2JKMA

Focal adhesion kinase catalytic domain in complex with bis-anilino pyrimidine inhibitor
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
274
structure length
260
Chain Sequence
RDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FOCAL ADHESION KINASE 1
publication title Crystal Structures of the Fak Kinase in Complex with Tae226 and Related Bis-Anilino Pyrimidine Inhibitors Reveal a Helical Dfg Conformation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 82
structure length 260
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2jkmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2jkmA01
2CDZA 4G3FA 4XBUA 2WGJA 3COKA 4BI0A 4OLIA 3PIYA 4ZOGA 4XV3A 5CU4A 4WOVA 4FTIA 4Y8DA 3BWJA 4C0TA 3DAKA 4DGLC 2WD1A 3C0HA 4GJ2A 4AX8A 2F7ZE 1MP8A 3ELJA 3MY1A 3N4TA 2R3MA 5AFVA 1BI8A 3HRFA 2CLXA 5HIDA 4TNBA 2BZJA 2VX3A 1GIHA 3FEGA 4AT3A 1KUTA 4RA4A 1LUFA 4CRSA 2XK8A 5BVEA 4C57A 5BUIA 2W06A 5CF5A 1IA8A 3N4UA 2GNIA 3DK7A 1XH6A 2VNWA 4FEUA 4M15A 1WBWA 3POOA 2O8YA 3FZRA 2VX1A 3GFWA 4NKSA 5EG3A 3UYTA 4C35A 4DFUA 2CGWA 4EZ7A 2GCDA 5JFWA 4BKYA 5M06A 4B9DA 4F08A 3MB7A 3F5PA 3W2RA 2FYSA 5HE2A 2WTVA 3CTQA 4ZIMA 4L6QA 5FGKA 4XNEA 2P33A 4B0GA 2YERA 4B7TA 2VNYA 4D1SA 3P79A 4YNEA 4HGLA 2PUUA 4PMMA 5CT7A 5HI2A 5KKRC 2I0HA 3CQUA 5FM2A 3KMWA 5CVFA 5HQ0A 3QCQA 3CTJA 4K11A 1H07A 4U5JA 3LLAA 3DGKA 3D94A 4ZY6A 2FB8A 2FSTX 2PHKA 2XS0A 4IZYA 4QMZA 3GXLA 4UWYA 5CSXA 5HIBA 5HLPA 3E88A 3P7CA 4F0GA 2ZDUA 3Q2MA 4MXAA 3OF0A 3ENMA 2ONLA 3KVWA 3H30A 3TZ9A 3S95A 3S1HA 3O2MA 4S30A 4V01A 3ORLA 2OSCA 5FM3A 3VN9A 4IZ5A 1OIRA 4C59A 1Q41A 2JFLA 4NK9A 4ZY4A 2C3JA 3NDMA 3BQRA 4IMYA 4AN3A 2F57A 2E9UA 3NNUA 1KE8A 4JL9A 2QR7A 3PIZA 4GMYA 2QOHA 2WMSA 4L46A 4QMSA 4E26A 1JAMA 3LMHA 3ZDIA 5EHYA 4EWQA 4QP9A 3UE4A 3WZKA 3RBWA 2X81A 3EB0A 1YWNA 2XNMA 3T3VA 5FDXA 1GZKA 2E2BA 2YM4A 3TV4A 4UMPA 2WHBA 2HAKA 3HMIA 4EK3A 3FHRA 1P14A 3QYZA 4QQTA 3UODA 4F7JA 4M67A 3SW4A 4AZFA 3UO5A 4UXLA 1OBDA 5C03A 2ERZE 3RGFA 5HORA 5AUXA 2WMAA 4BDAA 4WHZA 3B8RA 4NIFB 3QGYA 5KMLA 4HCUA 4J8MA 4IDTA 2OXYA 3OY3A 2IPXA 4FICA 1M2QA 4HYUA 5IKWA 3PPJA 4F7NA 5C27A 4CKRA 4A4OA 5JMSA 4CKIA 2YCRA 4P5ZA 5EYKA 5GINE 4U7ZA 4FEXA 4H58A 3W2SA 3FMLA 3U51A 5KX8A 1GY3A 3Q32A 2WMUA 1URWA 3I5NA 4JVGA 3O71A 4O0VA 4Q9SA 3FZSA 2GNJA 3M42A 2J7TA 1MRYA 4Q2AA 3OTUA 2C5XA 4MCVA 2RSVA 3ATTA 2H34A 4HCTA 3O8UA 4USDA 5ACKA 3GCPA 4X7QA 3V5LA 5IDPA 3SV0A 3MH3A 2Y0AA 4F64A 3TKIA 2BIKB 5DT0A 1U5RA 4ACCA 4FT7A 5IQBA 5DGZA 1UWHA 5D9HA 3QQJA 4GKHA 4ITIA 2PVJA 4V04A 4XOZA 1UV5A 3EQRA 4A4LA 2OJFE 4HOKA 4DYMA 4PDPA 1V0BA 3CD3A 4FSUA 3E7OA 1FBNA 4XX9A 4BCPA 4KKGA 3VBVA 2QONA 3ZZWA 3HDNA 3SD0A 4F6UA 4Y5HA 4UN0C 1YXVA 2J0KA 3FLQA 4ALWA 3RPRA 3BYVA 2R3LA 4IDVA 3GFEA 4MYGA 4L3PA 4CFVA 5B2MA 2VWIA 5M56A 3HV3A 3IDCA 2JKQA 3L8SA 4IJ9A 2OO8X 3QTIA 5DG5A 4DFZE 2ZAZA 3ZLWA 2GHLA 3F69A 3BLRA 4BI1A 3KQ7A 3VS0A 4JLCA 2QC6A 5K9IA 1W7HA 3F3WA 3TDVA 5CI6A 3DBCA 4XBRA 4YJTA 4W9WA 4YHTA 4FG8A 1IASA 1YQJA 2JD5A 3ZM9A 3R22A 4DTKA 1UNGA 3TV6A 4QT1A 4FTTA 5I9YA 2UW4A 4ITJA 4RA5A 2YM3A 2HW6A 2QI8A 3DU8A 3PA4A 4W4VA 4C38A 1WVYA 2WQBA 3QQGA 5E9EA 3AT3A 3LAUA 2X4FA 3Q60A 4XOYA 3WILA 5CWZA 3AMYA 4EHVA 4O0RA 5ETAA 2OF2A 5A4TA 3QTSA 4H1MA 3BU6A 4DG3E 2PYWA 3BEGA 2W17A 3O8TA 4E4MA 3SOAA 3L8VA 4DEGA 2Z02A 3PUPA 2NPQA 3HECA 5CENA 3D4QA 4FKUA 2GPHA 4EUUA 3EFJA 1J3HA 3NUNA 3T8OA 1KSWA 4DEDA 3MDYA 2XA4A 3EL7A 3EQBA 3MPMA 4J53A 5AAEA 2GSFA 1ZOHA 1XHAA 2BCJA 2Z7SA 3AD4A 4MD9E 4RFYA 4DH3A 4EHGA 5AAGA 3QA0A 2WOTA 2R3HA 4I6FA 4ITHA 3E5AA 4MWIA 4MBIA 5EYMA 4LUDA 4C34A 4E3CA 2QHMA 5ANJA 4ACDA 2JDRA 5BMMA 3B2TA 1J7UA 4XRLA 2YJSA 3MIAA 2E9OA 4FIIA 3NUPA 4EOSA 2XB7A 3N51A 2VTRA 3DNEA 2WQNA 2R2PA 2FSOX 2G01A 2REIA 3V01A 4KB8A 4ZTRA 4O0WA 3WZUA 4EZ3A 5I9ZA 4LV5A 1PXOA 1G3NA 4E7WA 3OCTA 3RAKA 2GQGA 4U44A 2R3KA 3KN6A 4NW6A 5HCXA 4DLJA 4EH5A 4FNWA 1JQHA 3ALNA 3PE2A 5JRQA 4ID7A 1E1VA 1K2PA 5EOBA 5IQDA 1OKVA 4DE4A 3PVBA 3WARA 2OIDA 4R3RA 3GCVA 2WQOA 4V0GA 2RL5A 4DTBA 1PKGA 4CTBA 4O7WA 1XBCA 4M0YA 4FKOA 3CGOA 3DBDA 3C4ZA 3ZONA 3QBNA 5AP3A 3TL8A 4D1ZA 3NW7A 2B55A 5CLPA 4RBLA 3KMMA 4F99A 4GIHA 5HTBA 3QQUA 1UU8A 3QZGA 5DT3A 4EQUA 4JX7A 2R7IA 3TKHA 3U6IA 2H96A 4O86A 1PHKA 3EIDA 4C4JA 4F9AA 3GCQA 5TT7A 3RPOA 3FMHA 1JKSA 4JQEA 3FI4A 1B39A 2FSLX 3TT0A 4GT5A 1YXXA 4ASDA 1Y6BA 2XJ1A 4OTFA 4MTAA 2PUNA 2CKOA 5CSPA 4I6HA 3BELA 4L67A 3MBLA 4TYGA 4U97A 2I0EA 4I22A 4JR7A 2R3IA 4QO9A 2O2UA 2VTNA 4M84A 1JLUE 2CN5A 3A4OX 4RT7A 5I3OA 3SAYA 2UW5A 1PXLA 4NCTC 5LVLA 3LFBA 4IJPA 1PRYA 2PMOX 4IZAA 3UP7A 5EM5A 4O6EA 1P4FA 5ANGA 5HZNA 3N4VA 3LCSA 3ORMA 3F3UA 2ITZA 4E1ZA 3A2CA 3ZBXA 3ZFYA 1R78A 3TZ7A 3V6SA 2P2HA 4RFMA 2UV2A 1E1XA 4TT7A 2X7FA 3BQCA 4D2SA 5DN3A 1LEWA 4CFWA 1OL5A 4YTCA 2QOFA 3BHTA 4MBLA 4EOKA 5JZNA 3OBGA 5AMNA 3RINA 3T9TA 3SW7A 5IH4A 3FLZA 3ZCLA 2XK6A 5FBNC 3ORPA 3RK5A 2XK9A 4YO4A 3OW4A 4FV7A 4EOPA 3LXKA 4NJDA 4G3CA 3V5PA 1PXPA 4USFA 3RVGA 5TKDA 5BNJA 3BPRA 4QYEA 4EWHA 1UA2A 4DH7A 2QOQA 3EQGA 2WAJA 2XCHA 4HNFA 2PULA 3RK9A 1XO2B 2UZDA 1FQ1B 4WUNA 1Z57A 1XQZA 2OH4A 3PG3A 4WNOA 3ZC6A 3F5UA 1GIJA 5CVGA 4L42A 4OTQA 3ODYX 