2JKRI

Ap2 clathrin adaptor core with dileucine peptide rm(phosphos)qikrllse
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
142
structure length
142
Chain Sequence
b'MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP-2 COMPLEX SUBUNIT ALPHA-2
publication title A Structural Explanation for the Binding of Endocytic Dileucine Motifs by the Ap2 Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 45
structure length 142
sequence length 142
chains with identical sequence S
ec nomenclature
pdb deposition date 2008-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2jkrI00
2JKRI 2JKTI 1W63M 3TJZC 1NRJA 2XA7M 2VGLM 2FH5A 4UQIM 2JKRM 2XA7S 2VGLS 4P6ZM 4UQIS 1W63Q 2JKTM 4NEED 4P6ZS 5MC7A 2HF6A
chains in the Genus database with same CATH superfamily
5KSHA 3PBSA 3K3CA 4LV0A 2ZC7A 4LPZA 5A93A 4LCLA 2XK1A 2VGKA 5EPHA 3LIDA 4I3JA 2P9VA 2Y2NA 3CPTA 1K6RA 2O9BA 2OLUA 2VKSA 1I5QA 1K4FA 2W0NA 3BM6A 1A0KA 2EWVA 1VEUA 3CJMA 5G4YA 2PAVP 5EM0A 5A8BA 1S0WA 3H9WA 2NUTC 3OPHA 5DF8A 3MBZA 4IVKA 3N6IA 3UNWA 4K0XA 2J8YA 1K57A 5L09A 4PAUA 3E2LA 3F1PA 4D60A 4LLOB 2A3UA 1YLYA 4FD8A 4KQRA 3IX4A 5M19A 2PHYA 4ZBEA 2W3GA 5DKKA 1K54C 1ONHA 3T4KA 3UE3A 2O9CA 3C5AA 4BBTA 4QB8A 3GDIA 4I38A 3LY3A 2HP6A 3EGDC 1S1YA 3ZDJA 5HAQA 2V9AA 1G28A 3O3VA 3T4JA 4EETB 1GSVA 3QP4A 1YQSA 1FSWA 1IYPA 1LSWA 4MN6A 4C75A 5L2FA 4E3OA 3KSGA 3QP6A 3EQVA 3DAVA 5EV0A 5F1FA 3CI6A 3VV4A 3SW1A 1E3UA 5FQ9A 5FAQA 3M2KA 1N9OA 3VSLA 3MQ0A 4PKYG 4S2LA 4EEPA 2EX6A 5J4EA 5DTTA 2L4RA 3E98A 4PM8A 5JYPA 1MZUA 3KSHA 4CLCA 1GA9A 4JXWA 2JKTI 3NOUC 1PI4A 2WK0A 3NJAA 2H5SA 2HP9A 4MLLA 2WKIA 3W4QA 5HSQA 2ZJ9A 5GLDA 4E3LA 4PM5A 2XR0A 3IH8A 4PHTA 2NUPC 1BULA 2M1CA 2WKEA 3VOZA 3DW0A 4O0PA 2K31A 1C3BA 2HF6A 4II7A 2PU4A 2B95A 1PZOA 4XUZA 2PRFA 3IHBA 3A3IA 4S2OA 5AJGA 1YLJA 