5M07A 3OTUA 4EUTA 4S2ZA 3CR0A 3KMMA 3RGFA 3FMEA 4QMXA 4ERKA 3TDVA 2WMSA 4AOTA 3U54A 3UVRA 2G01A 2Z7RA 3ELJA 3PJCA 5ANKA 4W4YA 4M0YA 4C34A 4ASDA 3VBWA 2UW9A 3UZTA 1ZARA 2ITOA 5CI6A 3HUBA 2J51A 5FRIA 4CSVA 2W9ZB 3ORPA 2DUVA 1ZY4A 2ITYA 3SRVB 5DYJA 2HYYA 4BCKA 5DI1A 3QQLA 3ZLSA 1NA7A 4C37A 3ET7A 1WBOA 3O51A 3FMMA 4EKKA 4BFMA 3G33A 3D15A 1XBCA 2OXDA 3OD6X 4IAYA 4HGEA 4DGOA 3FKLA 4DFLA 5KCVA 2PVMA 2CGXA 3JY0A 4NJDA 1Q61A 4TWOA 4KABA 2OI4X 3LJ1A 5CVHA 3NLBA 4QMOA 4E8AA 3CJFA 4W8DA 5CS6A 3UC3A 4O7YA 2WQNA 4ZSEA 2PYWA 4IZAA 3OP5A 3B8QA 1Z5MA 2JDRA 3R63A 4RIXB 3V6RA 4D4YA 2YJSA 2QU6A 2WNTA 4A7CA 3Q4TA 1ZYDA 3AC8A 4MWHA 1H25A 2OBJA 3RM7A 4PF4A 2HZNA 4D4SA 1J1CA 4MHAA 4FSQA 2G9XA 3IOPA 4O0WA 4U41A 3JS2A 4UN0C 4J52A 4ACDA 3VS5A 4L45A 4XLIA 4O38A 2B9IA 3WZEA 2ZOQA 1HCLA 4C02A 3I6WA 3KRRA 3RCJA 3P86A 3PJ3A 2ITTA 2H9VA 2PE0A 3GQLA 5HU9A 5DFPA 2WB8A 1TQIA 2Y6OA 4A4XA 5L4QA 4OT5A 3UDBA 2UZBA 1GZOA 1XO2B 3GU6A 2WTVA 3R6XA 3HA6A 3O8PA 2ZV2A 5F94A 5BVFA 5C9CA 3WZKA 2A4LA 4FKWA 3MTFA 5TO8A 4F65A 4HCUA 4WNMA 4LFIA 4BCOA 3DPKA 2I0VA 4IMYA 4TYIA 3THBA 4XEYA 1OIRA 2XJ2A 4PPAA 4EH5A 5IEYA 4H3QA 2WTJA 3RK7A 4YJVA 4ANLA 3LCDA 3W2PA 4GU9A 3QL8A 2UW8A 3E8EA 5ANJA 5IQFA 4EONA 1OPLA 4C59A 3RAKA 4RG0A 3JR1A 4GSBA 4QMQA 1Q5KA 3PA3A 3MN3A 4I1ZA 3PWYA 4NUSA 3UC4A 1KOBA 3KXMA 4MBJA 4W9WA 1ZYCA 4FV9A 3DXQA 2R7IA 2BFXA 3DXNA 3BGZA 2X6DA 4GT5A 4OBQA 4Z55A 3G5DA 4I24A 2XYNA 4J98A 3ACJA 4IX5A 5L6PA 2BVAA 1JPAA 1RQQA 4IWQA 3QLGA 2BIYA 4CRLA 4DCEA 5IQCA 4OTIA 3NEWA 2E9VA 4ASZA 5C8NA 4CG9A 2UVXA 4BCIA 4D1SA 4P2KA 4PL4A 2YIYA 3POZA 4KKGA 3AOXA 1R0EA 2EXEA 3KGAA 3QQKA 3NAXA 4GMYA 1PY5A 1FBNA 3GFWA 5L8KA 5M06A 4V04A 4ZTHA 2PZPA 4LGHA 4V05A 3ATTA 4BCGA 2IG7A 3CLYA 1FOTA 3DCVA 3Q6UA 4RVKA 4RJ8A 3VN9A 3CQWA 1H08A 3FUPA 3GENA 4FTRA 3TKIA 3I6UA 2CGUA 3OWPA 4DCAA 3VULA 3FLNC 3OW3A 3RALA 3OBJA 2R3IA 3CJGA 2QOLA 4K11A 5KKRC 2C3IB 3G90X 2OXXA 4H58A 2PVJA 3VW6A 5DVRA 5I9YA 3P78A 1DS5A 1YHSA 4QNYA 4XCUA 2HXLA 3GEQA 3O8UA 1HCKA 2BFYA 5HCXA 5AFVA 4R78A 3G2FA 1GIIA 2P33A