3PRIA 4II5A 5CU3A 3VO3A 4QOXA 3TZMA 2RFSA 3B8QA 2VWWA 2C4GA 2C6KA 5E8VA 4DFYA 4LUEA 4L01A 4TRLA 3IKAA 4LRMA 4Y72A 2ETMA 2F2UA 3QCYA 4B99A 4IZ7A 5C01A 5L2IA 4CNHA 2OFUA 3EQIA 3NZ0A 4AZWA 3EWHA 5CU6A 2OXDA 3FMNA 3G0FA 3QF9A 4V0GB 4TWNA 1GZNA 4LM5A 3R8PA 4KS8A 4Y83A 4DEAA 3I0QA 1NY3A 3BGZA 3QWJA 2OW3A 4QD6A 5E1SA 1H4LA 3EQPA 3BLQA 3LXLA 4IFCA 4ANOA 1PXIA 2AUHA 2FH9A 2CJMA 3ZLSA 3FXXA 3DXQA 3OTVA 5IF1A 3R02A 3TZ8A 3GBZA 3TIYA 4P90A 3BGQA 2Q0BA 5L3AA 2UZNA 4K8AA 5J9LA 4HYHA 3OWKA 4ASZA 2SRCA 4BCQA 3L9NA 3R28A 4D5KA 3VULA 3VUGA 2DS1A 2WQMA 3W16A 3F5XA 2Z7LA 3QKMA 3DLSA 3V6RA 4U8ZA 5ANKA 2JBOA 4DINA 2PSQA 3BYOA 4YHFA 4YSMA 1XH5A 2ZM3A 4FKLA 3WBLA 4RIOA 5I9WA 1YRPA 3AOXA 3SG8A 4BL1A 5ANEA 3IW7A 3MY5A 4X6RA 4QTBA 1WVWA 3WE8A 5AUTA 1Q3WA 1R39A 3PTGA 4GK2A 1VYWA 2YCQA 3L9PA 3QTZA 4X3FA 4ZSJA 3TNQB 2H8HA 5IQIA 3EOCA 4PP7A 1H24A 3HYHA 1CDKA 3F82A 5LVOA 3RNYA 2Y4PA 5AX3A 4OUCA 2BRNA 4IFGA 4UBAA 3K2LA 3IONA 5DR2A 4E5WA 4UMRA 5EQEA 5M08A 2B7AA 3FPQA 4L53A 3Q6UA 3UJGA 5DHJA 4FZFB 2JBPA 4U40A 5CEIA 4XS2A 1KE9A 3R1SA 4APCA 1FVRA 2VU3A 5IDNA 4RVLA 2PY3A 4BCFA 4QTDA 5CAOA 2CKPA 3KXMA 1HCLA 1BL7A 3QTWA 5L8JA 5AUYA 2JAMA 4ZTSA 4I92A 3UC4A 3VBYA 3BKBA 3FZOA 4IB3A 3DK3A 2F9GA 2UZVA 3VS1A 3GU8A 1M2RA 4M14A 3RHXA 2HY0A 2WMRA 2VTJA 4RFZA 2C5YA 4AOTA 4MXOA 2OFVA 4BWKA 4YJPA 1REKA 4S31A 4U79A 2YIXA 3OOMA 3QTQA 2GDOA 3VS7A 2C68A 4FNYA 3CQWA 3HV5A 4HVGA 3PJCA 2VWBA 2C6IA 5AV4A 3KCKA 3JVRA 5H8GA 3DPKA 3UG1A 4UWCA 2Z7RA 1J7IA 3VS5A 4YLKA 4D2WA 3GENA 4D2VA 3OY1A 4N0SA 5AP7A 3E8DA 4KIOA 3TNIA 2CGVA 4N6YA 4RJ6A 3PJ1A 3NCGA 4O22A 4XLIA 4FTUA 4EH2A 3ORKA 3JY9A 5FG8A 2V62A 3NUYA 4BYIA 2HYYA 3K3JA 2W1HA 5G6VA 2V5QA 3QX2A 5HG9A 4D4RA 4KIQA 5IEXA 3BRBA 4J52A 4PPBA 4RG0A 4CT1A 1ZRZA 2WTKB 2PVNA 3IG7A 4KA3A 4X6QC 4JAJA 4E6CA 1OIUA 3UQGA 4QP4A 5E8XA 3W32A 4TZRA 2W9ZB 2YITA 1QMZA 3CEKA 4EQCA 4JDIA 5ICPA 3D5UA 4FV2A 5ETCA 1AD5A 5CU0A 3C7QA 1R0EA 1KOAA 1IA9A 1UVRA 3FAAA 4TY1A 5E7RA 5D7VA 3OHTA 3TJCA 4KBKA 4AT4A 5M07A 4DH8A 3F7WA 3AC3A 5DEYA 1PXJA 2QOOA 5LMBA 5E8YA 2C6EA 4QTAA 3R21A 3OW3A 4GH2A 3PXRA 4X3FB 3Q9YA 1JSVA 2BAQA 4UB7A 4CXAA 5L2SA 3VUTA 4FVQA 5J87A 4HGSA 3CPBA 4LYNA 5J7HA 3FLYA 2PZYA 5IA5A 1H1WA 4IANA 3RPYA 5A4CA 5B7VA 3LCTA 4N4SA 4D4SA 4FSZA 4EH8A 3D14A 3IGGA 3TUBA 3UDBA 3KXXA 2CCIA 3P23A 2VN9A 1Q8TA 1OPLA 5E92A 3G6HA 3OEZA 4ARKA 1STCE 5EKNA 2VZ6A 4NM3A 3CY3A 3CE3A 2C0TA 3NVKI 4M12A 4Z7GA 4HJOA 5J1WA 2UW7A 2YM5A 4OTGA 5L8KA 4NT4A 3QZIA 1JKTA 4N6ZA 4ONAA 4OAUC 1Q24A 4YNOA 2XBJA 1LR4A 3O23A 3OXIA 2JKKA 3HV4A 1PMEA 3RAWA 1DS5A 1W98A 4F1OA 4Z55A 4P5QA 2Y4IB 2X2KA 1BI7A 2YIYA 3JVSA 2W1EA 3QD2B 1W84A 4DBXA 2VUWA 4KINA 4S33A 3AXWA 4FK3A 1ZMWA 3CJFA 4RIYA 4FL2A 3IDPA 1FOTA 3IW6A 3OT3A 4JBPA 3L1SA 1H08A 4JNWA 4I23A 4ZJJA 3VNTA 1VEBA 2JKMA 2VGOA 3W18A 3QUPA 4MD7E 2V7OA 3FI2A 1YXTA 3EN7A 4MK0A 4DFLA 4GVJA 4WUAA 5CZIA 5EW9A 3E87A 3E92A 5KUPA 2WELA 3G51A 3K5VA 3LJ1A 5HVKA 5K4IA 5H9BA 4C4HA 3KULA 4FGBA 5BVWA 3ENHA 4MKCA 5L2WA 2PMIA 4LG4A 4CFUA 4ZMFA 4FVPA 4LFIA 4IWOA 3V5TA 3FE3A 3ZLYA 4DGMA 4DH5A 4XP2A 4MWHA 2X9EA 4I0RA 3MW1A 4J7BA 2BAJA 5FD2A 2AYPA 2OI4X 4K0YA 1YDRE 3FQEA 2BKZA 3O8PA 3ZRLA 5T6KA 1Y6AA 3P78A 3V5WA 1PXNA 4D55A 3MTFA 3PLSA 4FK6A 4UMQA 3QHRA 1OKYA 4APPA 1YDTE 4R8QA 4AT5A 4I41A 4IBMA 4BDBA 3KREA 2WTCA 1YHVA 3KC3A 1KE6A 4TYJA 3DBEA 4XEYA 3L9LA 1QL6A 5H8BA 3UVQA 1VZOA 2OZOA 2RFNA 3O0GA 4GVAA 3CP9A 4XJ0A 2GHGA 5FXSA 3FSKA 3KK8A 4HGEA 1WBNA 4ENXA 4FT5A 4X2JA 5EHLA 1S9JA 1RE8A 4DEIA 5J9ZA 4RWJA 5E91A 3DY7A 2Q0NA 4EH3A 2YACA 4JJRA 5HBJA 2XM8A 4NEUA 3S2PA 4FVRA 5IA2A 1PMUA 3DTWA 2X6DA 3CCNA 3PPZA 3KF7A 4BICA 4I6BA 3WF5A 2WMTA 4EC9A 2NRYA 5KHWA 4O83A 5IQHA 5BYZA 4ZEGA 1U59A 4K18A 3LE6A 2YZLA 3DKOA 3SLSA 5A9UA 3Q4UA 1H1SA 2W4JA 3LJ0A 2OJJA 2HELA 3I7CA 4HPUE 5HU9A 2CNVA 4FTMA 4D0WA 2BZHB 3EZRA 3PWDA 3L8XA 3QGWA 4CTCA 5LCKA 3NSZA 4C4FA 3A7FA 5IQAA 4OBPA 2XKDA 1SMHA 4GUEA 1WMKA 3OT8A 2OGVA 1ZAOA 3ZO2A 4DT8A 4LGHA 4KKHA 4PX6A 5CXZA 4FNXA 5AUZA 4HCVA 4PV0A 3NIEA 4DG2E 3NPCA 5CNNA 2R3NA 4B8MA 3QUEA 1FGIA 4CG8A 3P4KA 4JOAA 2B52A 3OWPA 4U81A 4XLVA 3DB6A 3GC0A 3LFDA 2BHEA 4O2ZA 4AN9A 1YKRA 4PDOA 3ZUTA 4B8LA 5CALA 4AZSA 5KO1A 3GCUA 5CU2A 2IO6A 2J0MB 2HY81 4G5JA 2QD9A 2XBAA 3KRWA 4RIWB 4BDFA 3E8NA 2W5BA 4PWNA 5EH0A 5CEMA 3TN8A 2JDTA 3D7TA 4AXAA 5D11A 4JG6A 3KULB 4GYGA 4U41A 3D83A 4UYAA 2PZ5A 1YWVA 1PY5A 2WTJA 4GFMA 3EYGA 5FP5A 4KIKA 4QPMA 5JQ5A 4CZYB 3DNDA 4OW8A 3PLAE 5DYJA 1ZLTA 4RZVA 1M52A 2BHHA 2E9PA 4M0ZA 3D7ZA 4FYOA 5HIEA 3RHKA 4YBKA 3PG1A 4WRSA 4CVAA 4JBQA 2QOKA 4F6WA 3EMGA 3HNGA 3VW6A 3MESA 3QTUA 1V0OA 5H3QA 1DAYA 4FV5A 3ANRA 3NGAA 1SNUA 4PTEA 4XCUA 1Q97A 3LM0A 4L00A 5E8WA 4CSVA 1ZYCA 3PFQA 4C4GA 4FKTA 2QKRA 2YAAA 3FY0A 5ACBC 1QPDA 2BROA 2ONLC 2WU7A 5AA8A 4BZOA 4ACGA 4D28A 2PPQA 3WF7A 2XEYA 2C1AA 4KS7A 5I5ZA 4RJ4A 3DKCA 4IX3A 3RMFA 3AGMA 3KGAA 1PMVA 2UW8A 4QYFA 4XV2A 4YGAA 2CNUA 3LKMA 5CASA 2HZNA 3AC2A 3HAMA 5HVJA 4D9UA 1KOBA 3QD0A 1ND4A 3CR0A 3RK7A 1NA7A 2BZKB 4YJOA 4UX9A 3IECA 4LQMA 3V5JA 5K5NA 2X7OA 4ANSA 3CLYA 1H0VA 2ITTA 4DGGA 4DG0E 4CGAA 4DGOA 3ZTXA 1CSNA 4F70A 3IOPA 2FA2A 4XG2A 3DBFA 5BVOA 