2JKRI

Ap2 clathrin adaptor core with dileucine peptide rm(phosphos)qikrllse
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
142
structure length
142
Chain Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP-2 COMPLEX SUBUNIT ALPHA-2
publication title A Structural Explanation for the Binding of Endocytic Dileucine Motifs by the Ap2 Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 45
structure length 142
sequence length 142
chains with identical sequence S
ec nomenclature
pdb deposition date 2008-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2jkrI00
4P6ZM 2VGLS 2XA7M 3TJZC 2HF6A 5MC7A 1NRJA 2JKTM 2VGLM 4P6ZS 2JKTI 1W63M 4UQIS 2JKRM 2JKRI 2XA7S 1W63Q 4UQIM 2FH5A 4NEED
chains in the Genus database with same CATH superfamily
1E4DA 4BD1A 2K2NA 5CRFA 3IHBA 2IWBA 5GLDA 4Z1WA 3NHQA 2I9VA 4HP9A 5E2FA 5EVIA 3HLWA 5F83A 3UDIA 2ZMAA 4OP5A 5E43A 5HPFA 1OTAA 3ZHHA 3E98A 1DP6A 5HW3A 4JLFA 3SOIA 1NZOA 1D7EA 1H5XA 2BTFP 3BLSA 5KZHA 5L2FA 3K2NA 1XJ3A 2JCHA 2HDQA 5M18A 5KIZA 3TE8A 2KDKA 2ZMVA 3ISGA 4GHIB 2GDNA 3AGEA 3T4QA 2M7VA 3BY9A 2O9CA 3B47A 1XJ4A 4JGPA 5HAIA 4CLCE 3LIBA 1BULA 4O8GA 5A92A 3CMZA 3E2LA 3M2JA 4LPZA 4QPRA 3ULFA 1W79A 2ZC4B 3CPTB 3HUOA 2YKHA 1G6OA 2J80A 1MWTA 2H5SA 2XH9A 4NXEA 2PD8A 4EEPA 3VP1A 1G68A 4DDYA 4DXCA 3Q7ZA 3HUNA 1OTIA 3ZG9B 3NOUC 1H8MA 1VEUA 2EFXA 2R9XA 3ZG5A 2Y2JA 5F6AA 2YKFA 3NC8A 1S4RA 1TDGA 5CXWA 4OOMA 3PYPA 1T1CA 3RJUA 2QPNA 1H8YA 2JKTI 3PBRA 3HL9A 2IWDA 4PM9A 2FFYA 2ZM0A 1NLYA 3U4LP 4QY5A 3IF6A 5F68A 3S7PA 5F82A 2JHEA 5CECA 4Y13A 3OLOA 3UB8A 4LRYC 1SDNA 2G7UA 1RCJA 1LSWA 1SKFA 2P7JA 1ODVA 2C5WB 4ESPA 4P6ZS 4ZJ1A 4HHDA 1HTZA 1EW0A 3UB9A 5FA7A 2L0WA 4Y7PA 1FOFA 1PI5A 3CHWP 4PM8A 4JF4A 3H82A 3W8KA 3SH8A 3O5YA 4S2NA 4K08A 4EXOA 2XROA 2Q0OA 4OPRA 1DY6A 4B4XA 2NUPC 3PBQA 1PI4A 1I5QA 1MKIA 1KDWA 3C7UA 3PXPA 1S6RA 3VSKA 4F94A 1M6KA 1XGIA 4NG2A 3T50A 3UN7A 2J3TC 3G30A 5F5YA 1GCEA 5CGSA 2Y2IA 2BASA 3LIEA 4YOFA 1WYBA 4WBGA 2A49A 3C4PA 4BJPA 3BEBA 2A24B 2R78A 4X1MA 1SHVA 4I3AA 3T1RA 1ES3A 3BY8A 4JKTA 5FQMA 3DAVA 1XJ6A 3MJQA 1JWVA 3CI6A 2H0YA 4CQHA 1SKOA 2QZ6A 5FATA 1LI0A 4ZJ3A 1PZPA 5IU1A 4MCWA 5AVFA 3OC2A 4DMZA 1ZKJA 2Y91A 3FZCA 1LSVA 3GDIA 2QMIA 2HJEA 3N7WA 3E4QA 3DBAA 3UY6A 4R6LA 1EWZA 1KOUA 1SCWA 3JYIA 2A2LA 3WS0A 2UWXA 1F5MA 3HCYA 3RXXA 3ITBA 4FH4A 3HREA 3BLMA 1MC0A 3G6OA 3EEAA 2OV5A 3LY3A 1UWPX 3MSHA 1G28A 4HI4A 4MNRA 1ZC2A 4Y2FA 2DNSA 4R4SA 2JE5A 4EERA 4JBFA 2W27A 2W3HA 1FQGA 2ZOHA 4IBXA 2Y2KA 5TR7A 3UE6A 1M40A 5DTTA 4EESA 4R38A 3DWKA 1NXYA 4WEJA 1STZA 3V50A 5IS1A 3R7WB 1VETA 1YLPA 2WAEA 3FYZA 4HESA 4E3NA 3IX3A 3G31A 4NXBA 3JPUA 3BFEA 4WZ5A 1VQQA 2Q9MA 5EVIB 1T18A 1IELA 3BW6A 2B02A 5A93A 4PKYA 1DRMA 2HDRA 1G5UA 2JKTM 4JXSA 2Y59A 1VB6A 2EFUA 4EETB 1OMEA 3VE4A 2Y2NA 3DWZA 5J7EA 4JF5A 2Y2LA 3TSGA 4HQAA 4KZ4A 4MN6A 4I3IA 4LFUA 1ES5A 5FDSA 3PBOA 2K31A 1ERQA 4X68A 2HZ5A 3UO9A 3F1NA 3LYXA 1JTDA 5KSHA 2CC1A 4JGRA 2B18A 1YQSA 2VV6A 1MWSA 1VHMA 2NUTC 5M19A 2VV8A 5CEDA 1PRQA 2PYPA 4KZ9A 4FSFA 1KVMA 4IEDA 4S2IA 4WN5A 3C7VA 3IS2A 2PDRA 4ID4A 1Y28A 4JGQA 5J8XA 4PM7A 3N8LA 3SZTA 5AQBA 5AQ7A 5FEGA 1JNUA 2ZL1A 3PAGA 3T4SA 3IBJA 2ZD8A 4OQIA 3T4JA 2Y79A 1FR1A 3IXBA 4QU3A 3R4KA 3W4QA 3EWKA 5HPIA 1Z09A 4HNBA 2XA7M 4EBNA 3FC7A 2EWVA 3IF6B 2X01A 3CITA 4KQDA 4CLCD 2WKQA 3GQZA 4KZ3A 2WKIA 3S4XA 3T1XA 4NEED 3UE0A 4GDBA 3UB7A 3BFGA 5AVEA 4MN7A 4Y3IA 3QP2A 3S7NA 3H82B 1LHYA 2JKRM 1JVJA 4P85A 4LCLA 2IA2A 4L0LA 4LLOB 2ZBBA 5L10A 1K4EA 1XPBA 4PM6A 4WUJA 3C2WA 1YM1A 5EVLA 1K55C 3B42A 3D4FA 3LEQA 1MBLA 1K55A 5TFQA 4UEYA 1YT4A 3IBRA 3IX8A 1KDSA 1XXMA 3LIDA 3PHYA 1PW1A 1S1YA 3HLFA 4LGWA 4HH2A 3A3IA 4B88A 4E3IA 2WYXA 4OP8A 4NXFA 3NJAA 2XGNA 2D01A 4XUXA 4GLQA 1MPLA 2XD5A 3H9WA 4R3JA 1SKOB 3WRTA 1GHMA 3IHAA 2Y2MA 1Q2QA 4GOGA 2VK3A 4OH0A 1PWCA 4HJ6A 1K38A 2EX8A 4P6BA 1A0KA 3NDEA 4BENA 3PBSA 3VV4A 3MXSA 2PU4A 4LRZE 2OAQ1 3IQAA 2EX2A 3PBTA 4GNUA 3HLDA 5EM1A 4BBTA 2JN7A 3CUEA 5EVIC 1GA9A 3UDFA 4CPKA 2VA0A 3ZG8B 2GJ3A 2W1TA 3OZHA 1DJBA 4JGOA 3A3EA 3VE3A 3ZVTA 1YMSA 4B4ZA 4GD6A 1TVFA 2B5RA 5GLAA 3FG8A 2KX6A 4Y0OA 5E2GA 3GSGA 1YSQA 5FAQA 3MZDA 1DJAA 2VGLS 4BQMA 3A0RA 3OPRA 1FCNA 4I39A 2W3EA 1XP4A 4C3QA 5I94A 3MXRA 4WELA 1VM1A 4QB8A 4XT2A 1MY8A 2WADA 4IVIA 2H10A 1P9RA 2ZM8A 4DJ2A 1RP5A 5EECA 3QP5A 2ZQ8A 5D3OA 4LV1A 1BTLA 2WKHA 1V9ZA 2XRNA 2ZC7A 1PFLA 4OQGA 4RX2A 4EW7A 5CTNA 1ZG6A 3W4OA 3MXQA 2PHYA 5FL3A 3W2ZA 5K5BA 2Y4AA 3OPHA 3N8SA 3F1OA 3SH9A 1BLSA 4E04A 4MBKA 4NXGA 