1W63M 3T50A 2UWXA 4KZ6A 4GS9A 3C30A 3MZDA 3BFEA 1S4SA 4DDSA 3GTCA 1MWUA 4JGRA 2ZOIA 2QJ5A 4CPKA 1KVMA 1TS6A 3P09A 1T1CA 4KZAA 1ES4A 1IFQA 3MR0A 1CEFA 3T4OA 3UO9A 5DF9A 2WUQA 4GHIB 1H8YA 2EX8A 2FFFB 3FV7A 5J3WA 3WS1A 3IQAA 2ZM8A 2H0TA 1Q2QA 2JC7A 3G32A 4FSFA 1BLPA 2UV0E 4X1LA 2XF3A 1IKIA 2V20A 2O9AA 3BLMA 1EI5A 3SOIA 1XA1A 4KENB 2ZQDA 4X6TA 4BD1A 2EX9A 4RX3A 5A92A 4RVAA 3Q7VB 2WZZA 4QD4A 2PDRA 3IS2A 3KSIA 3OLOA 4XXRA 1NY0A 5CHJA 3F1OA 3G30A 1YMSA 4GW9A 2VV6A 4BQMA 2XEPA 4P87A 4WLAA 4EUVA 5EOEA 2QYBA 1IELA 4P0MA 4CJNA 1OTAA 2PYRA 4YNRA 5DTKA 3IT9A 1N9LA 4WEKA 4KZ8A 1W7FA 4DMZA 3U4LP 3LY4A 4NXFA 1Z6FA 3LEZA 1BTLA 3S7NA 1VETA 3VE4A 5EUAA 4JGQA 1FR6A 1DP8A 4PM9A 1SCWA 3KX0X 3VP4A 2WKQA 1VHMA 4Z1WA 3PTEA 1LL9A 5FQKA 1DJBA 3W4OA 5J8XA 4C6YA 3DWZA 5KIZA 3EWKA 3LUQA 2VGJA 3H7WA 4K91A 2CMNA 2XSSA 1W63Q 4QY6A 3BY8A 5HDSA 2FFYA 2VA0A 2W1RA 4QY5A 1K56A 5HW3A 3HVFA 1BUEA 2HV1A 5FI6A 5BOHA 4QU3A 4ARZB 3TJZC 5DFXA 1W5DA 2M7VA 2OAP1 4KZ7A 2R9XA 1PW8A 2HJEA 1BZAA 3G35A 4CLCE 5FSRA 3UB5P 2A2LA 5HZHA 3N8LA 4CQHA 1S67L 2W3DA 2VK3A 2EWWA 2XD5A 5I5LA 1PZPA 1L0GA 5L8MA 3IX3A 1FIKA 5EVEA 3BEBA 1JNUA 3S7QA 1FCMA 1TD5A 4K08A 5TJJA 5AQ9A 4E3JA 1TDLA 3QNCA 2HP5A 3UPPA 1ESUA 3LR3A 1XJ3A 2G2UA 2IWDA 1T1BA 2C5WB 4GZBA 1K54A 4JF4A 3LEQA 3HJIA 4ZJ3A 1TDGA 5G18A 4JKTA 4WF0A 1MPLA 1CEGA 1FCNA 2ZC3B 4R4SA 4Z9QA 5EECA 2JBFA 4EERA 3LR0A 2JN7A 3UDIA 4QJGA 4Y13A 4BL3A 3W8KA 2J3WA 4R23A 4WELA 3MKFA 2E8IA 3AGDA 1ES5A 5E2HA 2B02A 1CQAA 2J80A 2Y4AA 4IJGA 5DKLA 4GOGA 3V50A 4HQAA 4OOYA 3HLDA 5TBMA 2WGWA 3MXRA 2DCFA 5HDCA 1WA9A 2WAFA 4GDBA 3G4PA 4U3TA 1H8ZA 4A5RA 3FPWA 3QHYA 4HJ3A 2V8CA 3A3EA 4GCZA 5L07A 4LRXC 1N4OA 4G3KA 1IYOA 3I7JA 1YSQA 3R4KA 2XRNA 2PD7A 3UPNA 3Q7ZA 3DTKA 5FEFA 5AQ7A 3Q07A 1VQQA 2LB5A 3ICYA 1DRMA 4OLGA 4L9EA 2HDSA 3HLGA 3V3RA 