5AM6A 3W8LA 1Q62A 3MWUA 2C47A 5AUWA 5LARA 4AU8A 5M4UA 3G0EA 3EFWA 3UGCA 1RJBA 5HVYA 4AACA 3G15A 3C1XA 3IS5A 3PPKA 2Y9QA 3KXNA 4OBQA 5HD4A 4DA5A 3WZEA 2GNHA 3ZLXA 4B6LA 4ZSEA 2W1DA 3NMUF 2Y7JA 2YISA 5FUTA 5CANA 2QNJA 3LPBA 3OP5A 4YJNA 3DDPA 4O0XA 5DLSA 3H9RA 4YPSA 4RZWA 1ZOGA 4YJQA 2PE2A 2W4OA 4FSMA 4NM7A 1JPAA 4JAIA 5EQPA 3PXQA 1TQMA 4ZMEA 3GU5A 5J9YA 1URCA 4UMTA 3ZU7A 2BRMA 5EYDA 5CNOA 1ERKA 2JDOA 4RJ5A 4L45A 3SHEA 4PL3A 5T3QA 4CMOA 3JPVA 2R4BA 3MYGA 3FSFA 3ZEPA 3D7TB 1CMKE 4RX8A 4GFGA 5LCJA 4O82A 3QUDA 4FIJA 2I0VA 3GC9A 3BU3A 4FOCA 3RM7A 5I0BA 3FI8A 5FXQA 4PDSA 3UOLA 4KIKB 3EN6A 5B0XA 1P5EA 3MFSA 2YJRA 4CCUA 1PXKA 4M3QA 3IW5A 3WIKA 2J0IA 5EK7A 1NW1A 3E62A 4AUAA 3R9RA 3TV7A 1ZZLA 3F2RA 4TKSA 1OKWA 1Y57A 3NCZA 3QQFA 1BX6A 2XIXA 4D5HA 2ZMCA 5AP4A 5EDPA 5IA4A 1GAGA 4FKJA 2CSNA 2WMQA 1FMKA 3A7JA 4DHFA 4F1MA 4M97A 4FTCA 2X8IA 1U5QA 4AFJA 3UPXA 2QO7A 4O1OA 2A4LA 3PP1A 5KMKA 2VWXA 4Y73A 2XJ0A 3ZSHA 2BDFA 2EVAA 4NYEA 4GK4A 3LQ8A 5FTOA 3DKGA 4OTHA 4JG7A 2OU7A 3DTCA 5EI8A 3MVMA 4G31A 4ZSLA 5GZAA 4IACA 5AR7A 3KRLA 5GJDA 4O7SA 4C3FA 1M7NA 1WAKA 1F0QA 2XF0A 2R5TA 3HVCA 4IAYA 5EI6A 3W8QA 4DAWA 3C4FA 4F7SA 4ZLOA 5LMKA 4JIKA 3PXKA 2C0IA 3FMJA 5KMOA 4LV8A 3VBQA 3UNKA 4GT3A 4EYMA 5IPJA 2R3FA 3P9JA 2BPMA 4I5HA 4RWKA 5E8ZA 4DLIA 4BDEA 3SXSA 4EI4A 3MJ2A 2DQ7X 1Z9XA 2OIBA 2UZOA 4QP8A 4X2KA 2WO6A 3LLTA 3GU4A 1XKKA 3CJGA 3FDNA 2UUEA 4CFFA 4HVDA 4CT2A 4E4XA 1K3AA 4XG3A 2I7QA 2FO0A 4J8NA 4FKGA 4PPAA 2GS2A 3CD8A 4RLLA 4C33A 3IGOA 3KMUA 3QC9A 3NAXA 4FIGA 2IJMA 2Y6OA 2OXXA 4HW7A 3U9NA 4UXQA 3DV3A 2BTSA 5M4IA 1FGKA 5IQCA 3BBWA 3UTOA 3OCBA 3OROA 4HYSA 4QNYA 4L8MA 4AF3A 4BKJA 5BX0A 2ITOA 4TL0A 3VHKA 4IX4A 3LQ5A 1DM2A 3W2PA 2Z7QA 2CNQA 4G16A 3W10A 1JKKA 4UZHA 4ZZMA 4NFMA 2ITWA 2X2MA 5K5XA 3VW8A 1YOMA 4IW0A 2ETKA 2YDIA 3LFQA 4OGRA 3BGPA 3R7UA 5FDPA 1ZY4A 3ZZEA 3TUCA 2IZTA 3MIYA 4PQNA 4YC8A 4AW2A 1V1KA 4C4IA 4KWPA 4TW9A 4FTKA 4WKQA 2OICA 2QCSA 4LMNA 5K3YA 5AP0A 1DAWA 2A0CX 4EUTA 3LMGA 5HBEA 4ALUA 3VBXA 2XYUA 5KMNA 4AZTA 4ANBA 4FODA 2YIWA 3A7IA 2R9SA 3ZXZA 3FC2A 2ZJWA 4O6LA 3UMWA 1H26A 2ZV7A 3NAYA 4JIAA 3OEFX 3VAPA 3ZEWA 2X39A 3UZTA 3NWWA 4NM0A 3VWAA 4CZTA 4WD5A 4XG7A 4RPVA 1FINA 3I79A 4NL0A 3VC4A 3K54A 3NYXA 5C8MA 2W4KA 3MGYA 4EH9A 5D7AA 5ANOA 1JVPP 5LQFA 4PMSA 3FZ1A 4R78A 4YLLA 4FG7A 4MAOA 4BHZA 3P7AA 4EEVA 2BRHA 2O65A 2BKKA 3A99A 3I60A 4YJSA 2W9FB 3VRZA 4R7BA 3VS6A 4I6QA 4JX3A 3DB8A 3Q4TA 4MNFA 2ZV8A 1O6YA 3NUXA 3PYYA 4FZAB 4JDJA 2HWOA 5AUVA 2E9VA 4O1PA 4AW0A 4HVIA 1Q5KA 4ACHA 1W0XC 1PF8A 2HCKA 5D41A 3R8VA 4MXYA 3I6UA 5F20A 4E73A 3KL8A 4LOOA 4ERWA 3FXWA 4MBJA 3FLNC 5IUGA 3KB7A 4XP3A 3U54A 2W7XA 3OXTA 3VF9A 2QU6A 2ZOQA 3ACKA 4E20A 3AD6A 3G33A 2CN8A 1Y91A 1VYZA 1RW8A 4W4WA 4ACMA 1L8TA 4FT0A 4R6VA 4Y85A 3VRYA 5L8LA 4O7NA 3I5ZA 4ANLA 5IH5A 2J4ZA 4GRBA 3UNJA 2BFYA 1OPKA 1UKIA 4JBVA 3BYUA 5CY3A 3VUKA 4ZSAA 3JXWA 2IN6A 4RC4A 2J50A 4RX7A 5CAUA 4Q5EA 4DITA 3CS9A 3NYOA 1BLXA 3C5UA 5HE3A 4EH7A 4UYNA 2ITNA 3AGLA 4KKEA 3IQ7A 1FVVA 1YI4A 3GOKA 5EW3A 4A9RA 4ZP5A 1J1CA 3D9VA 1MQ4A 2LGCA 3MA6A 3GOPA 2CPKE 3HDMA 4OTDA 3F2NA 4LL5A 5L6WL 3TM0A 2DUVA 2UZWE 4FV8A 5JFVA 3P7BA 4JDHA 4EJNA 5HCZA 4OT5A 4C36A 4YJRA 2FVDA 3EN5A 3FQSA 3QALE 4R1VA 3UC3A 2UW9A 4CD0A 2WQEA 3IW4A 5AEPA 5KHXA 4ZTNA 1AQ1A 5HEZA 4O91A 4FKIA 5FLFA 4AG8A 1FVTA 1Q8UA 4MF0A 4MXXA 4I5MA 4IH8A 3DQWA 4O96A 3SRVA 5EFQA 3Q3BA 3FQHA 5E90A 2VTPA 4WO5A 4QP2A 3RCDA 4F1TA 2PVKA 4BDHA 3E8CA 2VTAA 4O7TA 5DVRA 3VHEA 4FI1A 4M13A 5LJJA 5CEOA 4S2ZA 2GQRA 5IISA 2C69A 3E7VA 2CGUA 4AN2A 5AM7A 4ALVA 1A9UA 3PZEA 3C4CA 4GUBA 4TNDA 4ZS0A 5J95A 1IR3A 3ZRKA 3CSVA 3PWYA 2QG5A 3K3IA 1QPJA 2WTKC 2YEXA 5LMAA 3WI6A 4YZ9A 5CF6A 2VD5A 3OXZA 4O7VA 4BCJA 2QVSE 3E8EA 4LGDA 4UALA 5DWRA 4XG9A 2B53A 4C37A 3F3TA 4J98A 2XRUA 4HPTE 4IAKA 3ROYA 3VJNA 3ODZX 4RWLA 4FZ6A 5KZIA 4FL1A 3F61A 5DRBA 2R64A 4UMUA 3R00A 2G2FA 2ZV9A 5DR6A 4DBNA 2R3RA 4WG5A 2JC6A 3UBDA 5J5SA 5J1VA 4F0FA 3FLWA 4IVDA 5DT4A 1TQIA 2A1AB 3QL8A 1UU7A 3NUAA 3AT2A 5CQUA 4QMTA 4X3FC 4GCJA 4Y46A 5KE0A 3R1YA 3ORTA 3HP2A 4RQVA 2P55A 4YJUA 4W4YA 2W0JA 1M17A 3ZM4A 3NYNA 4NSTA 4QMOA 3UIBA 1GOLA 2VO7A 2V22A 5B2KA 3SG9A 2EXMA 3R30A 4BCGA 4OTIA 3DKFA 5EYCA 3T9IA 2IW8A 5GZ8A 5FXRA 1ATPE 2EB2A 4BDKA 2HZ4A 2G2IA 2Z2WA 5F1ZA 5LVNA 3BBTB 2GU8A 4JI9A 3U6JA 3HP5A 1YXSA 4NM5A 4BTKA 4EYJA 3RWPA 4FKQA 3NNVA 4Z7HA 3CKXA 3A62A 4FF8A 3UOHA 4EJ7A 3L8PA 4YTHA 2BALA 5AUUA 4YZCA 1YOLA 3OCSA 3R71A 4HGTA 3FLSA 2QQ7A 3VS3A 2B9JA 2Y4IC 5JKGA 2PZIA 3OCGA 1PW2A 4GW8A 4P7EA 3MH0A 4Z16A 4ZS4A 2ZB0A 4BRXA 4PTGA 4OBOA 3G9LX 3PY1A 5JT2A 2VRXA 4OTRA 5AP1A 2B4SB 1J1BA 4IAIA 5FBOA 1W83A 4O7RA 3PIXA 5FWKK 2PL0A 3MPAA 4ZJVA 2B9FA 2A2AA 4G2FA 3S00A 2W99B 2J2IB 1H0WA 4XG6A 4E6QA 3U9CA 1HCKA 3OZ6A 2NO3A 4D9TA 3PE1A 5IU2A 3QKLA 2C5OA 2XCKA 2WKMA 3SRVB 3LOKA 4BBFA 4DH1A 1R3CA 3DJ7A 4YU2A 3S0OA 5EI2A 3DK6A 4YHJA 2CKEA 2XM9A 4EHEA 5AA9A 4D2PA 2YCSA 3ATSA 1Q8ZA 4IB1A 4EH6A 3QD3A 3H0YA 5AJQA 3TCPA 5JZJA 4G3EA 2C6DA 3COMA 3BHUA 2KTYA 3BHHA 1WZYA 5FEDA 4BDIA 3LFSA 4ORKA 5AV3A 2ZM1A 2XIZA 2VTQA 3BU5A 3LJ2A 4BDCA 3R7IA 1OI9A 4AFEA 3BZ3A 4C62A 5LXMA 3QQKA 4DTAA 4QP7A 