2KOIA 3S22A 4KG2A 1Z6FA 3PBNA 3M6BA 3ZYTA 4BL2A 1FILA 2W3GA 5J4EA 2OLUA 4L9EA 5CHUA 2G2WA 1FCMA 5FAPA 4C6YA 2OSUA 3EGXC 2V0UA 4KZ7A 1K57A 5HWWA 5MC7A 4LCMA 3F1NB 2W1RA 1YKDA 5EOEA 1HVBA 3G2YA 2Y2PA 1PWDA 5FQQA 1JWZA 2OWJA 3EQUA 3ICYA 1KVLA 3ZQ5A 3RH8B 3ZDJA 4Y17A 2E8JA 1BLPA 3IF6C 4JXGA 3IXGA 5HD5A 1UWNX 2I72A 2ZJ9A 3CZDA 4P87A 5HDSA 4H6JA 1O7EA 2O99A 5DJUA 3IS2B 5DVAA 4OKPA 1PYYA 4S2MA 1F98A 4I3JA 2BLSA 4IBRA 5AQ9A 4PMAA 5L09A 2ACGA 3G2ZA 2WZXA 2FZ0A 3ZVWA 4S2NC 5FEFA 4WEKA 1TS8A 4B93A 4UHUA 4U3TA 4X6TA 5E2EA 1F9IA 2XSSA 1TDLA 2QJ7A 3EEHA 3HUMA 3EQVA 2HGVA 2J3WA 1TS7A 3MFDA 1CJFA 4G3KA 1N9NA 1I2WA 3KYZA 1V9YA 4LENA 2GX5A 4QD4A 3HLGA 1L0EA 2HDUA 2RCXA 3AGFA 3LI9A 1IEMA 5JYOA 4WLAA 5HAPA 3B33A 3F1PA 2V1AA 1LLBA 1D06A 4Q8IA 3V67A 4M4XA 2K7SA 5HDDA 3UMEA 5DFYA 4GS9B 3NIAA 4EBLA 3T4OA 3VSLA 4HY8A 1H3QA 1OTBA 3OCNA 1DP8A 3MS6A 3FWLA 4R23A 5E2HA 5EOOA 4N1HA 2HF6A 5A90A 2PR6A 4MLLA 5CTMA 3A3JA 3LO7A 3ZCZA 5U47A 2V8CA 1C3BA 3ITAA 4HJ4A 5TGFA 2C6WB 4ZAMA 4DE2A 1LL5A 3DTIA 3QNBA 3GVBA 4KG5A 3WWXA 3ZGAB 2XEPA 2Y2OA 5EUAA 5FSRA 1J3WA 3EGDC 3IF5A 3V5MA 3JVVA 3VP4A 4ARZA 5G4ZA 1K56D 1IFQA 5LBRA 3LEZA 3NULA 3NDGA 2WGVA 3NOTC 4E3MA 1W7FA 5CGXA 1FR6A 4WZ5C 1XX2A 4OPQA 2ZM2A 4R1GA 2JC7A 3BFFA 5DKKA 1P97A 4E6WA 1P0ZA 2O9AA 1OJGA 4HBUA 3MQOA 3Q07A 2W1TB 2FH5A 2VKSA 3IH8A 3JVUA 3MZFA 5DKLA 3V3RA 2P08A 2WK0A 4MBHA 2V9AA 4OOYA 1JWPA 2V1ZA 4GW9A 4CLCA 3D3OA 4OPYA 4GHIA 4UA7A 2J3TD 4E3LA 3TOIA 1YMXA 3VP3A 4XT2B 4Y0TA 2X71A 4FOFA 4QHCA 1QMFA 3GRJA 1SZVA 1PW8A 3MKEA 4G3VA 3EOIA 2V8FA 4LV0A 4RX3A 3LR3A 3N6IA 4PM5A 2VX8A 2XQZA 5I5LA 4S2OA 1L3LA 1K54A 5TJJA 4BBUA 3F1OB 2J9OA 3SH7A 4HEFA 4OQHA 1HZOA 3K3DA 2KLIA 3UMDA 2PYRA 1PWGA 4MN5A 1PNEA 2ZQ9A 1T1BA 2HP6A 1S4SA 4OQ0A 1Y54A 4KQRA 1XJ2A 5EFWA 3MQ0A 2VV7A 4A5RA 2JBFA 5IT5A 5F1FA 1VEUB 2V2FF 4EUZA 3H7WA 1NYYA 4PPRA 3BRMA 1ALQA 2QJ5A 3SS3A 2OWHA 3E0YA 4UQIS 1XA1A 3C5AA 4M3KA 4RYEA 1CQAA 4IVKA 5FDHA 1KGEA 3OCLA 3S7QA 1MWUA 3PTEA 3GR2A 3LICA 2O0YA 3KO6A 4FTXA 3UB6A 1OJ5A 3S1YA 3WS4A 4DE3A 2W3DA 1H0MA 3O86A 3LCEA 1H8ZA 4H6JB 2EX6A 1L0GA 3IXHA 1RGZA 4WM9A 4DE0A 1W63Q 2Z2LB 4DE1A 2WZZA 3HLBA 1WE4A 4HH3A 2HPBA 3DTEA 5FI6A 2RL3A 2ZQAA 1NZUA 2XD1A 3BYDA 4ZTKA 3ZNYA 4WMCD 5DFXA 1U60A 4K0XA 2DRWA 4U0TA 3NBLA 4NKPA 3BFCA 4WF0A 4S2LA 5HFOA 1ZG4A 3NCKA 1TS0A 3E4PA 2A3UA 4EV4A 3DTMA 3Q7VA 3KSHA 4O01A 3CWFA 1CEFA 5GL9A 5G18A 1NRFA 4FD8A 2VGLM 4WL9A 3N4IA 1W8QA 4N9LA 5BOHA 5TBMA 1O07A 1BUEA 2Z6DA 4ZRRA 3A3DA 4X55A 2ZC5B 4D60A 3GV9A 1MXOA 2XDMA 1XFQA 3Q1FA 1OT9A 2ZC3B 1WA9A 4PHTA 4E6XA 1DP9A 4EUVA 1KGFA 3F1PB 3U2AA 2WUQA 2DCFA 2J9PA 4JF6A 3LR5A 5DJTA 5FQ9A 1HLUP 1J9MA 3FV7A 4MDZA 4N9KA 1Q2PA 4I5SA 4UAAA 4HP4A 4FCFA 3RXWA 3CUEC 3MKFA 3C4OA 4OPZA 3AGDA 4X1LA 4D2OA 4EBPA 5CEBA 4BBVA 3LGOA 3LUQA 2PR5A 2BG1A 1K25A 3UNWA 1ZHHB 3MZEA 4IUHA 2HP5A 1XGJA 3S7OA 1W8YA 2WGWA 1LI9A 1MZUA 3M2KA 1TS6A 4KZ5A 1E3UD 3A0VA 4ARZB 1N9OA 2UV0E 3LIAA 1OTEA 3VOYA 4BLMA 5KMWA 3T12B 5JYPA 2GNXA 4GJ4A 2AVXA 2XFTA 4KG6A 4KQOA 3MFXA 1QMEA 4HIAA 2M1CA 3IWOA 5F1GA 1VETB 4KZAA 1CI9A 3E4OA 2PBDP 4F3LA 1CF0A 4P6ZM 3ZNTA 1ACFA 4N1XA 5HL6A 3PR6A 5FQKA 1KE3A 3TRCA 5HZHA 2P74A 4MMNA 5FAOA 1S0WA 4JXWA 3T1QB 4EEUA 1HD8A 3IT9A 4XXRA 5FQIA 1JTGA 4UA9A 4NETA 5G4YA 1GSWA 4X69A 3IH9A 4CLCB 3SW1A 4GN2A 2EXAA 4GDNA 5HARA 1I2SA 2CMNA 1F2KA 3LFVA 4CJNA 3QHYA 2DMWA 3NI9A 3WS2A 5HSQA 3HVFA 3P98A 4G3WA 4IHQA 2VJWA 4EWFA 1K6SA 1BSGA 1T1AA 1K57C 4R3AA 2Z2MB 2XR0A 3QP8A 4KZ6A 4XUZA 4GZBA 5DF8A 3T4KA 3MR0A 2LB9A 3Q81A 4FUWA 1WYCA 4OLDA 1EI5A 1TF1A 1LT0A 4BL3A 4II7A 3UE3A 4C75A 1YSPA 4ZDXA 1FIKA 4EQIA 3D72A 2WKEA 2FFFB 3TJZC 4OLGA 4Q0HA 3KYQA 1KGGA 1FSWA 3QP4A 3IWQA 3LI8A 2Q9NA 2B95A 5DTSA 3BFDA 5EVID 3O87A 3H7WB 4KZ8A 3P01A 1BLCA 5HD3A 1YLZA 2ZL1B 1FSYA 4NK3A 2ZQDA 3C8CA 3GMWA 3BECA 1KE4A 1T19A 3RFBA 3P09A 2XK1A 1K56A 3G35A 4R70A 3WS5A 4O7DA 5DTKA 4P0MA 2Z6CA 3HJKA 1CK3A 3UE1A 3UB5P 5M1AA 1IKGA 1IYPA 4E3OA 2EXBA 1S66L 2HV1A 2P04A 1YLWA 4ZBEA 1P9WA 1L2SA 5L8MA 1LL9A 2PBYA 2E8IA 1IYSA 2HDSA 4ZJ2A 2L4RA 3BQAA 2P9VA 1LL8A 3IXDA 4KUOA 5GHYA 1MWRA 4YWZA 1IOUA 3LR4A 2QKPA 3L9KA 4LV2A 1XFNA 3B3XA 3Q7VB 3C38A 3BM6A 1NJ4A 1OTDA 2XF3A 3PAEA 1OT6A 1ES4A 2XFSA 5TBMB 4L9GA 1NRJA 3QP1A 4KUKA 2X02A 3QNCA 5CHMA 1YAXA 2J8YA 1S67L 4Y5FA 5EVEA 3N8RA 3FKWA 1OPXA 1S1ZA 1GSVA 3RTYA 4EQ1A 2VGJA 3GECA 5HWVA 2ZOIA 2O9BA 2R9WA 4IUKA 3LIFA 3VP0A 2OOLA 5HWTA 3BWLA 1E25A 3KX0X 1CEGA 1YPRA 3MBZA 4X56A 4Y0UA 2JKRI 2ZLYA 2V1BA 1DJCA 4RQ9A 4JPMA 