3QP5A 1WE4A 4OP5A 4BJPA 1EROA 3C4PA 4DJ2A 4EEUA 3MZEA 5FASA 5CEBA 4JGOA 3DTIA 4DJ3A 1F98A 2HJ9C 4I5SA 4B93A 1H5XA 1XFNA 5DFYA 4EU0A 1NLZA 5FDSA 3NCKA 5GHZA 3CPTB 4FH4A 4N1XA 3C7UA 4O01A 1JWPA 3B47A 2JE5A 1OMEA 2ZQCA 3PAGA 3EGXC 2GZAA 5A91A 2D01A 1OJGA 4EW7A 2XA7S 4X69A 3OBFA 1OT6A 2ZMFA 1G6OA 4LRYC 3UY6A 1K4EA 3WS0A 5HD3A 4O7DA 4B88A 2XA7M 3HUOA 3IXHA 3LR5A 2Y2OA 4KQDA 5GLBA 5CHUA 2V1ZA 2V0UA 3HLEA 3E4OA 3HJKA 3T4LA 1KGGA 5KMWA 1L0FA 2OV5A 3V3SA 3FYZA 2J3TD 1ERMA 3S7OA 3MJQA 1X0OA 3ZHHA 4BBUA 4NXBA 5TFQA 3VE3A 1KE4A 1XGIA 3K3DA 1ALQA 3A0RA 2JKFA 3G2YA 2Z2MB 1V9YA 3VMAA 4H6JA 3KO6A 2ZC4B 1K0KA 3JVVA 1ZTUA 3UMDA 3UN7A 1YLPA 3ISGA 3ZYTA 3TRCA 4R70A 4JXVA 1LL8A 3TE8A 4GKUA 1W8QA 3HLCA 4IEDA 4L0LA 1S6RA 3LI9A 2EA9A 3RTYA 1K55C 2OSUA 5L10A 1ZKJA 4ZJ2A 4NG2A 1Y4OA 1JWZA 2HDRA 3CITA 1XXMA 3S7PA 3T1RA 1ZG6A 4GJ4A 3BQAA 1WYCA 5HL1A 5GHYA 2Y59A 2G7UA 3LO7A 3HBRA 4LV1A 3R7WB 4KZ9A 3IHAA 1NWZA 1OTBA 3KSFA 5DTSA 3UDXA 3FKVA 4GS9B 1RGZA 4L9GA 3ZG7B 1D06A 4PMAA 4B4ZA 4OVDA 4OOLA 5IT5A 3S1YA 2KOIA 4WZ5C 4UEYA 1M40A 3RXWA 1ES2A 2INWA 1PWDA 4DF6A 4WMCA 4Y3IA 3C8CA 3MZFA 1TS7A 1P0ZA 3H82B 3UPOA 3PBTA 4UA7A 3UE1A 5AVFA 1LI9A 3LI8A 3MS6A 1PNEA 3EEHA 3BY9A 5EOOA 1PYYA 2Z6DA 3QP8A 3VSKA 2ZQ9A 2Y79A 4X1MA 3MFXA 1PWGA 3VFHA 4FH2A 3LGOA 4Y0UA 1YKDA 3Q1FA 3WS2A 2ZQAA 3MMHA 2FZ0A 4ZJ1A 5HWWA 3LICA 4BENA 3OCLA 3MXQA 3E0YA 2VGLS 5KSCA 5FATA 4NEED 1NZOA 4EWFA 4KG2A 5HPIA 3ZGAB 4S2NC 2ZD8A 1KDWA 2K2NA 5EVIC 5GHXA 4GN2A 1MWRA 1MKMA 2VGLM 5J7EA 2P7JA 3CAXA 2P74A 3DBAA 3FC7A 1UGUA 2PYPA 1AWIA 4UQIS 3ULFA 3ZNYA 5LBRA 4P6ZS 2J9OA 1Y54A 2ZBBA 1E3UD 1Q2PA 3UB9A 1N9NA 5F1GA 4HNBA 1XJ2A 3ZCZA 4IHQA 1EWZA 4KQOA 2OAQ1 4JBFA 2VV8A 5F83A 3T1SA 3CZDA 3SS3A 4KQQA 4PPRA 5CX7A 2JKTM 1D1JA 4MDZA 2WZXA 3H7WB 3F1NB 4CLCD 3O86A 2P08A 1ZC2A 3BECA 1HLUP 1PI5A 