4W8EA 3ZHPC 2I0YA 3CBLA 5F9EA 3DA6A 3DT1A 5HO7A 1WBOA 5HHWA 5M09A 3OS3A 5DH3A 2I6LA 3LFAA 4L44A 4IX6A 5HO6A 1JBPE 2B0QA 5HICA 3KF4A 4X2FA 4YBJA 1NVRA 2ETRA 2XYNA 4GFOA 3WF6A 4D4VA 1IAJA 4LRJA 5IA0A 1OL6A 4HNIA 2BILB 4CLIA 4OTPA 3R6XA 1IG1A 3C51A 2BAKA 4QPAA 2CGXA 3Q4ZA 5C8NA 4F7LA 5IUHA 2BVAA 3R1QA 3EHAA 3QQLA 1UU3A 5TOZA 4PDYA 2J0JA 4HYIA 2RG6A 3A7HA 3PXFA 4FKWA 4IC8A 3G5DA 3MN3A 3ZSIA 3PY3A 3BWFA 1ZYJA 4R5YA 4U9AA 3T3UA 1RDQE 2YIQA 5IA3A 3MH2A 5FRIA 2QURA 4TXCA 4DEBA 4TN6A 4E4LA 4EOOA 3HA8A 4U6RA 4BFMA 4RX9A 3QRTA 4ZSGA 2WOUA 4FUXA 4PPCA 1JSUA 3SXFA 3ZUVA 2IVUA 4CMTA 3OFMA 2JFMA 2OK1A 4EORA 4ZAUA 4RIXA 3U6HA 3DJ5A 4ANNA 4PMPA 3TTIA 2JEDA 3LCDA 4C58A 4AOIA 2R3JA 4NH1A 3LXPA 2FSMX 1SZMA 4QMLA 3Q6WA 4D2TA 1EH4A 5CF4A 5HLNA 3QLFA 1WBTA 4FTLA 2YDJA 3PA5A 1G8SA 5HU3A 1LPUA 4PNIA 2HENA 3MFRA 3C4XA 5CYIA 5GHVA 4J1RA 4C7TA 3V04A 3DXPA 1XH7A 2W1CA 3ET7A 2O64A 5I9UA 2XIYA 2GFSA 3DJ6A 4EZ5A 2XVDA 4X2NA 3LFFA 3RPSA 1SM2A 5IEVA 4A06A 5LOHA 1CKIA 4JT3A 5BMSA 2J9MA 4U80A 4FKRA 1PJKA 1BMKA 2YIRA 3NNXA 2C0OA 4M66A 4DN5A 5CAPA 4I0SA 4PUZA 3FBVA 4YJVA 5HTIA 2PTKA 3HEGA 4G17A 3VQHA 3ZBFA 5FQDC 2IWIA 4FNZA 5JK3A 4BTJA 4TWOA 3UOJA 5JN2A 1UU9A 3COHA 2WTIA 3KU2A 4I3ZA 4ANMA 1JSTA 1VJYA 2YABA 3R8MA 3PVWA 4O0SA 3Q9ZA 1FPUA 3D15A 3Q4CA 1OIQA 4K9YA 4RIWA 3D5WA 4RQKA 5EDQA 4I20A 3I1AA 4B4LA 5M53A 4R3PA 4TYEA 3OWLA 3ACJA 2XMYA 2J51A 2VWUA 2PZRA 4H3BA 2XNNA 2P2IA 1H00A 3QQHA 5EM8A 4A9TA 2HK5A 2X8EA 4QYGA 4N70A 1BKXA 4HZRA 3DBQA 4YMJA 1XBAA 3H9OA 3Q9WA 4GL9A 2QHNA 4ZK5A 4JG8A 4G5PA 2R3PA 5LWMA 2OH0E 3FZPA 5CSVA 3ZMMA 5CAVA 3R83A 5M4FA 4FIFA 3ZOSA 2R3GA 4NTSA 5HTCA 3JY0A 1PXMA 3AT4A 3E3BX 4IM0A 4QYYA 3V8TA 3KRJA 4C61A 2WMVA 5KBRA 3R8ZA 2YM8A 3NX8A 2GNFA 3OBJA 5T68A 3BIZA 3IPHA 4A07A 4CYJA 5HOAA 1ZY5A 4KABA 3NRMA 4DCEA 5CQWA 5A4EA 3EJ1A 1ZYDA 3TACA 3OUKA 3RM6A 2HXLA 4WT6A 4I5PA 4LMUA 4BTMA 4ENYA 5L2TA 4AW1A 2XNEA 1REJA 3ITZA 1PYEA 4BWPA 3KXZA 3HLLA 2PVLA 1O6KA 1LEZA 1YI6A 2PE0A 3LZBA 1YDSE 3BE9A 4RIXB 2ZB1A 5AIRA 4EONA 4GIIA 2VTMA 4IM3A 3PVGA 5IQFA 2WNTA 4QNAA 3ULZA 4ERKA 5BUEA 2BRBA 3DAEA 2W1IA 4YZMA 2OJ9A 1H1RA 5DNRA 4I94A 1UWJA 1WCCA 2ITQA 3LIJA 3MA3A 4IWDA 4Y5QA 2PZPA 5AWMA 3MTLA 2XNOA 4RC2A 4BDGA 4PP9A 3NUSA 1XR1A 4WBOA 3W2OA 1OPJA 3BYSA 4XYFA 1GIIA 2ZV2A 3EQCA 3F7ZA 3KEXA 4RJ8A 3BEAA 3TXOA 2PVRA 3POZA 5BVKA 1Y8GA 4KUJA 1OKZA 2JKOA 4M68A 3LFEA 5HX8A 3QXPA 1YOJA 2ITVA 2CHLA 3DCVA 1NVQA 3FPMA 1CM8A 3OVVA 5B2LA 4WA9A 3UNZA 4FSYA 3C0IA 3ANQA 5BYYA 5DA3A 3AC5A 5DOSA 4YPDA 3P1AA 2WTWA 4WNKA 2ZMDA 2PK9A 4NZWB 3SC1A 3VS4A 1M14A 3H0ZA 3VJOA 3UVRA 3V5QA 5C4KA 4QMPA 3UOKA 4FKPA 3B2WA 4QMVA 5D10A 4USEA 4BZDA 2PMLX 2OLCA 3FY2A 3WYYA 4RVKA 4AA5A 5M51A 5E8UA 4ZLZA 3WOWA 4J95A 2QLUA 1BUHA 2VX0A 3FHIA 3BE2A 4BYJA 2VO0A 1HOWA 4QQ5A 1H01A 1GZOA 3LM5A 3LFNA 4E6AA 5C8KA 4MX9A 3QHWA 3CGFA 4IE9A 4E5BA 4AGUA 1OUYA 3JS2A 3O7LD 4O81A 5HX6A 1OL7A 2OJGA 5BPYA 5F4NA 3RAHA 4O0TA 3GC8A 3ULIA 4FBXA 4MVFA 4RX5A 4EBWA 3LCKA 4CFNA 5JGDA 4AAAA 1OMWA 3O7LB 4TPTA 3RZFA 3TTJA 3MFTA 2J0LA 2PE1A 4XHKB 2R3OA 1R1WA 4IADA 3ZXTA 3OMVA 5AR2A 2OZAA 4JQ8A 5HESA 4D1XA 4QMYA 5FEEA 4C2VA 5IA1A 1B38A 4G3GA 3R73A 5E1EA 3UPZA 3HAVA 4EQMA 3FWQA 3UIMA 4IHPA 3VVHA 1GZ8A 1YHWA 5BVNA 4IB0A 3QA8A 2IZUA 4UWBA 4ZTMA 3TNHA 5JGAA 4U42A 4FL3A 4BHNA 4AA4A 4FV6A 4C8BA 5HKMA 2QOLA 3PJ2A 4QTEA 5CF8A 3R7EA 4NU1A 2PU8A 3M1SA 4XH6A 3BI6A 3Q04A 2I40A 5J7BA 1J7LA 3ZSGA 2YM7A 3QRUA 2C6MA 3A8XA 2UZLA 5EW8A 4KSPA 3TKUA 5HG5A 3DZOA 4IIRA 2QOCA 3MSSA 4I21A 1O6LA 4RJ7A 2ZVAA 3K5UA 4BZNA 4YTIA 1VR2A 4AZEA 1OB3A 2IZRA 2P0CA 2WIPA 3LHJA 4EH4A 1FMOE 3R2YA 5C9CA 3I7BA 3CY2A 5GNKA 2DWBA 5CZHA 3MVJA 2X1NA 4H39A 5DRDA 4OT6A 4XRJA 1Q99A 5HE1A 3Q5IA 3RWQA 1Y8YA 5IQEA 1Q8WA 3QRJA 4FSQA 4EK4A 3EL8A 1QPEA 4H3PA 3WZDA 3UZPA 3HZTA 3FKOA 3BLHA 4FT9A 1H27A 1ZMVA 4J99A 2IVSA 3A4PA 3WE4A 4WSQA 3MS9A 4BBEA 2RGPA 1RQQA 4M8TA 4R3CA 5GIOE 4K77A 3SGCA 3KFAA 4JXFA 5I4NA 3UO6A 4U3YA 4EBVA 4I93A 2VGPA 2XKCA 1F5QA 3MH1A 2YA9A 4IEBA 4BCIA 2XJ2A 2X4ZA 4D0XA 1LP4A 3FUPA 4ZY5A 2F7XE 1OVEA 3FL5A 3HMMA 3Q52A 3KVXA 2HIWA 3C13A 3ERKA 2CCHA 4GV1A 1YW2A 4BCNA 4LOPA 1I44A 1KWPA 4FUYA 3QCXA 4KRCA 1S9IA 2BDJA 3F2AA 3VF8A 2UZEA 2YZAA 4AP7A 2F49A 2WB8A 4BVUA 5A54A 4AWIA 5CS6A 4ZZOA 2W1GA 3DZQA 3HMNA 3R7YA 4O0UA 2XZSA 5CAQA 5FP6A 4MXCA 1SYKA 3TI1A 2P3GX 5KBQA 3SX9A 4ZLYA 5LMKC 5AP2A 3UO4A 5F94A 1SNXA 4HZSA 3FL4A 3W2QA 5GIPE 3IOKA 2KULA 2W1FA 3C4EA 2OZAB 3NUUA 5DPVA 5HNIX 4JRNA 3D0EA 3FMEA 4YURA 3SQQA 2B9IA 3EKNA 3FXZA 1CTPE 4IQ6A 3R7VA 4J71A 4G9RA 5CEQA 1UNHA 2QKWB 4YZBA 5IMXA 3TUDA 2IVVA 3U87A 4WG3A 5L2QA 3M2WA 2O0UA 3LXNA 4AZVA 1H28A 4CRLA 4G6OA 2OBJA 4KD1A 5EOLA 4GSBA 4MXZA 5TO8A 5FEQA 4MD8E 5M44A 4QMQA 4YSJA 2HWPA 3SDJA 4CFMA 4ZJIA 2VTSA 3NW6A 4JDKA 2QLQA 3ORIA 3ORXA 4G6LA 4H1JA 4XV1A 3FMDA 2XK4A 2C5VA 2UVZA 2UZTA 2WFYA 2Y8OA 3HKOA 4FEQA 2JAVA 4O38A 3UVPA 3NS9A 3CQEA 4A9SA 4Y95A 4F9BA 3GEQA 4X2GA 2ITYA 3PA3A 3IO7A 3KKVA 5M57A 5AX9A 1SVGA 2PVHA 2J5EA 2UZBA 2W5HA 5CSHA 3BHYA 4DF3A 3MB6A 1ZWSA 4CV8A 5AADA 1E9HA 5L6PA 2YN8A 3OC1A 3ORNA 4WBBB 3I4BA 1O9UA 4FEVA 3GU6A 4O84A 3H3CA 4AE6A 4FV0A 5C26A 