4Y15A 2JKGA 1IKIA 4KZBA 2ZMFA 3NECA 5EE8A 3VOLA 4PKYG 2EX9A 3G4PA 2Y2QA 4BWIA 3I7JA 3CJMA 2GZAA 2IWCA 3SS4A 3O3VA 4BMWA 5GHZA 3D9YA 2VLGA 4UQIM 3KYEA 3VMAA 4YINA 3L7HA 3KSGA 4LV3A 4CLCC 1AWIA 2WGWB 5J3WA 4GKUA 2J7VA 3VP2A 4QWOA 3DW0A 3G34A 4IJGA 4BD0A 1GSXA 1D1JA 1BT5A 2LB5A 1NWZA 2XLNA 1L0DA 4OVDA 4ETZA 4U0XA 4WMCA 3UDXA 3OBFA 4R4RA 5FI7A 1ERMA 4KQQA 5HAQA 4X53A 4DRTA 1PIOA 4F3LB 2WGIA 2D02A 3CPTA 1GHPA 3NY4A 4FH2A 1W63M 4DN0A 2INWA 5L07A 3Q82A 1EROA 1XA7A 3TW8A 3HJIA 1K54C 1FCOA 2QWSA 5GLBA 4K91A 3UPOA 4HJ3A 3FPWA 4KENB 5DF7A 5HX9A 3SS5A 5CGWA 3T1SA 4HBTA 3MQQA 1L0FA 4JXVA 3CLOA 3KSFA 1YLJA 4EU0A 2EA9A 1IYOA 1NYMA 3FPVA 1ESUA 4H8RA 2Y2GA 2Y55A 1GHIA 3VOZA 3MF0A 3V3SA 3ZFZA 2PD7A 2V0WA 3CAXA 3UPNA 3M6HA 1Y4OA 5CX7A 1SDEA 5GLCA 5AJGA 4O0PA 2PRFA 3BJNA 1YLYA 2H0TA 4GD8A 4R0QA 1GA0A 2VGKA 5IHVA 1KE0A 2M7UA 2PAVP 3WS1A 4E3KA 3ZG0A 1ZTUA 4MBFA 3NOPC 3FKVA 4R3BA 3CG5A 4DXBA 4DKIA 2VEAA 5CHJA 3IX4A 3OPLA 4OOLA 2QYBA 4YNRA 1K4FA 3LY4A 1NLZA 4E3JA 2W0NA 2L1MA 4X25A 4QY6A 4WZ4A 2JKFA 3GTCA 2V20A 3UPPA 2WKRA 4AFIA 1LSXA 3P7NA 4WYYA 1BYWA 3IWIA 1N9LA 1G6AA 4LRXC 3VFHA 2EWWA 3KSIA 1ONGA 2G2UA 1N9BA 5EPHA 5HDCA 1E3UA 2HJ9C 2QHKA 1K0KA 5CERA 1XKZA 4GCZA 3WRZA 4Z9QA 4DDSA 4OONA 4B9OA 3K3CA 3OOVA 1YLTA 4RVAA 2A24A 1ESIA 5GHXA 1TEMA 3G32A 5AQAA 5A8BA 5EV0A 4ETXA 1CI8A 3HLCA 4Q0JA 4QJGA 2MJ6A 3W4PA 1X0OA 3VFFA 4GS9A 4K0WA 2ZC6B 1RGYA 2W3FA 2Y8HA 4MEZA 1UGUA 3ZG7B 4HOIA 2P9VB 4ME4A 5HL1A 3HLEA 1BLHA 1TD5A 1PZOA 1NY0A 4DJ3A 3LR0A 3T4LA 4S2JA 4DF6A 3A3FA 2OLVA 2ZQCA 4Q0IA 5F69A 4N92A 2PT7A 5EM0A 4S2KA 4L9FA 5KSCA 5C5KA 3HBRA 4UA6A 2HP9A 2WAFA 3C30A 3T4TA 1N4OA 2XA7S 3OPPA 1ES2A 2WKPA 1AXBA 2PU2A 5A91A 5DF9A 4RA7A 5FQJA 3O88A 3V39A 3BQ8A 4I38A 4YFMA 5FASA 1K6RA 1MKMA 4GB7A 3MMHA 1W5DA 2ZQ7A 3E2KA 2H28A 3QP6A 2VZWA 1BZAA 2Y2HA 5FI2A 3R7WA 1IYQA 3DTKA 2OAP1 4S2PA 4PAUA 3TG9A 1ONHA 3A0SA
chains in the Genus database with same CATH topology
4HNBA 2XA7M 2K2NA 3NOTC 3C8CA 3FC7A 4Z1WA 3NHQA 2I9VA 4HP9A 2EWVA 1T19A 3RFBA 3CITA 5DKKA 4R70A 4KQDA 1P97A 4CLCD 2WKQA 1P0ZA 2O9AA 1OJGA 2Z6CA 5HPFA 1OTAA 3HJKA 3MQOA 2W1TB 2FH5A 2VKSA 4NEED 3JVUA 5DKLA 2P08A 3E98A 1DP6A 2V9AA 3UB7A 1D7EA 5AVEA 4MN7A 3K2NA 4GW9A 1S66L 2HV1A 1XJ3A 2P04A 4Y3IA 3D3OA 4CLCA 3S7NA 1P9WA 3H82B 4GHIA 2JKRM 5L8MA 2J3TD 2IA2A 4L0LA 2L4RA 4LLOB 2ZBBA 3BQAA 1LL8A 5KIZA 4WUJA 4XT2B 4KUOA 3C2WA 3TE8A 4FOFA 2KDKA 2ZMVA 4GHIB 4YWZA 1IOUA 3T4QA 3B42A 2M7VA 3BY9A 2O9CA 3B47A 1XJ4A 3LR4A 4JGPA 2QKPA 4G3VA 4CLCE 1XFNA 3LIBA 3EOIA 4O8GA 3C38A 3LR3A 4UEYA 4LPZA 3IBRA 4QPRA 1OTDA 3ULFA 2VX8A 1OT6A 3LIDA 5I5LA 2YKHA 3PHYA 5TBMB 1G6OA 2J80A 5TJJA 1S1YA 4NXEA 2PD8A 4BBUA 3F1OB 4L9GA 4EEPA 4HH2A 1NRJA 3K3DA 4KUKA 2KLIA 3UMDA 1YAXA 2PYRA 4NXFA 1S67L 3NJAA 4Y5FA 4MN5A 2D01A 1OTIA 1OPXA 1T1BA 1S1ZA 1H8MA 3NOUC 1GSVA 1S4SA 3RTYA 4GLQA 4EQ1A 5F6AA 3H9WA 2YKFA 1S4RA 3GECA 4OOMA 1XJ2A 5HWVA 2ZOIA 2O9BA 4IUKA 5EFWA 3MQ0A 2VV7A 5IT5A 3LIFA 3PYPA 2OOLA 3H7WA 1T1CA 5HWTA 4HJ6A 2QJ5A 2OWHA 3BWLA 3E0YA 3KX0X 3PBSA 3VV4A 2JKTI 3PBRA 4UQIS 4LRZE 2OAQ1 2JKRI 1NLYA 2V1BA 3OCLA 3S7QA 3PBTA 4RQ9A 4BBTA 2JN7A 5F68A 3S7PA 2JHEA 3CUEA 3OLOA 3LICA 3UB8A 2ZMFA 2O0YA 3KO6A 4LRYC 2G7UA 3UB6A 4PKYG 3VOLA 1OJ5A 4BWIA 2VA0A 1LSWA 2P7JA 1ODVA 2W3DA 2GJ3A 2GZAA 2W1TA 4P6ZS 4JGOA 4H6JB 3VE3A 4HHDA 1EW0A 4BMWA 3UB9A 3FG8A 2KX6A 2L0WA 1W63Q 2VLGA 4UQIM 1YSQA 3KSGA 2VGLS 4HH3A 3H82A 3O5YA 3A0RA 4CLCC 4K08A 4I39A 4EXOA 2W3EA 2XROA 5DFXA 4WELA 5J3WA 4XT2A 4NKPA 4WF0A 1P9RA 4IJGA 4DJ2A 2NUPC 1TS0A 3E4PA 3PBQA 1GSXA 3PXPA 2LB5A 1NWZA 4ETZA 1V9ZA 2XRNA 3OBFA 3T50A 3KSHA 4O01A 2J3TC 3CWFA 4EW7A 5F5YA 4F3LB 3MXQA 2D02A 2PHYA 2VGLM 2BASA 4WL9A 3LIEA 5FL3A 3W2ZA 5TBMA 5K5BA 1W63M 4DN0A 2INWA 2Z6DA 3F1OA 4YOFA 4ZRRA 4BJPA 3TW8A 2A24B 2R78A 4E04A 3HJIA 4NXGA 4I3AA 2QWSA 3BY8A 2KOIA 1XJ6A 4HJ3A 3FPWA 3PBNA 3MJQA 1XFQA 1OT9A 3ZYTA 1WA9A 3CI6A 3MQQA 4CQHA 4PHTA 3CLOA 3KSFA 4EU0A 1DP9A 2EA9A 4EUVA 2W3GA 5J4EA 3F1PB 4L9EA 3FPVA 3U2AA 5IU1A 4MCWA 5AVFA 3LR5A 3MF0A 3OC2A 5DJTA 2PD7A 2V0WA 3CAXA 3EGXC 2V0UA 4DMZA 1LSVA 5HWWA 5MC7A 3F1NB 2W1RA 3GDIA 1YKDA 4MDZA 2HJEA 5CX7A 2OWJA 3E4QA 3DBAA 3EQUA 3ICYA 4R6LA 1KOUA 3ZQ5A 3RH8B 5AJGA 2A2LA 4O0PA 4I5SA 3BJNA 4HP4A 1F5MA 3HCYA 3CUEC 5HD5A 1UWNX 2M7UA 1MC0A 5HDSA 4H6JA 3G6OA 3EEAA 1UWPX 1ZTUA 2O99A 5DJUA 3IS2B 1G28A 3NOPC 4BBVA 4HI4A 3LUQA 2PR5A 4Y2FA 4EERA 1F98A 1ZHHB 2VEAA 4I3JA 2W27A 2W3HA 4IUHA 4OOLA 2QYBA 2ZOHA 4YNRA 1NLZA 3S7OA 2W0NA 