chains in the Genus database with same CATH superfamily
3TNWA 4W9XA 4O81A 4EQCA 4HVIA 5CZIA 2WMTA 4C8BA 4HYIA 1CDKA 2X4ZA 3ORTA 4Q9SA 4TYHA 5TOZA 3TZMA 5HIEA 4IAIA 4FKVA 4QMYA 2IWIA 4EOMA 1ZOHA 4GRBA 3IONA 3LIJA 4WNPA 5E7RA 2XMYA 3NUXA 2BROA 4F9CA 1Q3WA 2OFVA 3BU6A 2ETKA 2R3HA 2RFDA 1YDSE 2V62A 4X0MA 4C7TA 3U9CA 4W8EA 5CWZA 5AUYA 4WUNA 3MI9A 1PKDA 5D41A 1JOWB 2GNFA 1GAGA 1LR4A 1KE8A 2OU7A 4O4FA 4YZNA 1ATPE 3OWJA 3ZDUA 4IB0A 4BDCA 2Z7LA 3I1AA 5HORA 4OAVB 2W96B 4O7VA 4A4OA 4BJJB 2HY81 4GT3A 2BRGA 3FLZA 3MIAA 3O0GA 4YMJA 5AR7A 1M52A 3G51A 3Q53A 4XRJA 3SXFA 3HMMA 3OROA 3FLQA 3ZRKA 3UPXA 3KY2A 4FTIA 1Q3DA 1PYEA 3RNIA 2B52A 4FZ6A 2YCFA 3FYKX 3QTSA 3VONA 4OAUC 4B99A 3KK8A 4RVMA 3ZM9A 3GVUA 4X2FA 5HNBA 2R7BA 3Q4CA 3VUTA 4BBMA 1XWSA 3R8MA 2GFCA 3DGKA 3IQ7A 3DJ5A 4FSTA 4A07A 5CF4A 3CTHA 5DPVA 3VO3A 3A4PA 3PJ1A 3KXNA 3ZUVA 3BV2A 4DITA 4GH2A 3QCSA 4DFBA 5HE1A 3QTZA 2WQMA 3FKOA 4FVQA 2PZIA 4JBPA 5CEMA 3SXRA 3ZO3A 3HRBA 4MKCA 4QQ5A 4RFZA 2GFSA 3REPA 3OT8A 3D5VA 3D2KA 5KMKA 2W7XA 4YJOA 5HEZA 4APCA 5HQ0A 1GJOA 3DFAA 3OUNB 4QT1A 2VO3A 2C5XA 2FVDA 3L8SA 3VUHA 3FZPA 4F70A 1V0BA 3LQ3A 3RHKA 3TZ7A 3D4QA 4ZEGA 4FSNA 3VHEA 5HBJA 3UE4A 3C5UA 3QRTA 4I22A 4MVFA 4YO4A 2OJGA 5HG9A 5AV4A 5KNJA 1KE6A 2C47A 2RG6A 3DK3A 4XYFA 4MQ2A 5EDQA 4FOCA 5LARA 3RKBA 3RPVA 4ARKA 4AW5A 5HLWA 5I3RA 1PMVA 3DA6A 5HTCA 3BQCA 1JKTA 3IDBA 3W18A 1NVQA 2BALA 5LCJA 4X21A 5J5TA 1M7QA 4DFYA 1G8JA 3A8XA 3AKLA 3DNEA 2XF0A 3FPQA 4ENXA 2A1AB 3GT8A 4RIOA 4F78A 5D12A 4BIEA 3AGLA 5HIDA 4A9RA 3GCUA 4YLJA 4FTTA 2VO6A 3C0IA 2QKWB 3FLYA 1BL6A 2WELA 4WOVA 3DQWA 1YWNA 3PXFA 4FYNA 4BDEA 1XMLA 3PFQA 2CGWA 4DGNA 2H96A 1H4LA 3IECA 5GJDA 1XH6A 3ZLXA 2CKQA 4I6LA 2C1AA 4DH3A 3M42A 3U4WA 4X3FB 3DXPA 2YDJA 3E8CA 3ZDIA 5KX8A 3DKCA 4NCTA 1NXKA 4FZ7A 3QD2B 4B4LA 4NM0A 3KULB 3ML1A 2O8YA 1ST0A 1O6KA 1U4DA 4ALUA 1YRPA 3SLSA 3BWFA 4F6SA 2YZAA 2Z8CA 4YJSA 4ENYA 3QC4A 