4PF4A 3KY2A 4DGNA 4U3ZA 4BKZA 5C4LA 3UIUA 3EH9A 4I5CA 5H8EA 4E8AA 4C02A 4O2PA 2QG7A 2I1MA 3AD5A 2AC5A 4GG7A 4L9IA 1QCFA 3P86A 1TVOA 2OF4A 3CIKA 3OUNB 3ZO4A 2BFXA 4FTOA 4QP6A 1KV1A 1ZMUA 3F6XA 4D4YA 4PL4A 4DT9A 4CFXA 1OM1A 3TNWA 4YZNA 1H8FA 1TKIA 2VO6A 3EQDA 4MEDA 3C50A 4KNBA 3V8SA 5JGBA 5E8TA 4Q9ZA 2YDKA 1XBBA 5I3RA 3C5IA 3RJCA 3MY0A 3HV7A 3D5VA 4YP8A 3W1FA 1IRKA 3DS6A 4FTQA 3ETAA 4WNPA 3H9FA 5KKRB 4L7FA 4FZ7A 2O5KA 1OIYA 4QP3A 3EFLA 3D5XA 2RFEA 3GB2A 3R2BA 4JR3A 3GQLA 3O17A 4R77A 2PMNX 3WIGA 3EKKA 2VTIA 3MV5A 1Q8YA 2C6OA 4XMOA 4YC3A 2BIYA 3FMMA 4G6NA 4YC6A 2WPAA 4PMTA 4RGJA 4AGCA 3L9MA 2XIKA 5GJFA 2VV9A 4W9XA 2QO2A 3D2IA 3HGKA 4GU9A 2GS7A 2PUIA 4FYNA 2WEVA 4C2WA 4QRCA 3ORZA 2JDSA 3GGFA 3RNIA 4H3QA 3KN5A 2WMBA 3MFUA 3OWJA 2OWBA 4X21A 1UNLA 2BTRA 4EL9A 4FSTA 2CMWA 3FJQE 4RWIA 1ZZ2A 4UV0A 3JYAA 2RF9A 1PKDA 4FZDB 2X0GA 4FTNA 5AP6A 5AAFA 3ZFXA 4PRJA 2UZUE 4MF1A 3O50A 3ROCA 3GI3A 3BHVA 4FV9A 5E8SA 1M7QA 2OJIA 3LCOA 3JUHA 3M11A 1TQPA 2JIUA 2XK3A 4YLJA 2BRGA 5ETFA 4CV9A 4EOQA 3EN9A 2VO3A 3QZHA 4EOLA 4FOBA 2NRUA 4NUSA 4CEGA 2BR1A 3Q2JA 2BMCA 5KMMA 3GP0A 2C5NA 3AMAA 5LVPA 5HGIA 2QOBA 4BIBA 3MVLA 4F4PA 2V7AA 1U4DA 1I09A 2XKEA 3Q96A 5A6OA 3F66A 4MH7A 5TE0A 3RTPA 5K0KA 3U4WA 5AV0A 4IX5A 4C4EA 3EQFA 3ZFMA 4CZUA 3PP0A 3SKCA 1YXUA 3F5GA 2VTHA 1DI9A 1QPCA 3R9HA 5HE0A 4OAVB 4EK8A 2W05A 2VWVA 3NYVA 4IWPA 2XP2A 3KXHA 5EM7A 2YLEA 4KBAA 3S3IA 2FUMA 1IEPA 3ZUUA 1WFCA 4X0MA 4BCMA 4BIEA 4CYIA 3ZO1A 3AC8A 3W33A 4O21A 2IW6A 2WZJA 5EM6A 3ZRMA 4RJ3A 4TWCA 4PNKA 4O7LA 5KCVA 2VTOA 1G8AA 2W96B 5HG8A 5A3XA 5KMJA 2IZSA 4L68A 3W55A 1OECA 3CXWA 3GU7A 3WYXA 3UYSA 4FSRA 1PYXA 2ZDTA 1F3MC 5DI1A 1A48A 4G34A 3HRCA 4F63A 2JGZA 3QX4A 4TWPA 4ZTLA 5CEKA 3QRKA 4I1ZA 1Q4LA 2HZIA 4M69A 3SXRA 2YAKA 4ZTQA 4FTAA 1MRVA 3NLBA 2WU6A 2UW0A 2W5AA 3VUHA 4BR3A 1ZYSA 4I4FA 2UW6A 4QMXA 3FI3A 3C9WA 5H2UA 4BGQA 4K6ZA 2C30A 4L3LA 4MNEA 1MQBA 1OL2A 4BIDA 2Z60A 4KRDA 4WRGA 2JIIA 5J8IA 4QMWA 4QP1A 4GG5A 2GFCA 4X3JA 3Q53A 4QMUA 3OG7A 4EOJA 3ZS5A 3QTRA 5HG7A 2EB3A 4R7IA 5IQGA 3QTXA 1G5SA 1PMNA 2EUFB 3FC1X 4FV1A 4RSSA 1JKLA 3DXNA 4NCTA 3PZHA 1JOWB 2QU5A 2C3KA 3QC4A 2E9NA 4XG4A 4AW5A 3GQIA 2YCFA 4C3RA 4RVTA 3TIZA 3QCSA 3EZVA 4F6SA 5IH6A 4JS8A 1R0PA 4ZTHA 4O7ZA 1Z5MA 2A27A 3VS2A 4KBCA 1WBSA 1OZ1A 3R01A 5A46A 1WVXA 3G90X 1XH8A 4HVHA 5CT0A 3VQUA 3GNIB 2G2HA 3II5A 3WZJA 4U43A 2W1ZA 4QPSA 2PVFA 3BCEA 2Q83A 4G3DA 2LAVA 4FV4A 2H9VA 2A19B 1BYGA 3R04A 3U55A 4S32A 3HL7A 3HV6A 3QFVA 1XH9A 4NFNA 4KSQA 4Q5HA 4BF2A 4OR5A 5BYLA 1JWHA 4L7SA 3Q9XA 2OKRA 2O63A 4BGGA 3GC7A 2WIHA 4I4EA 1XH4A 2J90A 2WXVA 3SA0A 3NEWA 4K2RA 3U4UA 2XRWA 4OTWA 4KIPA 1DI8A 4G1WA 4YZDA 5CSWA 4BBMA 5JH6A 2XEZA 5EKOA 5EQYA 4DCAA 4LRKA 1YHSA 4TYHA 5DR9A 4C3PA 3GT8A 3BV3A 5BVDA 4N57A 4GK3A 3ZYAA 3ZC5A 5IG1A 3RZBA 1NXKA 3QYWA 3IW8A 1YVJA 3R8UA 4QMMA 4EHZA 4UY9A 2XNPA 3RALA 4IXPA 4WIHA 4UEUA 1L3RE 3DDQA 4U45A 3EFKA 4EOIA 5KMIA 4S34A 2UVYA 4P4CA 5G1XA 1KE5A 4M7IA 1U54A 2XKFA 5IZFA 5L4QA 4BY9E 3BV2A 4ZZNA 4K33A 2PVMA 3MVHA 5AP5A 1P4OA 3FMKA 3JR1A 4DEEA 1ZXEA 4D2RA 4MHAA 1NVSA 2DYLA 5DIAA 4WG4A 5FTQA 2HW7A 3PJ3A 3WF8A 5HLWA 3FZTA 3CC6A 3R0TA 3UQFA 2XK7A 2JITA 4FX3A 1T46A 4M69B 2R3QA 4RMZA 5DBXA 3AC1A 4F9WA 1Q61A 4IAAA 5AIKA 3LVPA 4AOJA 2C1BA 3QRIA 5CEPA 3O96A 3W2CA 5AR3A 2J6MA 5DFPA 5J5TA 5AR8A 5IEYA 2BZIB 4IVBA 1CKJA 2CLQA 4MNEB 2GS6A 3QD4A 2J5FA 4FMQA 3TG1A 5IMEA 3F88A 2EWAA 3RAIA 1P2AA 4D58A 3VIDA 3NIZA 4NWMA 5K4JA 4EK6A 2XUUA 3HUBA 4I24A 1K9AA 5D1JA 5D12A 4CMUA 2Z8CA 2JIVA 3QAME 4GYIA 3MJ1A 4E4NA 3H10A 5JEBA 3I81A 3IDBA 3Q5ZA 5F95A 3AG9A 4RVMA 4GU6A 2R7BA 3COIA 4JQ7A 3C4WA 4IWQA 1W8CA 4NKAA 4RLKA 4ASEA 4YTFA 4FKSA 2G15A 3NR9A 4BI2A 4YUQA 4BGHA 2YHVA 3MI9A 4AE9A 4QYHA 5I9XA 3REPA 2F7EE 5CXHA 3VUIA 2HOGA 2NNWB 4FEWA 3F9NA 2BUJA 3P08A 4H36A 4K1BA 2XNGA 4BB4A 3LW0A 4JBOA 3GCSA 2GTNA 4L52A 5M55A 3SOCA 4E93A 3LMIA 4O27B 5JQ8A 2GQSA 4FGRA 5DEWA 1MRUA 3TNPC 3HUCA 4TTHB 2YWPA 5HCYA 4MQ1A 1MUOA 2F2CB 3U8WA 2EXCX 4CKJA 3CPCA 4EOMA 4FSNA 3DFAA 3OD6X 5M4CA 5HNBA 3KXGA 3EN4A 4A4XA 5DMZA 2ITXA 3SVVA 2C6LA 1W82A 3QWKA 4R1YA 1J91A 2YFXA 3GVUA 4TYHB 5IUIA 2IG7A 1ZOEA 3TJDA 4AS0A 3VUMA 3G9NA 2ITPA 3HRBA 4WSYA 4FSWA 4A7CA 5LVMA 5TR6A 3P5KA 2XIRA 3FV8A 5FTGA 2JDVA 3AC4A 4F65A 2CKQA 3MPTA 4PL5A 3PSCA 4NJ3A 1GJOA 4G9CA 2PWLA 4MQ2A 4W8DA 3IK3A 3KK9A 4LL0A 1U54B 5BUJA 4BDDA 4F0IA 5HNGA 5AV1A 4FTJA 5CTPA 3E63A 3NVMB 2ZYBA 2UW3A 5CI7A 3R7OA 3DOGA 4GT4A 4IAFA 1KE7A 3QLGA 4XV9A 3G6GA 3PXZA 4BCHA 2QO9A 4U0IA 4DFNA 4H05A 4F9CA 4FE2A 2FGIA 2PVYA 4PTCA 4WNMA 3A8WA 4IVCA 4GJ3A 4UZDA 5CX9A 3ZO3A 4GS6A 4BCOA 4FC0A 4IVAA 2YWVA 4QQJA 2G9XA 2RKUA 3PRFA 5AR4A 2YLFA 5K0XA 1OITA 3V3VA 3OOGA 4IAZA 4ANQA 4EK5A 3A61A 3AQVA 4BWXA 1YI3A 2QOIA 3E64A 4F9YA 3PJ8A 1T45A 3F3VA 5C1QB 2B1PA 2QODA 2UVXA 1AGWA 2RG5A 4AA0A 2B54A 3C0GA 3FYKX 4E6DA 1NT2A 4I0TA 2VTTA 1OL1A 3HA6A 4AGWA 4AGDA 5KZ0A 2H6DA 4XUFA 3VBWA 2X2LA 1X8BA 4NTTA 5AV2A 2P4IA 3QZFA 2NP8A 3KA0A 3E93A 5BQ0A 3R9OA 2ERKA 3LFCA 4FIHA 3R9DA 2HZ0A 2ESMA 4IM2A 2XNBA 3TDWA 3TWJA 5A4LA 1OBGA 1OGUA 2QR8A 2AC3A 3BYMA 3EYHA 3R7GA 5ITAA 1OUKA 3D2KA 3FYJX 2IVTA 4FR4A 