2FZ0A 1MZUA 3UE6A 2L1MA 1TS6A 4EESA 4R38A 3A0VA 4WEKA 4WEJA 1TS8A 4ARZB 4B93A 1N9OA 1STZA 3LIAA 5IS1A 1OTEA 3R7WB 2WKRA 4AFIA 1LSXA 2GNXA 3P7NA 4GJ4A 1BYWA 4KQOA 1N9LA 3MFXA 4HIAA 2M1CA 4NXBA 1F9IA 4LRXC 2EWWA 3KSIA 2XSSA 5HDCA 2HJ9C 2QHKA 3E4OA 4F3LA 2QJ7A 4P6ZM 1T18A 3EEHA 3EQVA 4GCZA 2HGVA 5HL6A 2J3WA 3BW6A 2B02A 3PR6A 4B9OA 3K3CA 3OOVA 1TS7A 4PKYA 1DRMA 3TRCA 4G3KA 1N9NA 2A24A 2JKTM 5HZHA 4MMNA 3KYZA 4EEUA 1VB6A 5A8BA 1V9YA 4ETXA 2GX5A 4EETB 5G4YA 3VE4A 3LI9A 1GSWA 4Q0JA 2MJ6A 5J7EA 1X0OA 4CLCB 3SW1A 4GS9A 4WLAA 3B33A 4HQAA 2W3FA 2Y8HA 4MN6A 4I3IA 3F1PA 2V1AA 1UGUA 2CMNA 1D06A 4HOIA 3LFVA 3V67A 4M4XA 2K7SA 5HDDA 3UMEA 4ME4A 5DFYA 4GS9B 1TD5A 3PBOA 2DMWA 2K31A 3T4OA 4DJ3A 5HSQA 3LR0A 4HY8A 4G3WA 4IHQA 3T4LA 2VJWA 1H3QA 1OTBA 3F1NA 3LYXA 3OCNA 4Q0IA 5F69A 5KSHA 1DP8A 1T1AA 2PT7A 4JGRA 4R3AA 2B18A 2VV6A 1VHMA 2HF6A 4L9FA 3T4KA 3MR0A 2NUTC 5C5KA 2LB9A 2PR6A 2VV8A 3C30A 2PYPA 4FSFA 3T4TA 4HJ4A 1TF1A 4WN5A 1LT0A 2XA7S 4II7A 2WKPA 3IS2A 3UE3A 1YSPA 5DF9A 2PDRA 1Y28A 4JGQA 3D72A 3TJZC 3BQ8A 4Q0HA 4I38A 3EGDC 3KYQA 1MKMA 1JNUA 3T4SA 3MMHA 3JVVA 3LI8A 3IBJA 2H28A 4ARZA 5G4ZA 3H7WB 2VZWA 3P01A 3T4JA 3R7WA 1IFQA 2Y79A 5LBRA 2OAP1 4PAUA 5HD3A 3R4KA 3A0SA 3EWKA 5HPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P6Z M;  2VGL S;  2XA7 M;  3TJZ C;  2HF6 A;  5MC7 A;  1NRJ A;  2JKT M;  2VGL M;  4P6Z S;  2JKT I;  1W63 M;  4UQI S;  2JKR M;  2JKR I;  2XA7 S;  1W63 Q;  4UQI M;  2FH5 A;  4NEE D; 
#chains in the Genus database with same CATH topology
 1E4D A;  4BD1 A;  2K2N A;  5CRF A;  3IHB A;  2IWB A;  5GLD A;  4Z1W A;  3NHQ A;  2I9V A;  4HP9 A;  5E2F A;  5EVI A;  3HLW A;  5F83 A;  3UDI A;  2ZMA A;  4OP5 A;  5E43 A;  5HPF A;  1OTA A;  3ZHH A;  3E98 A;  1DP6 A;  5HW3 A;  4JLF A;  3SOI A;  1NZO A;  1D7E A;  1H5X A;  2BTF P;  3BLS A;  5KZH A;  5L2F A;  3K2N A;  1XJ3 A;  2JCH A;  2HDQ A;  5M18 A;  5KIZ A;  3TE8 A;  2KDK A;  2ZMV A;  3ISG A;  4GHI B;  2GDN A;  3AGE A;  3T4Q A;  2M7V A;  3BY9 A;  2O9C A;  3B47 A;  1XJ4 A;  4JGP A;  5HAI A;  4CLC E;  3LIB A;  1BUL A;  4O8G A;  5A92 A;  3CMZ A;  3E2L A;  3M2J A;  4LPZ A;  4QPR A;  3ULF A;  1W79 A;  2ZC4 B;  3CPT B;  3HUO A;  2YKH A;  1G6O A;  2J80 A;  1MWT A;  2H5S A;  2XH9 A;  4NXE A;  2PD8 A;  4EEP A;  3VP1 A;  1G68 A;  4DDY A;  4DXC A;  3Q7Z A;  3HUN A;  1OTI A;  3ZG9 B;  3NOU C;  1H8M A;  1VEU A;  2EFX A;  2R9X A;  3ZG5 A;  2Y2J A;  5F6A A;  2YKF A;  3NC8 A;  1S4R A;  1TDG A;  5CXW A;  4OOM A;  3PYP A;  1T1C A;  3RJU A;  2QPN A;  1H8Y A;  2JKT I;  3PBR A;  3HL9 A;  2IWD A;  4PM9 A;  2FFY A;  2ZM0 A;  1NLY A;  3U4L P;  4QY5 A;  3IF6 A;  5F68 A;  3S7P A;  5F82 A;  2JHE A;  5CEC A;  4Y13 A;  3OLO A;  3UB8 A;  4LRY C;  1SDN A;  2G7U A;  1RCJ A;  1LSW A;  1SKF A;  2P7J A;  1ODV A;  2C5W B;  4ESP A;  4P6Z S;  4ZJ1 A;  4HHD A;  1HTZ A;  1EW0 A;  3UB9 A;  5FA7 A;  2L0W A;  4Y7P A;  1FOF A;  1PI5 A;  3CHW P;  4PM8 A;  4JF4 A;  3H82 A;  3W8K A;  3SH8 A;  3O5Y A;  4S2N A;  4K08 A;  4EXO A;  2XRO A;  2Q0O A;  4OPR A;  1DY6 A;  4B4X A;  2NUP C;  3PBQ A;  1PI4 A;  1I5Q A;  1MKI A;  1KDW A;  3C7U A;  3PXP A;  1S6R A;  3VSK A;  4F94 A;  1M6K A;  1XGI A;  4NG2 A;  3T50 A;  3UN7 A;  2J3T C;  3G30 A;  5F5Y A;  1GCE A;  5CGS A;  2Y2I A;  2BAS A;  3LIE A;  4YOF A;  1WYB A;  4WBG A;  2A49 A;  3C4P A;  4BJP A;  3BEB A;  2A24 B;  2R78 A;  4X1M A;  1SHV A;  4I3A A;  3T1R A;  1ES3 A;  3BY8 A;  4JKT A;  5FQM A;  3DAV A;  1XJ6 A;  3MJQ A;  1JWV A;  3CI6 A;  2H0Y A;  4CQH A;  1SKO A;  2QZ6 A;  5FAT A;  1LI0 A;  4ZJ3 A;  1PZP A;  5IU1 A;  4MCW A;  5AVF A;  3OC2 A;  4DMZ A;  1ZKJ A;  2Y91 A;  3FZC A;  1LSV A;  3GDI A;  2QMI A;  2HJE A;  3N7W A;  3E4Q A;  3DBA A;  3UY6 A;  4R6L A;  1EWZ A;  1KOU A;  1SCW A;  3JYI A;  2A2L A;  3WS0 A;  2UWX A;  1F5M A;  3HCY A;  3RXX A;  3ITB A;  4FH4 A;  3HRE A;  3BLM A;  1MC0 A;  3G6O A;  3EEA A;  2OV5 A;  3LY3 A;  1UWP X;  3MSH A;  1G28 A;  4HI4 A;  4MNR A;  1ZC2 A;  4Y2F A;  2DNS A;  4R4S A;  2JE5 A;  4EER A;  4JBF A;  2W27 A;  2W3H A;  1FQG A;  2ZOH A;  4IBX A;  2Y2K A;  5TR7 A;  3UE6 A;  1M40 A;  5DTT A;  4EES A;  4R38 A;  3DWK A;  1NXY A;  4WEJ A;  1STZ A;  3V50 A;  5IS1 A;  3R7W B;  1VET A;  1YLP A;  2WAE A;  3FYZ A;  4HES A;  4E3N A;  3IX3 A;  3G31 A;  4NXB A;  3JPU A;  3BFE A;  4WZ5 A;  1VQQ A;  2Q9M A;  5EVI B;  1T18 A;  1IEL A;  3BW6 A;  2B02 A;  5A93 A;  4PKY A;  1DRM A;  2HDR A;  1G5U A;  2JKT M;  4JXS A;  2Y59 