1Q8WA 5EHYA 1UWJA 5CU3A 3IW5A 5GZ9A 1G3NA 1OECA 3VBQA 1NT2A 4I6QA 3HV5A 4MD9E 3HV6A 3FJQE 3ORMA 4ID7A 3S0OA 3KXXA 3QQJA 4RJ4A 4WBOA 4RWJA 3NFFB 3A7GA 4NL0A 3IW8A 3JPVA 4BDDA 2W1IA 3WOWA 3E93A 4FL1A 5I4NA 4X7QA 4RC4A 1W98A 4FSYA 3R28A 2CSNA 4XHKB 5HCZA 2XM9A 3PG1A 1XR1A 3MVJA 2ITUA 3ORLA 2YCSA 4BIDA 4DAWA 4ZAUA 4ITIA 5J7HA 3LOKA 3D5UA 4F6UA 3VBXA 4C62A 3HL7A 5JQ5A 3CGOA 4TKSA 3GU4A 5T6KA 5CT7A 1CKIA 4J8NA 3VUMA 3OT3A 5AP6A 1H24A 2OG8A 5FDPA 4O22A 3GC8A 3VAPA 3DDQA 4L01A 4GCJA 3A99A 3QC9A 2PMOX 4JXFA 5CU0A 3GU7A 2GPHA 3A2CA 3EJ1A 2W05A 5JKGA 1IASA 2PE1A 2WQOA 4ZK5A 4IJPA 4XJ0A 5LQFA 1OL1A 2UW5A 4BDFA 3MVLA 4ZSLA 3N4UA 4DEBA 3EL7A 3C13A 3N4TA 3FSFA 4EHVA 3PZHA 2ZMDA 1KSWA 2HCKA 4ACHA 4UWBA 1E1VA 4A9SA 3LE6A 4AXFA 1OMWA 2NO3A 3BKBA 4JOAA 5E8SA 3EL8A 3F61A 2YM3A 3C50A 3GC9A 3AC1A 4XNEA 3NCZA 4C4FA 3AC2A 2ITZA 4FUYA 4O7ZA 3QD3A 4O91A 1LPUA 2AUHA 3V5QA 2XNBA 4IX4A 2W4JA 2BPMA 1YKRA 3NGAA 2OWBA 4APPA 5IDPA 4O0UA 3VRYA 3NMUF 4JS8A 3P23A 2QQ7A 4WG5A 4UY9A 1GZKA 3IOKA 4H3PA 5HBEA 3UYSA 4NW5A 3OWKA 5T3QA 3FEGA 4GKHA 3LFSA 4S32A 3PG3A 3A60A 4YR8A 5D7AA 3RPOA 3JXWA 3ANQA 3H4JA 4U44A 5C4LA 5FGKA 4FNYA 4RA5A 4ZTQA 2XIZA 4FKTA 5M53A 1FINA 2VWWA 5D1JA 4YBKA 5HI2A 3SDJA 2CDZA 5L6OA 1UKIA 3JUHA 4S33A 3COHA 3E88A 3ENHA 4KWPA 1FVVA 3EQPA 4XBUA 3RINA 1V0OA 2O5KA 1PXNA 1UVRA 4JT3A 3IG7A 1JKLA 3DDPA 4FSZA 1V1KA 2X2KA 4NTSA 2WGJA 3GU8A 4XRLA 4CTBA 1XH8A 4I92A 2VTHA 4CCBA 4UMUA 5DEYA 4G2FA 2J4ZA 2WHBA 4FG7A 5FWKK 3UO4A 1PRYA 4U45A 2PWLA 3SRVA 4EK8A 4ITHA 2LGCA 3RCDA 3VHKA 4G9CA 3HMPA 4WG3A 5BQ0A 5HO8A 4D0WA 4UBAA 2BDWA 3RBWA 2C5YA 2W9FB 3ZSIA 2X2LA 3Q9XA 4MCVA 1YOMA 5LVLA 3CP9A 2C30A 4CEGA 4LMUA 4AZEA 5E1EA 1JSVA 4Q5HA 2XS0A 5ETFA 3V8WA 1XBAA 3U87A 1A06A 2PUIA 4I5PA 5CU4A 2BZIB 3C4XA 3FL4A 4PDYA 5ANEA 4ZTNA 3BYOA 5LXMA 3U4UA 4ZY5A 2YABA 4S34A 5JN2A 4HZRA 1GIHA 4RIXA 4EZ5A 1YHVA 3AKKA 4IBMA 2XK9A 4M0ZA 5CI7A 4AE6A 4EK3A 1F5QA 3ID6C 5IQIA 5E8VA 5TF9A 3VBYA 1MRUA 2OIBA 4IB5A 