4FA2A 2WTDA 4L43A 3AMBA 5BVFA 3ID6C 3WF9A 4DEHA 3I0OA 4PY1A 3QXOA 3A60A 2EXEA 5ANDA 5A14A 3RI1A 4BCKA 4J97A 3VBTA 1KV2A 3DQXA 4FIEA 4CCBA 3PDTA 3BX5A 3ZH8A 3UG2A 3N9XA 4LI5A 4BDJA 1ZARA 3ZDUA 2VTLA 3NNWA 4Z9LA 1WBVA 3F3ZA 3NW5A 2GMXA 2F4JA 2X7GA 5JFSA 2RIOA 3CKWA 5JRSA 3DAJA 4FTRA 4NW5A 5J79A 5CVHA 4A9UA 3E3PA 3UMXA 1H1PA 1Q3DA 4BC6A 3ALOA 2C3IB 4KAOA 2JLDA 4A9YA 3PSDA 2WEIA 4IB5A 4YR8A 4CLJA 4W4XA 5AR5A 5EHOA 2C6TA 5JFXA 2PUPA 3FKLA 4GEOA 3UP2A 4J96A 4EKKA 1SVHA 3PY0A 2G1TA 3RP9A 3KCFA 3VUDA 4FG9A 3UQCA 1A06A 1U46A 2V0DA 5JSMA 3KRRA 3R9NA 4RC3A 1H1QA 3QU0A 3FKNA 1APME 2OIQA 3CTHA 4XG8A 2X9FA 3V8WA 3I6WA 4EC8A 2GTMA 4TYIA 4HVSA 2VWYA 3O51A 3TEIA 1ZYLA 2HXQA 4CG9A 4EKLA 4Z3VA 2X6EA 3RCJA 2EU9A 2RFDA 3RKBA 5HD7A 5TF9A 3PXYA 4L3JA 3HMPA 2O3PA 3KRXA 1H25A 3HMOA 4FV3A 3PSBA 1YWRA 3H4JA 1SVEA 5A6NA 2VAGA 1B6CB 1UKHA 4P2KA 2X8DA 2Y6MA 5I9VA 2VWZA 1WBPA 2C3LA 2R0UA 4DC2A 4YO6A 2GHMA 4F09A 4QMNA 3DFCB 5A4QA 5HBHA 4R7HA 2ZM4A 4O0YA 2BDWA 5GJGA 4FT3A 2V55A 5GZ9A 4LOQA 4ZXTA 4BTFA 2GNLA 3LQ3A 2WMXA 2ITUA 3QKKA 4IC7A 3GUBA 5L6OA 4BN1A 4GKIA 2OG8A 5EDRA 4E5AX 3R63A 5E4HA 2GNGA 4ASXA 3R8LA 3PVUA 4QTCA 2ACXA 4LGGA 5ANIA 5DE2A 4CQEA 1BL6A 1XJDA 1GNGA 4JRVA 4FKVA 4R5SA 4RIYB 4DFXE 3UZRA 4RRVA 5HO8A 5KNJA 3V51A 4CQGA 3A7GA 2IW9A 3THBA 4QQCA 2XH5A 4XP0A 1M2PA 2R0IA 3EQHA 3P0MA 3RPVA 4O7YA 1XWSA 1CKPA 2WMWA 3G2FA 4V05A 3S4QA 1JNKA 3UIXA 4AQCA 4DFBA 3HX4A 5ETIA 1IAHA 3DLZA 5LWNA 4NIFA 1V0PA 2YM6A 3R1NA 2B9HA
chains in the Genus database with same CATH superfamily
2CDZA 4G3FA 4XBUA 2WGJA 3COKA 4FRFA 4BI0A 4OLIA 3PIYA 4ZOGA 4XV3A 5CU4A 4WOVA 4FTIA 4Y8DA 3BWJA 4C0TA 3DAKA 4DGLC 2WD1A 3C0HA 4GJ2A 4AX8A 2F7ZE 1MP8A 3ELJA 3MY1A 3N4TA 2R3MA 5AFVA 1BI8A 3HRFA 2CLXA 5HIDA 4TNBA 2BZJA 2VX3A 1GIHA 3FEGA 4AT3A 1KUTA 3P5JC 4RA4A 1LUFA 4CRSA 2XK8A 5BVEA 4C57A 5BUIA 2W06A 5CF5A 1IA8A 3N4UA 2GNIA 3DK7A 1XH6A 2VNWA 4FEUA 4M15A 1WBWA 3POOA 2O8YA 3FZRA 2VX1A 3GFWA 4NKSA 5EG3A 3UYTA 4C35A 4DFUA 2CGWA 4EZ7A 2GCDA 5JFWA 4BKYA 5M06A 4B9DA 4F08A 4LV7A 3MB7A 3F5PA 3W2RA 2FYSA 5HE2A 2WTVA 3CTQA 4ZIMA 4L6QA 5FGKA 4XNEA 2P33A 4B0GA 2YERA 4B7TA 2VNYA 4D1SA 3P79A 4YNEA 4HGLA 2PUUA 4PMMA 5CT7A 5HI2A 5KKRC 2I0HA 3CQUA 5FM2A 3KMWA 5CVFA 5HQ0A 3QCQA 3CTJA 4K11A 1H07A 4U5JA 3LLAA 3DGKA 3D94A 4ZY6A 2FB8A 2FSTX 2PHKA 2XS0A 4IZYA 4QMZA 3GXLA 4UWYA 5CSXA 5HIBA 5HLPA 3E88A 3P7CA 4F0GA 2ZDUA 3Q2MA 4MXAA 3OF0A 3ENMA 2ONLA 3KVWA 3H30A 3TZ9A 3S95A 3S1HA 3O2MA 4S30A 4V01A 3ORLA 2OSCA 5FM3A 3VN9A 4IZ5A 1OIRA 4C59A 1Q41A 2JFLA 4NK9A 4ZY4A 2C3JA 3NDMA 3BQRA 4IMYA 4AN3A 2F57A 2E9UA 3NNUA 1KE8A 4JL9A 2QR7A 3PIZA 4GMYA 2QOHA 2WMSA 4L46A 4QMSA 4E26A 1JAMA 3LMHA 3ZDIA 5EHYA 4EWQA 4QP9A 3UE4A 3WZKA 3RBWA 2X81A 3EB0A 1YWNA 2XNMA 3T3VA 5FDXA 1GZKA 2E2BA 2YM4A 3TV4A 4UMPA 2WHBA 2HAKA 3HMIA 4EK3A 3FHRA 1P14A 3QYZA 4QQTA 3UODA 4F7JA 4M67A 3SW4A 4AZFA 3UO5A 4UXLA 1OBDA 5C03A 2ERZE 3RGFA 5HORA 5AUXA 2WMAA 4BDAA 4WHZA 3B8RA 4NIFB 3QGYA 5KMLA 4HCUA 4J8MA 4IDTA 2OXYA 3OY3A 2IPXA 4FICA 1M2QA 4HYUA 5IKWA 3PPJA 4F7NA 5C27A 4CKRA 4A4OA 5JMSA 4CKIA 2YCRA 4P5ZA 1W2CA 5EYKA 5GINE 4U7ZA 4FEXA 4H58A 3W2SA 3FMLA 3U51A 5KX8A 1GY3A 3Q32A 2WMUA 1URWA 3I5NA 4JVGA 3O71A 4O0VA 4Q9SA 3FZSA 4BJJA 2GNJA 3M42A 2X0PA 2J7TA 1MRYA 4Q2AA 3OTUA 2C5XA 4MCVA 2RSVA 3ATTA 2H34A 4HCTA 3O8UA 4USDA 5ACKA 3GCPA 4X7QA 3V5LA 5IDPA 3SV0A 3MH3A 2Y0AA 4F64A 3TKIA 2BIKB 5DT0A 1U5RA 4ACCA 4FT7A 5IQBA 5DGZA 1UWHA 5D9HA 3QQJA 4GKHA 4ITIA 2PVJA 4V04A 4XOZA 1UV5A 3EQRA 4A4LA 2OJFE 4HOKA 4DYMA 4PDPA 1V0BA 3CD3A 4FSUA 3E7OA 1FBNA 4XX9A 4BCPA 4KKGA 3VBVA 2QONA 3ZZWA 3HDNA 3SD0A 4F6UA 4Y5HA 4UN0C 1YXVA 2J0KA 3FLQA 3AKJA 3TMOA 4ALWA 3RPRA 3BYVA 2R3LA 4IDVA 3GFEA 4MYGA 4L3PA 4CFVA 5B2MA 2VWIA 5M56A 3HV3A 3IDCA 2JKQA 3L8SA 4IJ9A 2OO8X 3QTIA 5DG5A 4DFZE 2ZAZA 3ZLWA 2GHLA 3F69A 3BLRA 4BI1A 3KQ7A 3VS0A 4JLCA 2QC6A 5K9IA 1W7HA 3F3WA 3TDVA 5CI6A 3DBCA 4XBRA 4YJTA 4W9WA 4YHTA 4FG8A 1IASA 1YQJA 2JD5A 3ZM9A 3R22A 4DTKA 1UNGA 3TV6A 4QT1A 4FTTA 5I9YA 2UW4A 4ITJA 4RA5A 2YM3A 2HW6A 2QI8A 3DU8A 3PA4A 4W4VA 4C38A 1WVYA 2WQBA 3QQGA 5E9EA 3AT3A 3LAUA 2X4FA 3Q60A 4XOYA 3WILA 5CWZA 3AMYA 4EHVA 4O0RA 5ETAA 2OF2A 5A4TA 3QTSA 4H1MA 3BU6A 4DG3E 2PYWA 3BEGA 2W17A 3O8TA 4E4MA 3SOAA 3L8VA 4DEGA 2Z02A 3PUPA 2NPQA 3HECA 5CENA 3D4QA 4FKUA 2GPHA 4EUUA 3EFJA 1J3HA 3NUNA 3T8OA 1KSWA 4DEDA 3MDYA 2XA4A 3EL7A 3EQBA 3MPMA 4J53A 5AAEA 2GSFA 1ZOHA 1XHAA 2BCJA 2Z7SA 3AD4A 4MD9E 4RFYA 4DH3A 4EHGA 5AAGA 3QA0A 2WOTA 2R3HA 4I6FA 4ITHA 3E5AA 4MWIA 4MBIA 5EYMA 4LUDA 4C34A 4E3CA 2QHMA 5ANJA 4ACDA 2JDRA 5BMMA 3B2TA 1J7UA 4XRLA 2YJSA 3MIAA 2E9OA 4FIIA 3NUPA 4EOSA 2XB7A 3N51A 2VTRA 3DNEA 2WQNA 2R2PA 2FSOX 2G01A 2REIA 3V01A 4BJJB 4KB8A 4ZTRA 4O0WA 3WZUA 4EZ3A 5I9ZA 4LV5A 1PXOA 1G3NA 4E7WA 3OCTA 3RAKA 2GQGA 4U44A 2R3KA 3KN6A 4NW6A 5HCXA 4DLJA 4EH5A 4FNWA 1JQHA 3ALNA 3PE2A 5JRQA 4ID7A 1E1VA 1K2PA 5EOBA 5IQDA 1OKVA 4DE4A 3PVBA 3WARA 2OIDA 4R3RA 3GCVA 2WQOA 4V0GA 2RL5A 4DTBA 1PKGA 4CTBA 4O7WA 1XBCA 4M0YA 4FKOA 3CGOA 3DBDA 3C4ZA 3ZONA 3QBNA 5AP3A 3TL8A 4D1ZA 3NW7A 2B55A 5CLPA 4RBLA 3KMMA 4F99A 4GIHA 5HTBA 3QQUA 1UU8A 3QZGA 5DT3A 