A;  1VB6 A;  2EFU A;  4EET B;  1OME A;  3VE4 A;  2Y2N A;  3DWZ A;  5J7E A;  4JF5 A;  2Y2L A;  3TSG A;  4HQA A;  4KZ4 A;  4MN6 A;  4I3I A;  4LFU A;  1ES5 A;  5FDS A;  3PBO A;  2K31 A;  1ERQ A;  4X68 A;  2HZ5 A;  3UO9 A;  3F1N A;  3LYX A;  1JTD A;  5KSH A;  2CC1 A;  4JGR A;  2B18 A;  1YQS A;  2VV6 A;  1MWS A;  1VHM A;  2NUT C;  5M19 A;  2VV8 A;  5CED A;  1PRQ A;  2PYP A;  4KZ9 A;  4FSF A;  1KVM A;  4IED A;  4S2I A;  4WN5 A;  3C7V A;  3IS2 A;  2PDR A;  4ID4 A;  1Y28 A;  4JGQ A;  5J8X A;  4PM7 A;  3N8L A;  3SZT A;  5AQB A;  5AQ7 A;  5FEG A;  1JNU A;  2ZL1 A;  3PAG A;  3T4S A;  3IBJ A;  2ZD8 A;  4OQI A;  3T4J A;  2Y79 A;  1FR1 A;  3IXB A;  4QU3 A;  3R4K A;  3W4Q A;  3EWK A;  5HPI A;  1Z09 A;  4HNB A;  2XA7 M;  4EBN A;  3FC7 A;  2EWV A;  3IF6 B;  2X01 A;  3CIT A;  4KQD A;  4CLC D;  2WKQ A;  3GQZ A;  4KZ3 A;  2WKI A;  3S4X A;  3T1X A;  4NEE D;  3UE0 A;  4GDB A;  3UB7 A;  3BFG A;  5AVE A;  4MN7 A;  4Y3I A;  3QP2 A;  3S7N A;  3H82 B;  1LHY A;  2JKR M;  1JVJ A;  4P85 A;  4LCL A;  2IA2 A;  4L0L A;  4LLO B;  2ZBB A;  5L10 A;  1K4E A;  1XPB A;  4PM6 A;  4WUJ A;  3C2W A;  1YM1 A;  5EVL A;  1K55 C;  3B42 A;  3D4F A;  3LEQ A;  1MBL A;  1K55 A;  5TFQ A;  4UEY A;  1YT4 A;  3IBR A;  3IX8 A;  1KDS A;  1XXM A;  3LID A;  3PHY A;  1PW1 A;  1S1Y A;  3HLF A;  4LGW A;  4HH2 A;  3A3I A;  4B88 A;  4E3I A;  2WYX A;  4OP8 A;  4NXF A;  3NJA A;  2XGN A;  2D01 A;  4XUX A;  4GLQ A;  1MPL A;  2XD5 A;  3H9W A;  4R3J A;  1SKO B;  3WRT A;  1GHM A;  3IHA A;  2Y2M A;  1Q2Q A;  4GOG A;  2VK3 A;  4OH0 A;  1PWC A;  4HJ6 A;  1K38 A;  2EX8 A;  4P6B A;  1A0K A;  3NDE A;  4BEN A;  3PBS A;  3VV4 A;  3MXS A;  2PU4 A;  4LRZ E;  2OAQ 1;  3IQA A;  2EX2 A;  3PBT A;  4GNU A;  3HLD A;  5EM1 A;  4BBT A;  2JN7 A;  3CUE A;  5EVI C;  1GA9 A;  3UDF A;  4CPK A;  2VA0 A;  3ZG8 B;  2GJ3 A;  2W1T A;  3OZH A;  1DJB A;  4JGO A;  3A3E A;  3VE3 A;  3ZVT A;  1YMS A;  4B4Z A;  4GD6 A;  1TVF A;  2B5R A;  5GLA A;  3FG8 A;  2KX6 A;  4Y0O A;  5E2G A;  3GSG A;  1YSQ A;  5FAQ A;  3MZD A;  1DJA A;  2VGL S;  4BQM A;  3A0R A;  3OPR A;  1FCN A;  4I39 A;  2W3E A;  1XP4 A;  4C3Q A;  5I94 A;  3MXR A;  4WEL A;  1VM1 A;  4QB8 A;  4XT2 A;  1MY8 A;  2WAD A;  4IVI A;  2H10 A;  1P9R A;  2ZM8 A;  4DJ2 A;  1RP5 A;  5EEC A;  3QP5 A;  2ZQ8 A;  5D3O A;  4LV1 A;  1BTL A;  2WKH A;  1V9Z A;  2XRN A;  2ZC7 A;  1PFL A;  4OQG A;  4RX2 A;  4EW7 A;  5CTN A;  1ZG6 A;  3W4O A;  3MXQ A;  2PHY A;  5FL3 A;  3W2Z A;  5K5B A;  2Y4A A;  3OPH A;  3N8S A;  3F1O A;  3SH9 A;  1BLS A;  4E04 A;  4MBK A;  4NXG A;  2KOI A;  3S22 A;  4KG2 A;  1Z6F A;  3PBN A;  3M6B A;  3ZYT A;  4BL2 A;  1FIL A;  2W3G A;  5J4E A;  2OLU A;  4L9E A;  5CHU A;  2G2W A;  1FCM A;  5FAP A;  4C6Y A;  2OSU A;  3EGX C;  2V0U A;  4KZ7 A;  1K57 A;  5HWW A;  5MC7 A;  4LCM A;  3F1N B;  2W1R A;  1YKD A;  5EOE A;  1HVB A;  3G2Y A;  2Y2P A;  1PWD A;  5FQQ A;  1JWZ A;  2OWJ A;  3EQU A;  3ICY A;  1KVL A;  3ZQ5 A;  3RH8 B;  3ZDJ A;  4Y17 A;  2E8J A;  1BLP A;  3IF6 C;  4JXG A;  3IXG A;  5HD5 A;  1UWN X;  2I72 A;  2ZJ9 A;  3CZD A;  4P87 A;  5HDS A;  4H6J A;  1O7E A;  2O99 A;  5DJU A;  3IS2 B;  5DVA A;  4OKP A;  1PYY A;  4S2M A;  1F98 A;  4I3J A;  2BLS A;  4IBR A;  5AQ9 A;  4PMA A;  5L09 A;  2ACG A;  3G2Z A;  2WZX A;  2FZ0 A;  3ZVW A;  4S2N C;  5FEF A;  4WEK A;  1TS8 A;  4B93 A;  4UHU A;  4U3T A;  4X6T A;  5E2E A;  1F9I A;  2XSS A;  1TDL A;  2QJ7 A;  3EEH A;  3HUM A;  3EQV A;  2HGV A;  2J3W A;  1TS7 A;  3MFD A;  1CJF A;  4G3K A;  1N9N A;  1I2W A;  3KYZ A;  1V9Y A;  4LEN A;  2GX5 A;  4QD4 A;  3HLG A;  1L0E A;  2HDU A;  2RCX A;  3AGF A;  3LI9 A;  1IEM A;  5JYO A;  4WLA A;  5HAP A;  3B33 A;  3F1P A;  2V1A A;  1LLB A;  1D06 A;  4Q8I A;  3V67 A;  4M4X A;  2K7S A;  5HDD A;  3UME A;  5DFY A;  4GS9 B;  3NIA A;  4EBL A;  3T4O A;  3VSL A;  4HY8 A;  1H3Q A;  1OTB A;  3OCN A;  1DP8 A;  3MS6 A;  3FWL A;  4R23 A;  5E2H A;  5EOO A;  4N1H A;  2HF6 A;  5A90 A;  2PR6 A;  4MLL A;  5CTM A;  3A3J A;  3LO7 A;  3ZCZ A;  5U47 A;  2V8C A;  1C3B A;  3ITA A;  4HJ4 A;  5TGF A;  2C6W B;  4ZAM A;  4DE2 A;  1LL5 A;  3DTI A;  3QNB A;  3GVB A;  4KG5 A;  3WWX A;  3ZGA B;  2XEP A;  2Y2O A;  5EUA A;  5FSR A;  1J3W A;  3EGD C;  3IF5 A;  3V5M A;  3JVV A;  3VP4 A;  4ARZ A;  5G4Z A;  1K56 D;  1IFQ A;  5LBR A;  3LEZ A;  3NUL A;  3NDG A;  2WGV A;  3NOT C;  4E3M A;  1W7F A;  5CGX A;  1FR6 A;  4WZ5 C;  1XX2 A;  4OPQ A;  2ZM2 A;  4R1G A;  2JC7 A;  3BFF