1KDSA 2P04A 4R3AA 1O07A 2BLSA 4KZ5A 3CUEC 2EXAA 4IUHA 1PW1A 4KUOA 1ODVA 4LV3A 3IF6C 1MKIA 2JHEA 1T19A 2Q9NA 2WGIA 1AXBA 1CJFA 2ZL1A 2ZC5B 1UWPX 3KYEA 4S2PA 3IBRA 4PM6A 3A3FA 2HZ5A 4EXOA 4OLDA 4F3LB 4RA7A 3IXBA 2MJ6A 2QMIA 3VP3A 4E3MA 4EESA 3ITBA 4R0QA 1NYMA 1L0EA 3FKWA 5TR7A 3TG9A 4HP9A 3PXPA 5CHMA 3C38A 4HH3A 4JLFA 4OP8A 1P9RA 4WN5A 3IH9A 2JCHA 3HCYA 1OTDA 1LI0A 3WWXA 5TGFA 2XQZA 4Q0HA 4N1HA 1K6SA 3Q7VA 4JXSA 4LCMA 1XP4A 3UDFA 4Q0JA 2X01A 3ZG8B 3GECA 2DRWA 3MXSA 1L3LA 1TS8A 2OLVA 1FR1A 3NIAA 4D2OA 1CF0A 1NXYA 3B3XA 1YT4A 3MQOA 2V0WA 3UB8A 2L0WA 1KE0A 5TBMB 4G3VA 4X56A 2ZC6B 2WGWB 1GHMA 1NZUA 4YOFA 1PWCA 5I94A 3PBNA 1O7EA 4HP4A 3GVBA 2KX6A 3BRMA 2QHKA 3G34A 4E3IA 4ESPA 5IS1A 3ZG9B 1STZA 1ONGA 4HJ6A 1K55A 4OQIA 5GLAA 1H0MA 1UWNX 3PR6A 3WS4A 4MMNA 3Q82A 4M4XA 4E6WA 1T1AA 4WYYA 3DTMA 2XFSA 4DXCA 2H10A 3UB7A 1SKOA 2HDQA 2EFXA 4YINA 4JGPA 4HJ4A 3L7HA 5CXWA 3NOPC 3OOVA 5AQBA 4Y0TA 4DDYA 1YLZA 1FILA 5K5BA 4FTXA 4ME4A 5E2GA 2W1TA 2K7SA 4EBLA 3MSHA 4Q8IA 2WADA 3PBOA 5D3OA 1K56D 4N92A 4S2KA 5CGSA 2JKRI 4DE3A 3M6HA 2Y2LA 3E2KA 4WZ5A 1CI9A 3BFCA 2PR5A 3GR2A 1QMFA 4U0TA 3CHWP 5EE8A 3ITAA 2XGNA 4MBFA 3V39A 2XD1A 3KYZA 5AVEA 5HFOA 3TSGA 4Q0IA 1OT9A 4DE1A 4Y0OA 3SS4A 3N7WA 3TW8A 3JYIA 5F6AA 1JWVA 4BL2A 4JPMA 4XT2A 1EW0A 1Z09A 4FOFA 1NLYA 1E25A 3UMEA 1RP5A 4WUJA 3A0SA 3O88A 1YAXA 3E4QA 3IWOA 5HD5A 4C3QA 3BLSA 4HESA 5F5YA 3D72A 1D7EA 4Y15A 4KG5A 3T4SA 2VEAA 1V9ZA 2HPBA 5FQIA 3WS5A 5EM1A 5E2FA 3PAEA 1GHPA 2RL3A 5HDDA 4NXGA 3N8SA 4EBNA 4OH0A 1T18A 2P9VB 1TEMA 2Z2LB 4S2JA 4S2NA 4HI4A 1JTGA 1S4RA 2OWHA 5AQAA 4BD0A 2XFTA 3ZVTA 3GV9A 1VEUB 5EVIA 4ETZA 5C5KA 3MFDA 3V5MA 1G68A 1NRFA 2JKRM 2A49A 4P85A 4OOMA 2H0YA 4OQHA 2YKHA 3WRTA 3AGFA 1LT0A 3IWQA 3F1PB 3CLOA 5E43A 4R3BA 2Z6CA 3ZFZA 1H3QA 3OPRA 4JF5A 5IU1A 2XDMA 3HUMA 3M2JA 