3E5AA 4M12A 2XAMA 2CN5A 2PUUA 1R1WA 4KD1A 4O2ZA 3DBDA 5AP7A 4F9YA 3DKOA 5HO6A 3D7TB 3HMIA 3PRFA 5LWNA 3UQFA 3C0GA 3DU8A 2E9UA 4NEUA 1ZMUA 3SOAA 2JIVA 5AV1A 4BL1A 3V6SA 3BZ3A 3ZONA 3QKLA 2GS6A 1BX6A 2YJRA 3E7OA 4J53A 4QP6A 2VUWA 2IZSA 3OXZA 4XUFA 1WBWA 2R64A 3QWJA 3HDMA 2PL0A 4Z9LA 3QQFA 4M15A 2XNOA 5TKDA 1WAKA 1H00A 3QUEA 4O0SA 5GHVA 5CT0A 2BHHA 3FI3A 2CPKE 2F2UA 4I0RA 5A14A 4XP3A 4CFXA 1R3CA 4MWIA 4E6QA 4EHEA 4UWYA 4XG4A 1FQ1B 2J50A 3R00A 2W5AA 2FSTX 3QXPA 4HGSA 5KMIA 5I0BA 4DHIB 4JVGA 4IAAA 5IA5A 4QMVA 5A4TA 2XM8A 4EORA 2QG7A 3R9OA 3DBFA 3KMWA 3A7JA 5HG8A 4YO6A 2X81A 3BEAA 4GK4A 3WIGA 5DMZA 3LQ8A 5J9LA 3FYJX 4E4LA 3ZC6A 4ONAA 1SVEA 5EQEA 1P14A 3ZLWA 3KFAA 1FVTA 4EHGA 5EHOA 1PMEA 2UZDA 2VRXA 1J7LA 5AUTA 3U55A 4ZLZA 3AG9A 3F69A 2X39A 3PIZA 3PSBA 4EZ3A 5F9EA 4XG6A 3AGMA 4F64A 4C2WA 3BL9A 2RFNA 2R5TA 2YHVA 2W4KA 4RIYB 5FTQA 5I9UA 1T45A 1TKIA 4G5PA 4BCPA 2I7QA 4MX9A 5JQ8A 2CKEA 2O63A 4C4IA 4UEUA 5JZJA 5AR4A 5BV3A 5J1WA 2OZAB 2R3RA 1YXSA 4EH3A 3FZOA 4FVPA 4WSQA 4O0RA 4IZ7A 4CFFA 4GVJA 4RJ3A 3ODYX 3TXOA 3ZEWA 1BUHA 4FEQA 3QTUA 3SVVA 2G2IA 3LFFA 4XV2A 4I4FA 2XBAA 3SAYA 3D14A 3UTOA 4CFWA 2UZUE 3BEGA 5IUHA 4EH7A 1WBVA 4ZMEA 5IZFA 1I09A 4D2WA 2CN8A 5FD2A 3C4EA 3ZXTA 5CAQA 1VEBA 5JT2A 5FXQA 3F6XA 3VIDA 1OVEA 1YDTE 2ERZE 4K33A 3VUKA 1WBNA 2VTJA 3D5WA 4NWMA 2JBOA 3WILA 4G16A 3E8DA 1QCFA 2VGPA 4MYGA 4BR3A 3W0RA 3MFSA 3R2BA 2YEXA 3RWPA 4EI4A 4QOXA 2V5QA 3NNUA 2UZVA 3DKFA 3C51A 4NFMA 2VN9A 4TYJA 3R7IA 3F5XA 1QPDA 4PRJA 2Q83A 1UWHA 2PE2A 3MESA 2GHLA 1FMKA 2X2MA 5KKRB 4FV3A 3E7VA 4B8LA 3QKKA 1SVHA 4RX8A 2WOTA 1HOWA 2A0CX 2VTOA 3PPZA 5FP6A 1U5RA 3MH1A 3SD0A 5IKWA 2X8DA 1TFFA 1ZLTA 4O21A 4YPDA 3BGPA 4FK3A 4HVSA 3F5UA 3PXZA 2HXQA 4FTOA 4AT4A 1P2AA 2FO0A 5A9UA 3AT4A 5CEQA 2GHMA 2I0EA 2XBJA 4O7WA 4D5HA 2J9MA 3KVWA 5HLPA 3FC1X 4WT6A 3R1SA 1OUYA 3QRUA 3UIUA 4E5BA 2YLEA 3HV7A 3V5LA 4U40A 3QRKA 5I5ZA 3UDTA 4BJJA 1F0QA 3RNYA 3OXTA 4G6NA 1T46A 3H10A 2WIPA 4HJOA 4IM2A 2ZDTA 3BHUA 