A;  5DKK A;  1P97 A;  4E6W A;  1P0Z A;  2O9A A;  1OJG A;  4HBU A;  3MQO A;  3Q07 A;  2W1T B;  2FH5 A;  2VKS A;  3IH8 A;  3JVU A;  3MZF A;  5DKL A;  3V3R A;  2P08 A;  2WK0 A;  4MBH A;  2V9A A;  4OOY A;  1JWP A;  2V1Z A;  4GW9 A;  4CLC A;  3D3O A;  4OPY A;  4GHI A;  4UA7 A;  2J3T D;  4E3L A;  3TOI A;  1YMX A;  3VP3 A;  4XT2 B;  4Y0T A;  2X71 A;  4FOF A;  4QHC A;  1QMF A;  3GRJ A;  1SZV A;  1PW8 A;  3MKE A;  4G3V A;  3EOI A;  2V8F A;  4LV0 A;  4RX3 A;  3LR3 A;  3N6I A;  4PM5 A;  2VX8 A;  2XQZ A;  5I5L A;  4S2O A;  1L3L A;  1K54 A;  5TJJ A;  4BBU A;  3F1O B;  2J9O A;  3SH7 A;  4HEF A;  4OQH A;  1HZO A;  3K3D A;  2KLI A;  3UMD A;  2PYR A;  1PWG A;  4MN5 A;  1PNE A;  2ZQ9 A;  1T1B A;  2HP6 A;  1S4S A;  4OQ0 A;  1Y54 A;  4KQR A;  1XJ2 A;  5EFW A;  3MQ0 A;  2VV7 A;  4A5R A;  2JBF A;  5IT5 A;  5F1F A;  1VEU B;  2V2F F;  4EUZ A;  3H7W A;  1NYY A;  4PPR A;  3BRM A;  1ALQ A;  2QJ5 A;  3SS3 A;  2OWH A;  3E0Y A;  4UQI S;  1XA1 A;  3C5A A;  4M3K A;  4RYE A;  1CQA A;  4IVK A;  5FDH A;  1KGE A;  3OCL A;  3S7Q A;  1MWU A;  3PTE A;  3GR2 A;  3LIC A;  2O0Y A;  3KO6 A;  4FTX A;  3UB6 A;  1OJ5 A;  3S1Y A;  3WS4 A;  4DE3 A;  2W3D A;  1H0M A;  3O86 A;  3LCE A;  1H8Z A;  4H6J B;  2EX6 A;  1L0G A;  3IXH A;  1RGZ A;  4WM9 A;  4DE0 A;  1W63 Q;  2Z2L B;  4DE1 A;  2WZZ A;  3HLB A;  1WE4 A;  4HH3 A;  2HPB A;  3DTE A;  5FI6 A;  2RL3 A;  2ZQA A;  1NZU A;  2XD1 A;  3BYD A;  4ZTK A;  3ZNY A;  4WMC D;  5DFX A;  1U60 A;  4K0X A;  2DRW A;  4U0T A;  3NBL A;  4NKP A;  3BFC A;  4WF0 A;  4S2L A;  5HFO A;  1ZG4 A;  3NCK A;  1TS0 A;  3E4P A;  2A3U A;  4EV4 A;  3DTM A;  3Q7V A;  3KSH A;  4O01 A;  3CWF A;  1CEF A;  5GL9 A;  5G18 A;  1NRF A;  4FD8 A;  2VGL M;  4WL9 A;  3N4I A;  1W8Q A;  4N9L A;  5BOH A;  5TBM A;  1O07 A;  1BUE A;  2Z6D A;  4ZRR A;  3A3D A;  4X55 A;  2ZC5 B;  4D60 A;  3GV9 A;  1MXO A;  2XDM A;  1XFQ A;  3Q1F A;  1OT9 A;  2ZC3 B;  1WA9 A;  4PHT A;  4E6X A;  1DP9 A;  4EUV A;  1KGF A;  3F1P B;  3U2A A;  2WUQ A;  2DCF A;  2J9P A;  4JF6 A;  3LR5 A;  5DJT A;  5FQ9 A;  1HLU P;  1J9M A;  3FV7 A;  4MDZ A;  4N9K A;  1Q2P A;  4I5S A;  4UAA A;  4HP4 A;  4FCF A;  3RXW A;  3CUE C;  3MKF A;  3C4O A;  4OPZ A;  3AGD A;  4X1L A;  4D2O A;  4EBP A;  5CEB A;  4BBV A;  3LGO A;  3LUQ A;  2PR5 A;  2BG1 A;  1K25 A;  3UNW A;  1ZHH B;  3MZE A;  4IUH A;  2HP5 A;  1XGJ A;  3S7O A;  1W8Y A;  2WGW A;  1LI9 A;  1MZU A;  3M2K A;  1TS6 A;  4KZ5 A;  1E3U D;  3A0V A;  4ARZ B;  1N9O A;  2UV0 E;  3LIA A;  1OTE A;  3VOY A;  4BLM A;  5KMW A;  3T12 B;  5JYP A;  2GNX A;  4GJ4 A;  2AVX A;  2XFT A;  4KG6 A;  4KQO A;  3MFX A;  1QME A;  4HIA A;  2M1C A;  3IWO A;  5F1G A;  1VET B;  4KZA A;  1CI9 A;  3E4O A;  2PBD P;  4F3L A;  1CF0 A;  4P6Z M;  3ZNT A;  1ACF A;  4N1X A;  5HL6 A;  3PR6 A;  5FQK A;  1KE3 A;  3TRC A;  5HZH A;  2P74 A;  4MMN A;  5FAO A;  1S0W A;  4JXW A;  3T1Q B;  4EEU A;  1HD8 A;  3IT9 A;  4XXR A;  5FQI A;  1JTG A;  4UA9 A;  4NET A;  5G4Y A;  1GSW A;  4X69 A;  3IH9 A;  4CLC B;  3SW1 A;  4GN2 A;  2EXA A;  4GDN A;  5HAR A;  1I2S A;  2CMN A;  1F2K A;  3LFV A;  4CJN A;  3QHY A;  2DMW A;  3NI9 A;  3WS2 A;  5HSQ A;  3HVF A;  3P98 A;  4G3W A;  4IHQ A;  2VJW A;  4EWF A;  1K6S A;  1BSG A;  1T1A A;  1K57 C;  4R3A A;  2Z2M B;  2XR0 A;  3QP8 A;  4KZ6 A;  4XUZ A;  4GZB A;  5DF8 A;  3T4K A;  3MR0 A;  2LB9 A;  3Q81 A;  4FUW A;  1WYC A;  4OLD A;  1EI5 A;  1TF1 A;  1LT0 A;  4BL3 A;  4II7 A;  3UE3 A;  4C75 A;  1YSP A;  4ZDX A;  1FIK A;  4EQI A;  3D72 A;  2WKE A;  2FFF B;  3TJZ C;  4OLG A;  4Q0H A;  3KYQ A;  1KGG A;  1FSW A;  3QP4 A;  3IWQ A;  3LI8 A;  2Q9N A;  2B95 A;  5DTS A;  3BFD A;  5EVI D;  3O87 A;  3H7W B;  4KZ8 A;  3P01 A;  1BLC A;  5HD3 A;  1YLZ A;  2ZL1 B;  1FSY A;  4NK3 A;  2ZQD A;  3C8C A;  3GMW A;  3BEC A;  1KE4 A;  1T19 A;  3RFB A;  3P09 A;  2XK1 A;  1K56 A;  3G35 A;  4R70 A;  3WS5 A;  4O7D A;  5DTK A;  4P0M A;  2Z6C A;  3HJK A;  1CK3 A;  3UE1 A;  3UB5 P;  5M1A A;  1IKG A;  1IYP A;  4E3O A;  2EXB A;  1S66 L;  2HV1 A;  2P04 A;  1YLW A;  4ZBE A;  1P9W A;  1L2S A;  5L8M A;  1LL9 A;  2PBY A;  2E8I A;  1IYS A;  2HDS A;  4ZJ2 A;  2L4R A;  3BQA A;  2P9V A;  1LL8 A;  3IXD A;  4KUO A;  5GHY A;  1MWR A;  4YWZ A;  1IOU A;  3LR4 A;  2QKP A;  3L9K A;  4LV2 A;  1XFN A;  3B3X A;  3Q7V B;  3C38 A;  3BM6 A;  1NJ4 A;  1OTD A;  2XF3 A;  3PAE A;  1OT6 A;  1ES4 A;  2XFS A;  5TBM B;  4L9G A;  1NRJ A;  3QP1 A;  4KUK A;  2X02 A;  3QNC A;  5CHM A;  