3PYPA 4FUWA 1KE3A 3MF0A 4G3WA 3QP2A 1XGJA 1IOUA 3ZVWA 2DMWA 3G2ZA 2W27A 5HARA 5JYOA 3FWLA 4AFIA 4B4XA 1CI8A 3CG5A 5GLCA 5FI2A 3SS5A 2O99A 1GSXA 4FCFA 1MWSA 1GA0A 1SKFA 3CUEA 4GD8A 3VOYA 4EQIA 2PU2A 4UA6A 4HIAA 2B5RA 3IF6A 1JTDA 2C6WB 4OQGA 1IEMA 5KZHA 4X68A 3T1QB 2XH9A 4LV2A 4WM9A 2V1AA 2HDUA 2XLNA 3PBRA 4DKIA 4EV4A 1FSYA 5FAOA 1XPBA 4OKPA 3A0VA 1ZG4A 3LR4A 4KZ3A 3BFDA 3OPLA 4R6LA 2EX2A 5FEGA 2WGVA 3HLBA 1PIOA 3T4QA 1MXOA 2ZLYA 5EVID 4MCWA 4CLCB 1IYSA 1NYYA 2QKPA 2ZOHA 2A24A 4JF6A 3BWLA 4LFUA 2QJ7A 1XA7A 2IWBA 4YWZA 3T12B 4F94A 1SHVA 5DVAA 3S4XA 5FI7A 2KLIA 4OPYA 5FAPA 3RH8B 2YKFA 4ZDXA 4DRTA 4HBTA 3IWIA 2Y2JA 3OPPA 4R38A 2ZQ8A 4NETA 1I2SA 3O87A 4EBPA 4OPRA 1IYQA 3G31A 3IXDA 4L9FA 3UE0A 4RYEA 1TS0A 4O8GA 3FPVA 4BLMA 4HH2A 2QZ6A 5CEDA 4OQ0A 2BASA 3HLWA 3P98A 4HHDA 4HOIA 2CC1A 5M1AA 3C4OA 2EFUA 2VJWA 1MBLA 1ACFA 4QHCA 5A90A 1LLBA 5HL6A 3VP1A 2Q9MA 1J9MA 1PRQA 1ESIA 4B9OA 4JXGA 5DJUA 1DP6A 1MC0A 3BFGA 4E3NA 1GSWA 2J3TC 1ERQA 4GD6A 1I2WA 5HWTA 3NOTC 3RFBA 1W8YA 3A3JA 4I3IA 2RCXA 1BYWA 1DJCA 3IS2B 3U2AA 3B33A 3NC8A 5U47A 3F1OB 1F2KA 4E04A 4K0WA 4Y7PA 3AGEA 1F5MA 3JPUA 5GL9A 1XKZA 3R7WA 4ETXA 1YM1A 4R1GA 4KZBA 2W3EA 1YSPA 4GDNA 1HVBA 1OTIA 4LGWA 4DN0A 1FCOA 4EQ1A 5M18A 1YLTA 2I72A 1TF1A 4IBXA 2BTFP 5DF7A 3V67A 2FH5A 3EOIA 4R3JA 3UB6A 4NXEA 3L9KA 4IVIA 1GHIA 2ZL1B 1VETB 3NDEA 4OONA 1BLSA 4BBVA 2WKPA 4LRZE 3NDGA 3H82A 1N9BA 2QWSA 3ZQ5A 4UHUA 4WMCD 2GJ3A 3NHQA 4I3AA 4UQIM 3QP1A 2H28A 1WYBA 1VB6A 4P6ZM 2EXBA 5HAIA 4Y2FA 1XJ6A 4KG6A 4XUXA 1BLHA 3PBQA 3QNBA 3T4TA 3W4PA 2Y2HA 4WL9A 3B42A 3SH7A 4WBGA 3Q81A 3HLFA 2VV7A 3ZG5A 5CGXA 1E4DA 2Y55A 5HAPA 1KGFA 3P01A 1DP9A 2PBDP 3BYDA 3N8RA 4MEZA 5CTMA 1F9IA 4QPRA 5FQMA 1NJ4A 3NULA 1BLCA 5FQQA 1YLWA 3NBLA 1SDEA 1BSGA 5HWVA 3MQQA 1YMXA 2ZMVA 1L0DA 4IUKA 4KUKA 4MNRA 1DJAA 4HEFA 