4MUQA 4EQUA 4JX7A 2R7IA 3TKHA 3U6IA 2H96A 4O86A 1PHKA 3EIDA 2XARA 4C4JA 4F9AA 3GCQA 5TT7A 3RPOA 3FMHA 1JKSA 4JQEA 3FI4A 1B39A 2FSLX 3TT0A 4GT5A 1YXXA 4ASDA 1Y6BA 2XJ1A 4OTFA 4MTAA 2PUNA 2CKOA 5CSPA 4I6HA 3BELA 4L67A 3MBLA 4TYGA 4U97A 2I0EA 4I22A 4JR7A 2R3IA 4QO9A 2O2UA 5BV3A 2VTNA 4M84A 1JLUE 2CN5A 3A4OX 4RT7A 5I3OA 3SAYA 2UW5A 1PXLA 4NCTC 5LVLA 3LFBA 4IJPA 1PRYA 2PMOX 4IZAA 3UP7A 5EM5A 4O6EA 1P4FA 5ANGA 5HZNA 3N4VA 4AXDA 3LCSA 3ORMA 3F3UA 2ITZA 4E1ZA 3A2CA 3ZBXA 3ZFYA 1R78A 3TZ7A 3V6SA 2P2HA 4RFMA 2UV2A 1E1XA 4TT7A 2X7FA 3BQCA 4D2SA 5DN3A 1LEWA 4CFWA 1OL5A 4YTCA 2QOFA 3BHTA 4MBLA 4EOKA 5JZNA 3OBGA 5AMNA 3RINA 3T9TA 3SW7A 5IH4A 3FLZA 3ZCLA 2XK6A 5FBNC 3ORPA 3RK5A 2XK9A 4YO4A 3OW4A 4FV7A 4EOPA 3LXKA 4NJDA 4G3CA 3V5PA 1PXPA 4USFA 3RVGA 5TKDA 5BNJA 3BPRA 4QYEA 4EWHA 1UA2A 4DH7A 2QOQA 3EQGA 2WAJA 2XCHA 4HNFA 2PULA 3RK9A 1XO2B 2UZDA 1FQ1B 4WUNA 1Z57A 1XQZA 2OH4A 3PG3A 4WNOA 3ZC6A 3F5UA 1GIJA 5CVGA 4L42A 4OTQA 3ODYX 3PRIA 4II5A 5CU3A 3VO3A 4QOXA 3TZMA 2RFSA 3B8QA 2VWWA 2C4GA 2C6KA 5E8VA 4DFYA 4LUEA 4L01A 4TRLA 3IKAA 4LRMA 4Y72A 2ETMA 2F2UA 3QCYA 4B99A 4IZ7A 5C01A 5L2IA 4CNHA 2OFUA 3EQIA 3NZ0A 4AZWA 3EWHA 5CU6A 2OXDA 3FMNA 3G0FA 3QF9A 4V0GB 4TWNA 1GZNA 4LM5A 3R8PA 4KS8A 4Y83A 4DEAA 3I0QA 1NY3A 3UDSA 3BGZA 3QWJA 2OW3A 4QD6A 5E1SA 1H4LA 3EQPA 3BLQA 3LXLA 4IFCA 4ANOA 1PXIA 2AUHA 2FH9A 2CJMA 3ZLSA 3FXXA 3DXQA 3OTVA 5IF1A 3R02A 3TZ8A 3GBZA 3TIYA 4P90A 3BGQA 2Q0BA 5L3AA 2UZNA 4K8AA 5J9LA 4HYHA 3OWKA 4ASZA 2SRCA 4BCQA 3L9NA 3R28A 4D5KA 3VULA 3VUGA 2DS1A 2WQMA 3W16A 3F5XA 2Z7LA 3QKMA 3DLSA 3V6RA 4U8ZA 5ANKA 4QEBA 2JBOA 4DINA 2PSQA 3BYOA 4YHFA 4YSMA 1XH5A 2ZM3A 4FKLA 3WBLA 4AXEA 4RIOA 5I9WA 1YRPA 3AOXA 3SG8A 4BL1A 5ANEA 3IW7A 3MY5A 4X6RA 4QTBA 1WVWA 3WE8A 5AUTA 1Q3WA 1R39A 3PTGA 4GK2A 1VYWA 2YCQA 3L9PA 3QTZA 4X3FA 4ZSJA 3TNQB 2H8HA 5IQIA 3EOCA 4PP7A 1H24A 3HYHA 1CDKA 3F82A 5LVOA 3RNYA 2Y4PA 5AX3A 4OUCA 2BRNA 4IFGA 4UBAA 3K2LA 3IONA 5DR2A 4E5WA 4UMRA 5EQEA 5M08A 2B7AA 3FPQA 4L53A 3Q6UA 3UJGA 5DHJA 4FZFB 2JBPA 4U40A 5CEIA 4XS2A 1KE9A 3R1SA 4APCA 1FVRA 2VU3A 5IDNA 4RVLA 2PY3A 4BCFA 4QTDA 5CAOA 2CKPA 3KXMA 1HCLA 1BL7A 3QTWA 5L8JA 5AUYA 2JAMA 4ZTSA 4I92A 3UC4A 3VBYA 3BKBA 3FZOA 4IB3A 3DK3A 2F9GA 2UZVA 3VS1A 3GU8A 1M2RA 4M14A 3RHXA 2HY0A 2WMRA 2VTJA 4RFZA 2C5YA 2IF8A 4AOTA 4MXOA 2OFVA 4BWKA 4YJPA 1REKA 4S31A 4U79A 2YIXA 3OOMA 3QTQA 2GDOA 3VS7A 2C68A 4FNYA 3CQWA 3HV5A 4HVGA 3PJCA 2VWBA 2C6IA 5AV4A 3KCKA 3JVRA 5H8GA 3DPKA 3UG1A 4UWCA 2Z7RA 1J7IA 3VS5A 4YLKA 4D2WA 3GENA 4D2VA 3OY1A 4N0SA 5AP7A 3E8DA 4KIOA 3TNIA 2CGVA 4N6YA 4RJ6A 3PJ1A 3NCGA 4O22A 4XLIA 4FTUA 4EH2A 3ORKA 3JY9A 5FG8A 2V62A 3NUYA 4BYIA 2HYYA 3K3JA 2W1HA 5G6VA 2V5QA 3QX2A 5HG9A 4D4RA 4KIQA 5IEXA 3BRBA 4J52A 4PPBA 4RG0A 3BLAA 4CT1A 1ZRZA 2WTKB 2PVNA 3IG7A 4KA3A 4X6QC 4JAJA 4E6CA 2XALA 1OIUA 3UQGA 4QP4A 1ST0A 5E8XA 3W32A 4TZRA 2W9ZB 2YITA 1QMZA 3CEKA 4EQCA 4JDIA 5ICPA 3D5UA 4FV2A 5ETCA 1AD5A 5CU0A 3C7QA 1R0EA 1KOAA 1IA9A 1UVRA 3FAAA 4TY1A 5E7RA 5D7VA 3OHTA 3TJCA 4KBKA 3G15A 4AT4A 5M07A 4DH8A 3F7WA 3AC3A 5DEYA 1PXJA 2QOOA 5LMBA 5E8YA 2C6EA 4QTAA 3R21A 3OW3A 4GH2A 3PXRA 4X3FB 3Q9YA 1JSVA 2BAQA 4UB7A 4CXAA 5L2SA 3VUTA 4FVQA 5J87A 3NFGB 4HGSA 3CPBA 4LYNA 5J7HA 3FLYA 2PZYA 5IA5A 1H1WA 4IANA 3RPYA 5A4CA 5B7VA 3LCTA 4N4SA 4D4SA 4FSZA 4EH8A 3D14A 3IGGA 3TUBA 3UDBA 3KXXA 2CCIA 3P23A 2VN9A 1Q8TA 1OPLA 5E92A 3G6HA 3OEZA 4ARKA 1STCE 5EKNA 2VZ6A 4NM3A 3CY3A 3CE3A 2C0TA 3NVKI 4M12A 4Z7GA 4HJOA 5J1WA 2UW7A 2YM5A 4OTGA 5L8KA 4NT4A 3QZIA 1JKTA 4N6ZA 4ONAA 4OAUC 1Q24A 4YNOA 2XBJA 1LR4A 3O23A 3OXIA 2JKKA 3HV4A 1PMEA 3RAWA 1DS5A 1W98A 4F1OA 4Z55A 4P5QA 2Y4IB 2X2KA 1BI7A 2YIYA 3JVSA 2W1EA 3QD2B 1W84A 4DBXA 2VUWA 4KINA 4S33A 3AXWA 4FK3A 1ZMWA 3CJFA 4RIYA 4FL2A 3IDPA 1FOTA 3IW6A 3OT3A 4JBPA 3L1SA 1H08A 4JNWA 4I23A 4ZJJA 3VNTA 1VEBA 2JKMA 2AEGA 2VGOA 3W18A 3QUPA 4MD7E 2V7OA 3FI2A 1YXTA 3EN7A 4MK0A 4DFLA 4GVJA 4WUAA 5CZIA 5EW9A 3E87A 3E92A 5KUPA 2WELA 3G51A 3K5VA 3LJ1A 5HVKA 5K4IA 5H9BA 4C4HA 3KULA 4FGBA 5BVWA 3ENHA 4MKCA 5L2WA 2PMIA 4LG4A 4CFUA 4ZMFA 4FVPA 4LFIA 4IWOA 3V5TA 3FE3A 3ZLYA 4DGMA 4DH5A 4XP2A 4MWHA 2X9EA 4I0RA 3W0PA 3MW1A 4J7BA 2BAJA 5FD2A 2AYPA 2OI4X 4K0YA 1YDRE 3FQEA 2BKZA 3O8PA 3ZRLA 5T6KA 1Y6AA 3P78A 3V5WA 1PXNA 4D55A 3MTFA 3PLSA 4FK6A 4UMQA 3QHRA 1OKYA 4APPA 1YDTE 4R8QA 4AT5A 4I41A 4IBMA 4BDBA 3KREA 2WTCA 1YHVA 3KC3A 1KE6A 4TYJA 3DBEA 4XEYA 3L9LA 1QL6A 5H8BA 3UVQA 1VZOA 2OZOA 2RFNA 3O0GA 4GVAA 3CP9A 4XJ0A 2GHGA 5FXSA 3FSKA 3KK8A 4HGEA 1WBNA 4ENXA 4FT5A 4X2JA 5EHLA 1S9JA 1RE8A 4DEIA 5J9ZA 4RWJA 5E91A 3DY7A 2Q0NA 4EH3A 2YACA 4JJRA 5HBJA 2XM8A 4NEUA 3S2PA 4FVRA 5IA2A 1PMUA 3DTWA 2X6DA 3CCNA 3PPZA 3KF7A 4BICA 4I6BA 3WF5A 2WMTA 4EC9A 2XAMA 2NRYA 5KHWA 4DHZA 4O83A 5IQHA 5BYZA 4ZEGA 1U59A 4K18A 3LE6A 2YZLA 3DKOA 3SLSA 5A9UA 3Q4UA 1H1SA 2W4JA 3LJ0A 2OJJA 2HELA 3I7CA 4HPUE 5HU9A 2CNVA 4FTMA 4D0WA 2BZHB 3EZRA 3PWDA 3L8XA 3QGWA 4CTCA 5LCKA 3NSZA 4C4FA 3A7FA 5IQAA 4OBPA 2XKDA 1SMHA 4GUEA 1WMKA 3OT8A 2OGVA 1ZAOA 3ZO2A 4DT8A 4LGHA 4KKHA 4PX6A 5CXZA 1G8JA 4FNXA 5AUZA 4HCVA 4PV0A 3NIEA 4DG2E 3NPCA 5CNNA 2R3NA 4B8MA 3QUEA 1FGIA 4CG8A 