4JG8A 4GW8A 4O6EA 4NH1A 2EU9A 2WMXA 3VRZA 3ZEPA 4GS6A 4CNHA 2OJIA 4BRXA 3KK9A 4FV8A 1Y6AA 4E3CA 2VTLA 4MF0A 2GQSA 3ZSGA 5EOBA 1P4OA 4RC2A 2C3KA 1A9UA 1BMKA 2BHEA 2I40A 2PTKA 3R0TA 4IXPA 4KKEA 4P4CA 4R3RA 3G9LX 2X9FA 5GIOE 2J5EA 3II5A 2SRCA 1SVGA 4IACA 3A7FA 3ORKA 4XOYA 2OF4A 4LI5A 4RRVA 1V0PA 3C4CA 4FEVA 2BAKA 2RL5A 3B8RA 3IDPA 1URWA 4MBIA 3PJ2A 4KA3A 4O27B 4XG8A 4C35A 4DN5A 2A27A 3LZBA 3QQHA 5EDRA 3EFWA 3EQDA 4YPSA 5FTOA 3D94A 3C0HA 3POOA 4X2NA 4L44A 2PVKA 3CEKA 4CV8A 1GIJA 4C36A 2FSMX 5E90A 2NYAA 3QU0A 4R1VA 2XJ1A 1Q8UA 3FY2A 2EXCX 4TWPA 2OXYA 1IAHA 4O96A 1LEWA 3OEFX 2BZHB 4L3PA 4UYNA 2JKQA 4EYJA 5CANA 1WBSA 1MUOA 3WF7A 5FDXA 4BHZA 1IR3A 4AW2A 4AGUA 4ZTMA 5BX0A 2J0KA 4O6LA 3UJGA 1E9HA 5DT3A 3L9LA 5L2IA 3O5AA 5EH0A 4WNOA 1OKWA 1REKA 4E5AX 3LFEA 3AQVA 4JL9A 4LV5A 4M13A 5J9YA 1Y8YA 2VX3A 3PTGA 5K0XA 1LUFA 2R3NA 4L7SA 1H01A 4ITJA 4L00A 5E9EA 1CM8A 5AADA 4A06A 1SNUA 4JDJA 2PU8A 2ETMA 2QO7A 4F0IA 3EN9A 1IA9A 3QQUA 1O9UA 2BZJA 5E4HA 2PMLX 3PDTA 5LJJA 2ITQA 5AWMA 2YM5A 2BTSA 3UPZA 2BMCA 1AGWA 2HY0A 3K3JA 5C8MA 4MQ1A 4AAYA 3COMA 5AR5A 2RGPA 4GUEA 3F66A 4R8QA 2X0OA 3LCOA 5EYDA 5M56A 5J87A 4LRJA 3GNIB 4G31A 4BDIA 4F0GA 2OIDA 5C1QB 3EKNA 3FHRA 3R01A 4AX8A 5JK3A 3ROCA 3EN7A 4TWCA 3KA0A 3SHEA 3TNPC 5HESA 3NIEA 5E91A 3DB6A 3AT2A 4RA4A 4R6VA 5GNKA 4HVDA 2W17A 4X3FA 1OBDA 4KB8A 1OIUA 1ZYJA 4BCJA 1OL2A 1WBTA 4EK6A 4E6CA 3LCSA 4M67A 3KULA 4TZRA 4YZDA 3R8UA 4XG2A 3V8SA 4IEBA 5A46A 4G6LA 4V0GB 4YTIA 1IA8A 4PL5A 1UNHA 3EB0A 4O0YA 3TL8A 4YTCA 4QTDA 5B2MA 5CEPA 2F49A 3W8QA 5CSHA 5M57A 3LLAA 3NS9A 4HCVA 4K8AA 4I41A 4AT5A 4CZYB 4GV1A 2QHMA 3MPAA 4MXZA 3FKNA 4YBJA 4CKRA 2JEDA 3H0ZA 4RZWA 5FEQA 3FHIA 5AIRA 1ZYLA 3SW4A 3VVHA 5LOHA 3MY0A 3O23A 4UB7A 4RGJA 1PHKA 2B0QA 3D9VA 1TZDA 5HIBA 5ANGA 4O82A 4Y5QA 3EOCA 3TEIA 1OI9A 5AM7A 4YNOA 3BX5A 1Q8ZA 3ZH8A 4PMMA 4A9TA 4N6ZA 2PVYA 4XV3A 3R8VA 4PTEA 2R3KA 5KMMA 2EB3A 4A9YA 2A98A 3IW6A 5I9VA 4HZSA 2ZM3A 2ZVAA 3CD8A 4QO9A 4UXQA 3NVMB 