1YAX A;  2J8Y A;  1S67 L;  4Y5F A;  5EVE A;  3N8R A;  3FKW A;  1OPX A;  1S1Z A;  1GSV A;  3RTY A;  4EQ1 A;  2VGJ A;  3GEC A;  5HWV A;  2ZOI A;  2O9B A;  2R9W A;  4IUK A;  3LIF A;  3VP0 A;  2OOL A;  5HWT A;  3BWL A;  1E25 A;  3KX0 X;  1CEG A;  1YPR A;  3MBZ A;  4X56 A;  4Y0U A;  2JKR I;  2ZLY A;  2V1B A;  1DJC A;  4RQ9 A;  4JPM A;  4Y15 A;  2JKG A;  1IKI A;  4KZB A;  2ZMF A;  3NEC A;  5EE8 A;  3VOL A;  4PKY G;  2EX9 A;  3G4P A;  2Y2Q A;  4BWI A;  3I7J A;  3CJM A;  2GZA A;  2IWC A;  3SS4 A;  3O3V A;  4BMW A;  5GHZ A;  3D9Y A;  2VLG A;  4UQI M;  3KYE A;  3VMA A;  4YIN A;  3L7H A;  3KSG A;  4LV3 A;  4CLC C;  1AWI A;  2WGW B;  5J3W A;  4GKU A;  2J7V A;  3VP2 A;  4QWO A;  3DW0 A;  3G34 A;  4IJG A;  4BD0 A;  1GSX A;  1D1J A;  1BT5 A;  2LB5 A;  1NWZ A;  2XLN A;  1L0D A;  4OVD A;  4ETZ A;  4U0X A;  4WMC A;  3UDX A;  3OBF A;  4R4R A;  5FI7 A;  1ERM A;  4KQQ A;  5HAQ A;  4X53 A;  4DRT A;  1PIO A;  4F3L B;  2WGI A;  2D02 A;  3CPT A;  1GHP A;  3NY4 A;  4FH2 A;  1W63 M;  4DN0 A;  2INW A;  5L07 A;  3Q82 A;  1ERO A;  1XA7 A;  3TW8 A;  3HJI A;  1K54 C;  1FCO A;  2QWS A;  5GLB A;  4K91 A;  3UPO A;  4HJ3 A;  3FPW A;  4KEN B;  5DF7 A;  5HX9 A;  3SS5 A;  5CGW A;  3T1S A;  4HBT A;  3MQQ A;  1L0F A;  4JXV A;  3CLO A;  3KSF A;  1YLJ A;  4EU0 A;  2EA9 A;  1IYO A;  1NYM A;  3FPV A;  1ESU A;  4H8R A;  2Y2G A;  2Y55 A;  1GHI A;  3VOZ A;  3MF0 A;  3V3S A;  3ZFZ A;  2PD7 A;  2V0W A;  3CAX A;  3UPN A;  3M6H A;  1Y4O A;  5CX7 A;  1SDE A;  5GLC A;  5AJG A;  4O0P A;  2PRF A;  3BJN A;  1YLY A;  2H0T A;  4GD8 A;  4R0Q A;  1GA0 A;  2VGK A;  5IHV A;  1KE0 A;  2M7U A;  2PAV P;  3WS1 A;  4E3K A;  3ZG0 A;  1ZTU A;  4MBF A;  3NOP C;  3FKV A;  4R3B A;  3CG5 A;  4DXB A;  4DKI A;  2VEA A;  5CHJ A;  3IX4 A;  3OPL A;  4OOL A;  2QYB A;  4YNR A;  1K4F A;  3LY4 A;  1NLZ A;  4E3J A;  2W0N A;  2L1M A;  4X25 A;  4QY6 A;  4WZ4 A;  2JKF A;  3GTC A;  2V20 A;  3UPP A;  2WKR A;  4AFI A;  1LSX A;  3P7N A;  4WYY A;  1BYW A;  3IWI A;  1N9L A;  1G6A A;  4LRX C;  3VFH A;  2EWW A;  3KSI A;  1ONG A;  2G2U A;  1N9B A;  5EPH A;  5HDC A;  1E3U A;  2HJ9 C;  2QHK A;  1K0K A;  5CER A;  1XKZ A;  4GCZ A;  3WRZ A;  4Z9Q A;  4DDS A;  4OON A;  4B9O A;  3K3C A;  3OOV A;  1YLT A;  4RVA A;  2A24 A;  1ESI A;  5GHX A;  1TEM A;  3G32 A;  5AQA A;  5A8B A;  5EV0 A;  4ETX A;  1CI8 A;  3HLC A;  4Q0J A;  4QJG A;  2MJ6 A;  3W4P A;  1X0O A;  3VFF A;  4GS9 A;  4K0W A;  2ZC6 B;  1RGY A;  2W3F A;  2Y8H A;  4MEZ A;  1UGU A;  3ZG7 B;  4HOI A;  2P9V B;  4ME4 A;  5HL1 A;  3HLE A;  1BLH A;  1TD5 A;  1PZO A;  1NY0 A;  4DJ3 A;  3LR0 A;  3T4L A;  4S2J A;  4DF6 A;  3A3F A;  2OLV A;  2ZQC A;  4Q0I A;  5F69 A;  4N92 A;  2PT7 A;  5EM0 A;  4S2K A;  4L9F A;  5KSC A;  5C5K A;  3HBR A;  4UA6 A;  2HP9 A;  2WAF A;  3C30 A;  3T4T A;  1N4O A;  2XA7 S;  3OPP A;  1ES2 A;  2WKP A;  1AXB A;  2PU2 A;  5A91 A;  5DF9 A;  4RA7 A;  5FQJ A;  3O88 A;  3V39 A;  3BQ8 A;  4I38 A;  4YFM A;  5FAS A;  1K6R A;  1MKM A;  4GB7 A;  3MMH A;  1W5D A;  2ZQ7 A;  3E2K A;  2H28 A;  3QP6 A;  2VZW A;  1BZA A;  2Y2H A;  5FI2 A;  3R7W A;  1IYQ A;  3DTK A;  2OAP 1;  4S2P A;  4PAU A;  3TG9 A;  1ONH A;  3A0S A; 
#chains in the Genus database with same CATH homology
 4HNB A;  2XA7 M;  2K2N A;  3NOT C;  3C8C A;  3FC7 A;  4Z1W A;  3NHQ A;  2I9V A;  4HP9 A;  2EWV A;  1T19 A;  3RFB A;  3CIT A;  5DKK A;  4R70 A;  4KQD A;  1P97 A;  4CLC D;  2WKQ A;  1P0Z A;  2O9A A;  1OJG A;  2Z6C A;  5HPF A;  1OTA A;  3HJK A;  3MQO A;  2W1T B;  2FH5 A;  2VKS A;  4NEE D;  3JVU A;  5DKL A;  2P08 A;  3E98 A;  1DP6 A;  2V9A A;  3UB7 A;  1D7E A;  5AVE A;  4MN7 A;  3K2N A;  4GW9 A;  1S66 L;  2HV1 A;  1XJ3 A;  2P04 A;  4Y3I A;  3D3O A;  4CLC A;  3S7N A;  1P9W A;  3H82 B;  4GHI A;  2JKR M;  5L8M A;  2J3T D;  2IA2 A;  4L0L A;  2L4R A;  4LLO B;  2ZBB A;  3BQA A;  1LL8 A;  5KIZ A;  4WUJ A;  4XT2 B;  4KUO A;  3C2W A;  3TE8 A;  4FOF A;  2KDK A;  2ZMV A;  4GHI B;  4YWZ A;  1IOU A;  3T4Q A;  3B42 A;  2M7V A;  3BY9 A;  2O9C A;  3B47 A;  1XJ4 A;  3LR4 A;  4JGP A;  2QKP A;  4G3V A;  4CLC E;  1XFN A;  3LIB A;  3EOI A;  4O8G A;  3C38 A;  3LR3 A;  4UEY A;  4LPZ A;  3IBR A;  4QPR A;  1OTD A;  3ULF A;  2VX8 A;  1OT6 A;  3LID A;  5I5L A;  2YKH A;  3PHY A;  5TBM B;  1G6O A;  2J80 A;  5TJJ A;  1S1Y A;  4NXE A;  2PD8 A;  4BBU A;  3F1O B;  4L9G A;  4EEP A;  4HH2 A;  1NRJ A;  3K3D A;  4KUK A;  2KLI A;  3UMD A;  1YAX A;  2PYR A;  4NXF A;  1S67 L;  