3C2WA 4WZ4A 1L2SA 3IF5A 1K38A 1LSXA 4E6XA 2ZM0A 2XROA 4MN7A 3E4PA 2DNSA 5FDHA 4UA9A 4DE0A 4MBKA 3FG8A 4H8RA 5FQJA 1K57C 4GHIA 1J3WA 2I9VA 4IBRA 3RXXA 2Y2GA 5IHVA 1ES3A 4ZRRA 2J7VA 4U0XA 1K25A 3SZTA 1SZVA 1VM1A 1TVFA 2V1BA 1LSVA 3DTEA 1LHYA 1DY6A 2VLGA 4BWIA 4ZAMA 3WRZA 5CECA 2G2WA 5HPFA 1SKOB 1GCEA 1FOFA 3F1NA 4ZTKA 3GMWA 3IX8A 3NECA 2PBYA 3D9YA 3KYQA 3HREA 3N4IA 4X53A 4GB7A 4QWOA 2W1TB 3D4FA 1PFLA 4Y17A 2WKRA 3T1XA 2BG1A 2Q0OA 1RCJA 3LIEA 2R9WA 2B18A 3TOIA 2Y2KA 3VFFA 3LFVA 4GLQA 1P9WA 2PD8A 3PHYA 1M6KA 2E8JA 1S66L 1MY8A 2Y2QA 2ZQ7A 3LIAA 3IXGA 2V8FA 5EVLA 3LIFA 4F3LA 1G5UA 4PKYA 4BMWA 4XT2B 4CLCC 5CERA 3SH9A 3OZHA 1H8MA 1SDNA 3BJNA 3VP2A 2J9PA 4OPQA 1W79A 2D02A 3HUNA 3VP0A 5G4ZA 2QPNA 4LENA 3ZG0A 4DE2A 4MN5A 4EUZA 4N9KA 2ZMAA 4ARZA 2IWCA 5F82A 1OTEA 5DJTA 2WAEA 4WEJA 1XJ4A 5EFWA 2IA2A 3S22A 1ZHHB 2X02A 2VX8A 4Y5FA 2WKHA 2AVXA 5EVIB 3NI9A 1YPRA 3A3DA 3ZNTA 2LB9A 3BQ8A 4MBHA 3G6OA 4X25A 3BFFA 3GRJA 2OWJA 5E2EA 3O5YA 1OJ5A 3DWKA 2VZWA 2KDKA 4RX2A 5CRFA 1HD8A 1XFQA 1JVJA 3LIBA 3UE6A 3HL9A 2GNXA 2Y2IA 2OOLA 3LCEA 2WYXA 3NY4A 1KGEA 4ID4A 1G6AA 3CWFA 2GDNA 4N9LA 4NKPA 4PM7A 2Y2PA 4R4RA 1OPXA 1HTZA 3MKEA 3C7VA 4S2IA 3GSGA 2Y91A 1IKGA 4P6BA 3M6BA 2L1MA 5MC7A 4X55A 1FQGA 3VOLA 4HY8A 3LYXA 2V2FF 3SH8A 4H6JB 1HZOA 5HX9A 2R78A 2JKGA 1CK3A 3IF6B 2M7UA 5F68A 3OCNA 4OPZA 1Y28A 3W2ZA 3FZCA 1KVLA 1XX2A 2X71A 3EQUA 2W3HA 5F69A 3CMZA 4GNUA 1RGYA 5CTNA 4M3KA 2O0YA 2PT7A 3BW6A 2Y2MA 3OC2A 2ZM2A 3K2NA 4S2MA 2W3FA 4DXBA 4I39A 4NK3A 3P7NA 4HBUA 1U60A 4UAAA 1KOUA 1P97A 3RJUA 2A24B 4YFMA 5CGWA 4KZ4A 3GQZA 2Y8HA 5FA7A 2GX5A 2PR6A 1NRJA 1MWTA 1QMEA 3JVUA 2HGVA 3D3OA 3IBJA 5FL3A 1LL5A 1BT5A 3EEAA 2ACGA 4RQ9A 4E3KA 1S1ZA
chains in the Genus database with same CATH topology