3ZS5A 1NVSA 2QOHA 1Y91A 2WOUA 4E7WA 4F1TA 3ALNA 5CXZA 3R9NA 1MRYA 3ZLYA 3NUUA 5FEDA 3ERKA 5BMSA 5EM5A 1YOJA 4MAOA 3G0FA 3OEZA 2GS7A 1OPKA 3H30A 2JC6A 2R3MA 3FBVA 4XS2A 4AFJA 3EFKA 5KMOA 4A4LA 5FM2A 2QO2A 3F3ZA 4UMQA 3LM5A 4HVGA 2WO6A 4TWNA 1XJDA 3UQCA 4OLIA 3UIXA 1YWRA 2FA2A 2XNGA 2CKOA 2VNYA 2QR7A 4JBOA 2JKOA 3OMVA 4G3FA 4KIKA 3OOGA 4LRKA 5K3YA 4CQGA 4BCFA 3O8TA 1MQBA 4WHZA 3W16A 4YLLA 4IJ9A 5L6WL 2HK5A 4RVLA 4G3EA 2RSVA 3PYYA 4E20A 3BPRA 5E8UA 5M09A 4AWIA 2Y8OA 4AZFA 5DLSA 4NM7A 5I9WA 5JZNA 2YITA 4PDOA 5LMBA 4G3DA 4BGHA 3RPSA 4GJ3A 2Y0AA 1BI8A 4PL3A 2WD1A 4F6WA 3DAKA 5M4CA 2VO7A 4GIIA 1YDRE 5CY3A 3VUGA 2R3PA 2IEWA 2ZV7A 2GDOA 3DLSA 5IG1A 3LFAA 3RZFA 3S2PA 5EKNA 2W1ZA 5DR6A 2WAJA 3VUIA 4R5SA 3R9RA 3U6HA 3I79A 1H1SA 4GJ2A 5EM6A 4CTCA 4KKHA 4C4JA 4L9IA 5H2UA 5H3QA 5C4KA 2QU5A 3SW7A 4E1ZA 3LFDA 1M2PA 2BZKB 1XHAA 2W1HA 2R3OA 3Q4ZA 3R02A 1Q4LA 3B2WA 3OXIA 4NYEA 4KRDA 4RVTA 4N57A 2OICA 3NW6A 3EFJA 3QCQA 3NUPA 4ZZOA 5B2LA 5EM7A 3U8WA 3V5WA 2BAJA 4LM5A 5M51A 4BGQA 2GTNA 1BYGA 3GC0A 4QMLA 2HOGA 5DBXA 2X0GA 4QRCA 4AZVA 4KSPA 3F2RA 3N4VA 3F9NA 4EOLA 4YJPA 4LG4A 4YJNA 3D2IA 5DH3A 4ANBA 4R77A 1XBBA 2B7AA 4V01A 3BQRA 2GSFA 3NYXA 3A8WA 4QMWA 3CY2A 3LMIA 2WMAA 3GUBA 2RF9A 3Q9YA 4FSUA 4FTNA 4FT3A 3K2LA 2QCSA 4LL5A 2GNHA 4YZMA 5DN3A 5FXSA 2C6TA 3QA8A 4IE9A 3NAYA 5EYMA 4Y73A 4WUAA 5C03A 4YURA 5K5XA 3QYWA 5ANDA 5DR9A 4IM0A 2UW3A 5ETAA 3TUBA 4RWLA 2BTRA 2GMXA 2C0TA 2P55A 4RFYA 4YUQA 1R78A 3R71A 5FTGA 2DQ7X 1Q62A 5LVNA 3FQSA 2P0CA 4JJRA 3AC4A 3AMYA 5EK7A 3NW7A 2W5BA 3EQCA 4L67A 4MXYA 4I5MA 2OW3A 3BE9A 2J90A 1U54B 2XKCA 2UZEA 5BUIA 5DGZA 4Q5EA 4FKRA 4AGCA 2OJJA 5FBOA 4EOJA 3R30A 2ONLA 4O7NA 3HZTA 5CAVA 4RQKA 2NRYA 4QP3A 5IA1A 2HWOA 5EYCA 1OL5A 4D9TA 4R3CA 3Q9WA 2VTTA 3Q3BA 4C2VA 3FI2A 4ZOGA 4QP4A 3VUDA 5HG7A 4WG4A 1ZMVA 1YXUA 2C6KA 1SNXA 4FV5A 4L52A 3HAMA 5J79A 3MTLA 2R0IA 3E64A 4JIKA 3ETAA 3GXLA 3CD3A 1PXLA 4F7LA 1CTPE 2O2UA 3QGYA 4TW9A 5AP0A 3CKXA 4L8MA 4EL9A 5CF5A 