3NJA A;  4Y5F A;  4MN5 A;  2D01 A;  1OTI A;  1OPX A;  1T1B A;  1S1Z A;  1H8M A;  3NOU C;  1GSV A;  1S4S A;  3RTY A;  4GLQ A;  4EQ1 A;  5F6A A;  3H9W A;  2YKF A;  1S4R A;  3GEC A;  4OOM A;  1XJ2 A;  5HWV A;  2ZOI A;  2O9B A;  4IUK A;  5EFW A;  3MQ0 A;  2VV7 A;  5IT5 A;  3LIF A;  3PYP A;  2OOL A;  3H7W A;  1T1C A;  5HWT A;  4HJ6 A;  2QJ5 A;  2OWH A;  3BWL A;  3E0Y A;  3KX0 X;  3PBS A;  3VV4 A;  2JKT I;  3PBR A;  4UQI S;  4LRZ E;  2OAQ 1;  2JKR I;  1NLY A;  2V1B A;  3OCL A;  3S7Q A;  3PBT A;  4RQ9 A;  4BBT A;  2JN7 A;  5F68 A;  3S7P A;  2JHE A;  3CUE A;  3OLO A;  3LIC A;  3UB8 A;  2ZMF A;  2O0Y A;  3KO6 A;  4LRY C;  2G7U A;  3UB6 A;  4PKY G;  3VOL A;  1OJ5 A;  4BWI A;  2VA0 A;  1LSW A;  2P7J A;  1ODV A;  2W3D A;  2GJ3 A;  2GZA A;  2W1T A;  4P6Z S;  4JGO A;  4H6J B;  3VE3 A;  4HHD A;  1EW0 A;  4BMW A;  3UB9 A;  3FG8 A;  2KX6 A;  2L0W A;  1W63 Q;  2VLG A;  4UQI M;  1YSQ A;  3KSG A;  2VGL S;  4HH3 A;  3H82 A;  3O5Y A;  3A0R A;  4CLC C;  4K08 A;  4I39 A;  4EXO A;  2W3E A;  2XRO A;  5DFX A;  4WEL A;  5J3W A;  4XT2 A;  4NKP A;  4WF0 A;  1P9R A;  4IJG A;  4DJ2 A;  2NUP C;  1TS0 A;  3E4P A;  3PBQ A;  1GSX A;  3PXP A;  2LB5 A;  1NWZ A;  4ETZ A;  1V9Z A;  2XRN A;  3OBF A;  3T50 A;  3KSH A;  4O01 A;  2J3T C;  3CWF A;  4EW7 A;  5F5Y A;  4F3L B;  3MXQ A;  2D02 A;  2PHY A;  2VGL M;  2BAS A;  4WL9 A;  3LIE A;  5FL3 A;  3W2Z A;  5TBM A;  5K5B A;  1W63 M;  4DN0 A;  2INW A;  2Z6D A;  3F1O A;  4YOF A;  4ZRR A;  4BJP A;  3TW8 A;  2A24 B;  2R78 A;  4E04 A;  3HJI A;  4NXG A;  4I3A A;  2QWS A;  3BY8 A;  2KOI A;  1XJ6 A;  4HJ3 A;  3FPW A;  3PBN A;  3MJQ A;  1XFQ A;  1OT9 A;  3ZYT A;  1WA9 A;  3CI6 A;  3MQQ A;  4CQH A;  4PHT A;  3CLO A;  3KSF A;  4EU0 A;  1DP9 A;  2EA9 A;  4EUV A;  2W3G A;  5J4E A;  3F1P B;  4L9E A;  3FPV A;  3U2A A;  5IU1 A;  4MCW A;  5AVF A;  3LR5 A;  3MF0 A;  3OC2 A;  5DJT A;  2PD7 A;  2V0W A;  3CAX A;  3EGX C;  2V0U A;  4DMZ A;  1LSV A;  5HWW A;  5MC7 A;  3F1N B;  2W1R A;  3GDI A;  1YKD A;  4MDZ A;  2HJE A;  5CX7 A;  2OWJ A;  3E4Q A;  3DBA A;  3EQU A;  3ICY A;  4R6L A;  1KOU A;  3ZQ5 A;  3RH8 B;  5AJG A;  2A2L A;  4O0P A;  4I5S A;  3BJN A;  4HP4 A;  1F5M A;  3HCY A;  3CUE C;  5HD5 A;  1UWN X;  2M7U A;  1MC0 A;  5HDS A;  4H6J A;  3G6O A;  3EEA A;  1UWP X;  1ZTU A;  2O99 A;  5DJU A;  3IS2 B;  1G28 A;  3NOP C;  4BBV A;  4HI4 A;  3LUQ A;  2PR5 A;  4Y2F A;  4EER A;  1F98 A;  1ZHH B;  2VEA A;  4I3J A;  2W27 A;  2W3H A;  4IUH A;  4OOL A;  2QYB A;  2ZOH A;  4YNR A;  1NLZ A;  3S7O A;  2W0N A;  2FZ0 A;  1MZU A;  3UE6 A;  2L1M A;  1TS6 A;  4EES A;  4R38 A;  3A0V A;  4WEK A;  4WEJ A;  1TS8 A;  4ARZ B;  4B93 A;  1N9O A;  1STZ A;  3LIA A;  5IS1 A;  1OTE A;  3R7W B;  2WKR A;  4AFI A;  1LSX A;  2GNX A;  3P7N A;  4GJ4 A;  1BYW A;  4KQO A;  1N9L A;  3MFX A;  4HIA A;  2M1C A;  4NXB A;  1F9I A;  4LRX C;  2EWW A;  3KSI A;  2XSS A;  5HDC A;  2HJ9 C;  2QHK A;  3E4O A;  4F3L A;  2QJ7 A;  4P6Z M;  1T18 A;  3EEH A;  3EQV A;  4GCZ A;  2HGV A;  5HL6 A;  2J3W A;  3BW6 A;  2B02 A;  3PR6 A;  4B9O A;  3K3C A;  3OOV A;  1TS7 A;  4PKY A;  1DRM A;  3TRC A;  4G3K A;  1N9N A;  2A24 A;  2JKT M;  5HZH A;  4MMN A;  3KYZ A;  4EEU A;  1VB6 A;  5A8B A;  1V9Y A;  4ETX A;  2GX5 A;  4EET B;  5G4Y A;  3VE4 A;  3LI9 A;  1GSW A;  4Q0J A;  2MJ6 A;  5J7E A;  1X0O A;  4CLC B;  3SW1 A;  4GS9 A;  4WLA A;  3B33 A;  4HQA A;  2W3F A;  2Y8H A;  4MN6 A;  4I3I A;  3F1P A;  2V1A A;  1UGU A;  2CMN A;  1D06 A;  4HOI A;  3LFV A;  3V67 A;  4M4X A;  2K7S A;  5HDD A;  3UME A;  4ME4 A;  5DFY A;  4GS9 B;  1TD5 A;  3PBO A;  2DMW A;  2K31 A;  3T4O A;  4DJ3 A;  5HSQ A;  3LR0 A;  4HY8 A;  4G3W A;  4IHQ A;  3T4L A;  2VJW A;  1H3Q A;  1OTB A;  3F1N A;  3LYX A;  3OCN A;  4Q0I A;  5F69 A;  5KSH A;  1DP8 A;  1T1A A;  2PT7 A;  4JGR A;  4R3A A;  2B18 A;  2VV6 A;  1VHM A;  2HF6 A;  4L9F A;  3T4K A;  3MR0 A;  2NUT C;  5C5K A;  2LB9 A;  2PR6 A;  2VV8 A;  3C30 A;  2PYP A;  4FSF A;  3T4T A;  4HJ4 A;  1TF1 A;  4WN5 A;  1LT0 A;  2XA7 S;  4II7 A;  2WKP A;  3IS2 A;  3UE3 A;  1YSP A;  5DF9 A;  2PDR A;  1Y28 A;  4JGQ A;  3D72 A;  3TJZ C;  3BQ8 A;  4Q0H A;  4I38 A;  3EGD C;  3KYQ A;  1MKM A;  1JNU A;  3T4S A;  3MMH A;  3JVV A;  3LI8 A;  3IBJ A;  2H28 A;  4ARZ A;  5G4Z A;  3H7W B;  2VZW A;  3P01 A;  3T4J A;  3R7W A;  1IFQ A;  2Y79 A;  5LBR A;  2OAP 1;  4PAU A;  5HD3 A;  3R4K A;  3A0S A;  3EWK A;  5HPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...