3P4KA 4JOAA 2B52A 3OWPA 4U81A 4XLVA 3DB6A 3GC0A 3LFDA 2BHEA 4O2ZA 4AN9A 1YKRA 4PDOA 3ZUTA 4B8LA 5CALA 4AZSA 5KO1A 3GCUA 5CU2A 2IO6A 2J0MB 2HY81 4G5JA 2QD9A 2XBAA 3KRWA 4RIWB 4BDFA 3E8NA 2W5BA 4PWNA 5EH0A 5CEMA 3TN8A 2JDTA 3D7TA 4AXAA 5D11A 4JG6A 3KULB 4GYGA 4U41A 3D83A 4UYAA 2PZ5A 1YWVA 1PY5A 2WTJA 4GFMA 3EYGA 5FP5A 4KIKA 4QPMA 5JQ5A 4CZYB 3DNDA 4OW8A 3PLAE 5DYJA 1ZLTA 4RZVA 1M52A 2BHHA 2E9PA 4M0ZA 3D7ZA 4FYOA 5HIEA 3RHKA 4YBKA 3PG1A 4AQKA 4WRSA 4CVAA 4JBQA 2QOKA 4F6WA 3EMGA 3HNGA 3VW6A 3MESA 3QTUA 1V0OA 5H3QA 3W0NA 1DAYA 4FV5A 3ANRA 3NGAA 1SNUA 4PTEA 4XCUA 1Q97A 3LM0A 4L00A 5E8WA 4CSVA 1ZYCA 3PFQA 4C4GA 4FKTA 2QKRA 2YAAA 3FY0A 5ACBC 1QPDA 2BROA 2ONLC 2WU7A 5AA8A 4BZOA 4ACGA 4D28A 3W0QA 2PPQA 3WF7A 2XEYA 2C1AA 4KS7A 5I5ZA 4RJ4A 3DKCA 4IX3A 3RMFA 3AGMA 3KGAA 1PMVA 2UW8A 4QYFA 4XV2A 4YGAA 2CNUA 3LKMA 5CASA 2HZNA 3AC2A 3HAMA 5HVJA 4D9UA 1KOBA 3QD0A 1ND4A 3CR0A 3RK7A 1NA7A 2BZKB 4YJOA 4UX9A 3IECA 4LQMA 3V5JA 5K5NA 2X7OA 4ANSA 3CLYA 1H0VA 2ITTA 4DGGA 4DG0E 4CGAA 4DGOA 3ZTXA 1CSNA 4F70A 3IOPA 2FA2A 4XG2A 3DBFA 5BVOA 5AM6A 3W8LA 1Q62A 3MWUA 2C47A 5AUWA 5LARA 4AU8A 5M4UA 4O4CA 3G0EA 3EFWA 3UGCA 1RJBA 4O4BB 5HVYA 4AACA 3C1XA 3IS5A 3PPKA 2Y9QA 3KXNA 4OBQA 5HD4A 4DA5A 3WZEA 2GNHA 3ZLXA 4B6LA 4ZSEA 2W1DA 3NMUF 2Y7JA 2YISA 5FUTA 5CANA 2QNJA 3LPBA 3OP5A 4YJNA 3DDPA 4O0XA 5DLSA 3H9RA 4YPSA 4RZWA 1ZOGA 4YJQA 2PE2A 2W4OA 4FSMA 4NM7A 1JPAA 4JAIA 5EQPA 3PXQA 1TQMA 4ZMEA 3GU5A 5J9YA 1URCA 4UMTA 3ZU7A 2BRMA 5EYDA 5CNOA 1ERKA 2JDOA 4RJ5A 4L45A 3SHEA 4PL3A 5T3QA 4CMOA 3JPVA 2R4BA 3MYGA 3FSFA 3ZEPA 3D7TB 1CMKE 4RX8A 4GFGA 5LCJA 4O82A 3QUDA 4FIJA 2I0VA 3GC9A 3BU3A 4FOCA 3RM7A 5I0BA 3FI8A 5FXQA 4PDSA 3UOLA 4KIKB 3EN6A 5B0XA 1P5EA 3BL7A 3MFSA 2YJRA 4CCUA 1PXKA 4M3QA 3IW5A 3WIKA 2J0IA 5EK7A 1NW1A 3E62A 4AUAA 3R9RA 3TV7A 1ZZLA 3F2RA 4TKSA 1OKWA 1Y57A 3NCZA 3QQFA 1BX6A 2XIXA 4D5HA 2ZMCA 5AP4A 5EDPA 5IA4A 1GAGA 4FKJA 2CSNA 2WMQA 1FMKA 3A7JA 4DHFA 4F1MA 4M97A 4FTCA 2X8IA 1U5QA 4AFJA 3UPXA 2QO7A 4O1OA 2A4LA 3PP1A 5KMKA 2VWXA 4Y73A 2XJ0A 3ZSHA 2BDFA 2EVAA 4NYEA 4GK4A 3LQ8A 5FTOA 3DKGA 4OTHA 4JG7A 2OU7A 3DTCA 5EI8A 3MVMA 4G31A 4ZSLA 5GZAA 4IACA 5AR7A 3KRLA 5GJDA 4O7SA 4C3FA 1M7NA 1WAKA 1F0QA 2XF0A 2R5TA 3HVCA 4IAYA 5EI6A 3W8QA 4DAWA 3C4FA 4F7SA 4ZLOA 5LMKA 4JIKA 3PXKA 2C0IA 3FMJA 5KMOA 4LV8A 3VBQA 3UNKA 3UDZA 4GT3A 4EYMA 5IPJA 2R3FA 3P9JA 2BPMA 4I5HA 4RWKA 5E8ZA 4DLIA 4BDEA 3SXSA 4EI4A 3MJ2A 2DQ7X 1Z9XA 2OIBA 2UZOA 4QP8A 4X2KA 2WO6A 3LLTA 3GU4A 1XKKA 3CJGA 3FDNA 2UUEA 4CFFA 1XMMA 4HVDA 4O4FA 4CT2A 4E4XA 1K3AA 4XG3A 2I7QA 2FO0A 4J8NA 4FKGA 4PPAA 2GS2A 3CD8A 4RLLA 4C33A 3IGOA 3KMUA 3QC9A 3NAXA 4FIGA 2IJMA 2Y6OA 2OXXA 4HW7A 3U9NA 4UXQA 3DV3A 2BTSA 5M4IA 1FGKA 5IQCA 3BBWA 1ST4A 3UTOA 3OCBA 3OROA 4HYSA 4QNYA 4L8MA 4AF3A 4BKJA 5BX0A 2ITOA 4TL0A 3VHKA 4IX4A 3LQ5A 1DM2A 3W2PA 2Z7QA 2CNQA 4G16A 3W10A 1JKKA 4UZHA 4ZZMA 4NFMA 2ITWA 2X2MA 5K5XA 3VW8A 1YOMA 4IW0A 2ETKA 2YDIA 3LFQA 4OGRA 3BGPA 3R7UA 5FDPA 1ZY4A 3ZZEA 3TUCA 2IZTA 3MIYA 4PQNA 4YC8A 4AW2A 1V1KA 4C4IA 4KWPA 4TW9A 4FTKA 4WKQA 2OICA 2QCSA 4LMNA 5K3YA 5AP0A 1DAWA 2A0CX 4EUTA 3LMGA 5HBEA 4ALUA 3VBXA 2XYUA 5KMNA 4AZTA 4ANBA 4FODA 2YIWA 3A7IA 2R9SA 3ZXZA 3FC2A 2ZJWA 4O6LA 3UMWA 1H26A 2ZV7A 3NAYA 4JIAA 3OEFX 3VAPA 3ZEWA 2X39A 3UZTA 3NWWA 4NM0A 3VWAA 4CZTA 4WD5A 4XG7A 4RPVA 1FINA 3I79A 4NL0A 3VC4A 3K54A 3NYXA 5C8MA 2W4KA 3MGYA 4EH9A 5D7AA 5ANOA 1JVPP 5LQFA 4PMSA 3FZ1A 4R78A 4YLLA 4FG7A 4MAOA 4BHZA 3P7AA 4EEVA 2BRHA 2O65A 2BKKA 3A99A 3I60A 4YJSA 2W9FB 3VRZA 4R7BA 3VS6A 4I6QA 4JX3A 3DB8A 3Q4TA 4MNFA 2ZV8A 1O6YA 3NUXA 3PYYA 4FZAB 4JDJA 2HWOA 5AUVA 2E9VA 4O1PA 4AW0A 4HVIA 1Q5KA 4ACHA 1W0XC 1PF8A 2HCKA 5D41A 3R8VA 4MXYA 3I6UA 5F20A 4E73A 3KL8A 4LOOA 4ERWA 3FXWA 4MBJA 3FLNC 5IUGA 3KB7A 4XP3A 3U54A 2W7XA 3OXTA 3VF9A 2QU6A 2ZOQA 3ACKA 4E20A 3AD6A 3G33A 2ZFYA 2CN8A 1Y91A 1VYZA 1RW8A 4W4WA 4ACMA 1L8TA 4FT0A 4R6VA 4Y85A 3VRYA 5L8LA 4O7NA 3I5ZA 4ANLA 5IH5A 2J4ZA 4GRBA 3UNJA 2BFYA 1OPKA 1UKIA 4JBVA 3BYUA 5CY3A 3VUKA 4ZSAA 3JXWA 2IN6A 4RC4A 2J50A 4RX7A 5CAUA 4Q5EA 4DITA 3CS9A 3NYOA 1BLXA 3C5UA 5HE3A 4EH7A 4UYNA 2ITNA 3AGLA 4KKEA 3IQ7A 1FVVA 1YI4A 3GOKA 5EW3A 4A9RA 4ZP5A 1J1CA 3D9VA 1MQ4A 2LGCA 3MA6A 3GOPA 2CPKE 3HDMA 4OTDA 3F2NA 4LL5A 5L6WL 3TM0A 2DUVA 2UZWE 4FV8A 5JFVA 3P7BA 4JDHA 4EJNA 5HCZA 4OT5A 4C36A 4YJRA 2FVDA 3EN5A 3FQSA 3QALE 4R1VA 3UC3A 2UW9A 4CD0A 2WQEA 3IW4A 5AEPA 5KHXA 4DHIB 4ZTNA 1AQ1A 5HEZA 4O91A 4FKIA 5FLFA 4AG8A 1FVTA 1Q8UA 4MF0A 4MXXA 4I5MA 4IH8A 3DQWA 4O96A 3SRVA 5EFQA 3Q3BA 3FQHA 5E90A 2VTPA 4WO5A 4QP2A 3RCDA 4F1TA 2PVKA 4BDHA 3E8CA 2VTAA 4O7TA 5DVRA 3VHEA 4FI1A 4M13A 5LJJA 5CEOA 4S2ZA 2GQRA 5IISA 2C69A 3E7VA 2CGUA 4AN2A 4DHJA 5AM7A 4ALVA 1A9UA 3PZEA 3C4CA 4GUBA 4O4DA 4TNDA 4ZS0A 1IR3A 5J95A 3ZRKA 3CSVA 3PWYA 2QG5A 3K3IA 1QPJA 2WTKC 2YEXA 5LMAA 3WI6A 4YZ9A 5CF6A 2VD5A 3OXZA 3O5AA 4O7VA 4BCJA 2QVSE 3E8EA 4LGDA 4UALA 5DWRA 4XG9A 2B53A 4C37A 4I6LA 3F3TA 4J98A 2XRUA 4HPTE 4IAKA 3ROYA 3VJNA 3ODZX 4RWLA 4FZ6A 5KZIA 4FL1A 3F61A 5DRBA 2R64A 4UMUA 3R00A 2G2FA 2ZV9A 5DR6A 4DBNA 2R3RA 4WG5A 2JC6A 3UBDA 5J5SA 5J1VA 4F0FA 3FLWA 4IVDA 5DT4A 1TQIA