3HV3A 4Z3VA 5IH4A 1W83A 4G17A 4FTAA 4U79A 2C6MA 5BVEA 3MPTA 2HZ4A 5HHWA 3ULIA 5GZAA 4Y46A 4K18A 2AC5A 4FKQA 3JVSA 4F7SA 3C1XA 2B53A 3KREA 4FTMA 3ORNA 4FK6A 4BDKA 2YAKA 3NR9A 4JR3A 3NNWA 3QAME 4YSJA 4AA4A 3CCNA 2VAGA 4Z7HA 3G6GA 4GFGA 2ZAZA 4QQJA 3ROYA 3W1FA 4GUBA 4MXOA 4RIYA 3CS9A 1BI7A 3Q2MA 4XV9A 4E4MA 3PPKA 3QYZA 4I4EA 3QTWA 3TKUA 2VD5A 3ATSA 5AP5A 2UZNA 4DH5A 4F4PA 2EVAA 3ZCLA 3U6JA 2QNJA 4D4VA 3MA6A 3GI3A 4P7EA 3VS7A 3BL7A 3ZZWA 3VJNA 1OIQA 4BYIA 4FKUA 4ZIMA 1PXOA 4RC3A 4FEXA 4NFNA 3DZOA 3NFGB 2C1BA 2C69A 3TYKA 4OTQA 2A2AA 5CNOA 4EOQA 4Z16A 3ZUUA 5L2SA 4I0TA 1ZAOA 5AAGA 3RJCA 4D2PA 1TQMA 2YM4A 4AQCA 4AZSA 3IGGA 5IMXA 3HVCA 2XANA 2CLQA 3UOJA 1OUKA 4FIGA 2W1DA 2QOBA 4XP2A 3LXNA 4IB1A 3R7VA 2EB2A 4F1OA 3BYSA 3F3WA 1TVOA 3QZHA 3QA0A 4EQUA 4PMTA 5IA0A 5AUXA 1J7IA 2CHLA 4PTGA 3A7IA 5FBNC 4BZDA 3ZOSA 5M44A 3E63A 4TTHB 3FV8A 3VF8A 4ANMA 4XLVA 2P2IA 3G0EA 4C3PA 3A4OX 2XIKA 3BYVA 2Y9QA 3FZRA 2Q0NA 4FC0A 4MD8E 4RJ5A 3W2QA 3W8LA 1CMKE 3PP1A 4FTJA 4TYEA 2R3GA 5KBQA 4BICA 4M68A 4UYAA 4QP8A 4ZTLA 4PDSA 5HTBA 4C61A 4O4EA 2RG5A 3VF9A 3ZFXA 2WKMA 4J96A 1REJA 3QGWA 4OT6A 4NKSA 2PUNA 3BLAA 1OKYA 4UV0A 3IK3A 5LWMA 5EFQA 2VZ6A 4JAJA 2V22A 4KIQA 3ENMA 4CG8A 2W1GA 2W06A 2ZV9A 5LMKA 4ERWA 2QLUA 3UO6A 3UVQA 1PXMA 4GIHA 2X7OA 5AAFA 3ZBXA 5ETCA 2ITVA 4UMPA 5IA3A 5IQHA 2C6IA 1K9AA 2EXMA 2NPQA 3QTIA 3L1SA 1LP4A 4G3CA 5TE0A 4MXXA 4CD0A 3LPBA 3UOHA 1H1PA 3BU5A 5EKOA 3RK9A 4BZNA 3D83A 4AGWA 4F63A 3QHWA 3W0SA 1KE7A 2PPQA 3DAEA 2JD5A 3VS4A 3B2TA 3N9XA 4FTUA 3W0PA 3IW7A 3RHXA 3UZRA 4J97A 2PK9A 3EYHA 2GCDA 3DT1A 4QPAA 5CAPA 5EI6A 4YC8A 1ERKA 4UWCA 4H36A 4MNEA 1BKXA 3GB2A 2WU7A 4JDHA 2OH0E 4AN2A 4FKGA 5L8LA 3EHAA 3EQIA 4KINA 2VWXA 4CZUA 4WBBB 3PVWA 3Q52A 4DH8A 5AUUA 1Q8YA 4FV7A 2B1PA 2UW0A 1KE5A 2WTKB 2V0DA 2CCIA 5KO1A 2E9OA 2XEYA 4I5CA 4FT9A 3BHVA 3EQFA 2J0LA 4BBEA 2GNGA 2OGVA 4HPUE 1B38A 4KIOA 5E8ZA 4C3RA 1OM1A 4MEDA 3GQIA 5DR2A 4O4BB 4QP7A 4QMTA 2CMWA 4JDKA 3K3IA 2QC6A 4AG8A 3DTCA 5CEIA 3HRFA 3I0OA 5HLNA 3QF9A 2VWIA 3CBLA 4F0FA 2H34A 3ITZA 5KUPA 4NIFA 4YTFA 4CT1A 2YFXA 4RSSA 5G6VA 4AT3A 3DAJA 4O7RA 4BVUA 2BKZA 5JGAA 5CASA 2YZLA 3PJ8A 4HOKA 5TR6A 1P4FA 3CGFA 2BRMA 2FYSA 4OTHA 4JX7A 3PFYA 1UKHA 5ANOA 5AP1A 3ZSHA 2GNLA 4CXAA 2XNNA 3VS0A 3FL5A 5K0KA 3EQHA 3GCPA 4YJTA 4IB3A 1A48A 3P7CA 4FVRA 5GJGA 2XNMA 4H1MA 4P5ZA 2UVZA 3IPHA 4JBVA 4TY1A 4OTDA 1S9IA 3H9FA 4OTWA 4BI2A 3PIXA 1LEZA 4U3ZA 1QL6A 3RAWA 3SV0A 3TM0A 3NNVA 3R8LA 4AAAA 3ALOA 4TYGA 4BWPA 4Z7GA 2C0IA 3EN4A 4I93A 4O1PA 3HDNA 4I6BA 5AV2A 3R7EA 5IMEA 3QZIA 4V0GA 3LHJA 4CCUA 4PP7A 2I0HA 3PRIA 4DEDA 3I4BA 1DM2A 3L9MA 4IVBA 5CSVA 4FV6A 2HZ0A 3PY1A 2X4FA 3F2AA 3MYGA 4YZ9A 3TTIA 2DWBA 5D10A 3FQEA 2IW8A 2KTYA 1F3MC 2X8EA 5H8GA 3SC1A 3TJCA 1WBPA 3MY5A 4XG3A 3WF6A 3QKMA 4QMPA 2BRNA 3E92A 3QCXA 3UO5A 3F2NA 2YLFA 3R83A 4DHZA 1K3AA 3W2CA 4XG7A 5J9ZA 4B9DA 4CMOA 3RZBA 5HNIX 5BNJA 5FP5A 4B8MA 4OBPA 3WZJA 4NK9A 4DA5A 3U51A 2AC3A 4MH7A 4TXCA 4JR7A 4FKPA 5AM6A 2YACA 4U0IA 3PLAE 3R21A 3ORXA 2OKRA 3Q5ZA 3ZC5A 1AD5A 3L9PA 2X8IA 3GCSA 3R7UA 4CZTA 4QMSA 4OR5A 4TYHB 2QODA 2IVUA 3UG2A 3UZPA 4BWKA 5HCYA 3KKVA 4JX3A 1ZZ2A 2CLXA 5CF6A 4JQEA 4TNDA 2OIQA 4HW7A 3R73A 1PW2A 4JAIA 4NT4A 3TACA 3R8ZA 1Q24A 2IJMA 4L3LA 4Q2AA 5HVJA 3AXWA 4YNEA 1O6YA 2ZYBA 4EJNA 4DG2E 4LOQA 2XZSA 3QZGA 3AD4A 4WSYA 3NCGA 5IEXA 3KC3A 3SG9A 3UQGA 5FLFA 2XNPA 4C4GA 2JBPA 3DQXA 2UVYA 3VS2A 2XRWA 3BBWA 3DLZA 4H1JA 5GJFA 2NNWB 3FMNA 3R22A 5HVYA 3F82A 3ZFMA 5DOSA 3TZ8A 3IKAA 5EOLA 4OTRA 4TRLA 1JBPE 2IF8A 4FV0A 5FG8A 4MF1A 3W33A 4YJRA 5HKMA 4UMRA 3R1YA 2VX1A 4R7BA 4YC6A 3FXZA 3S3IA 3GCVA 3W55A 5IUIA 5ICPA 3KU2A 4A9UA 3GFEA 3K5UA 4CGAA 3DBQA 4I5HA 4MD7E 3RTPA 2ETRA 2GS2A 4EOSA 2F57A 5BVOA 3L8VA 3QCYA 3HKOA 3KN5A 3UOKA 3MV5A 4PX6A 5K4IA 4E4NA 4DEIA 4M7IA 2WZJA 1YI4A 3NPCA 4ANSA 3IW4A 3UIMA 2ZB1A 5CYIA 2VTQA 4LUEA 4DFXE 1OGYA 2J6MA 4NM5A 4D58A 3MS9A 3TNHA 3TT0A 3CKWA 5IH6A 4UX9A 1XH4A 4TN6A 4ZTRA 5M08A 4YSMA 3C4ZA 1H1WA 3DB8A 2FSOX 3BLHA