4IJGA 5DKLA 3PBSA 4I3IA 5KSHA 3K3CA 2MJ6A 1BYWA 4HQAA 4LPZA 4EESA 5TBMA 3IS2B 3LIDA 3U2AA 4I3JA 3B33A 3F1OB 5HDCA 1WA9A 4E04A 4HP9A 3PXPA 3FPWA 4HJ3A 1F5MA 3C38A 2O9BA 4HH3A 2VKSA 3R7WA 4ETXA 1P9RA 4GCZA 2W3EA 2W0NA 1YSPA 2EWVA 4WN5A 4LRXC 1OTIA 3HCYA 4DN0A 1OTDA 5G4YA 4G3KA 5A8BA 4EQ1A 1YSQA 2NUTC 3H9WA 4Q0HA 3R4KA 2XRNA 2PD7A 1TF1A 3V67A 2FH5A 3EOIA 3UB6A 4NXEA 2LB5A 4PAUA 3ICYA 3F1PA 4Q0JA 4LLOB 3GECA 2PHYA 1DRMA 1TS8A 4L9EA 2W3GA 5DKKA 3T4KA 3UE3A 2O9CA 4BBTA 4BJPA 4BBVA 2WKPA 3GDIA 4I38A 4LRZE 4DJ2A 3H82A 4EEUA 2QWSA 3EGDC 3ZQ5A 4JGOA 2GJ3A 3MQOA 3NHQA 4I3AA 4UQIM 4DJ3A 2H28A 2V0WA 1VB6A 1S1YA 3UB8A 4P6ZM 2L0WA 5TBMB 4G3VA 1F98A 2HJ9C 4I5SA 4B93A 4Y2FA 1XJ6A 4YOFA 1XFNA 5DFYA 4EU0A 2V9AA 1G28A 1NLZA 3PBNA 4HP4A 3PBQA 3T4JA 2KX6A 4EETB 4O01A 3T4TA 2QHKA 1GSVA 3B47A 4WL9A 3B42A 5IS1A 1STZA 1LSWA 3EGXC 4MN6A 2GZAA 2VV7A 4HJ6A 2D01A 3KSGA 1OJGA 1UWNX 3PR6A 4EW7A 3P01A 2XA7S 1DP9A 4MMNA 3OBFA 4M4XA 3EQVA 1F9IA 1OT6A 1T1AA 4QPRA 2ZMFA 1G6OA 3CI6A 3VV4A 3SW1A 3UB7A 5HWVA 4LRYC 3MQQA 2ZMVA 4IUKA 4JGPA 1N9OA 4HJ4A 4KUKA 5HD3A 3MQ0A 4PKYG 3NOPC 2XA7M 3OOVA 3C2WA 3LR5A 4EEPA 5J4EA 4KQDA 5K5BA 1LSXA 2XROA 2V0UA 3E4OA 3HJKA 3T4LA 4ME4A 2L4RA 3E98A 2W1TA 4MN7A 2K7SA 3E4PA 1MZUA 3PBOA 3FG8A 3KSHA 2J3TD 4CLCA 2JKRI 3S7OA 3MJQA 2JKTI 1X0OA 3NOUC 4BBUA 3NJAA 4NXBA 4GHIA 2I9VA 2PR5A 5HSQA 3VE3A 4ZRRA 3K3DA 4PHTA 2NUPC 3KYZA 3A0RA 5AVEA 1V9YA 4Q0IA 2M1CA 1OT9A 4H6JA 4O0PA 2K31A 2HF6A 2V1BA 4II7A 3KO6A 1LSVA 3JVVA 2VLGA 3TW8A 1ZTUA 3UMDA 5AJGA 5F6AA 4BWIA 1W63M 3T50A 3ZYTA 5HPFA 4GS9A 3C30A 4XT2A 3TRCA 1EW0A 4R70A 4FOFA 3F1NA 1NLYA 1LL8A 3UMEA 4WUJA 3A0SA 3TE8A 1S4SA 4L0LA 1YAXA 3LI9A 3KYQA 3E4QA 5HD5A 4JGRA 2ZOIA 2EA9A 2QJ5A 3RTYA 2W1TB 1TS6A 1T1CA 5F5YA 3D72A 1D7EA 3T4SA 2VEAA 1IFQA 3MR0A 2WKRA 1V9ZA 3T4OA 3LIEA 5DF9A 4GHIB 2B18A 5HDDA 4NXGA 3CITA 3LFVA 3S7PA 1T18A 5J3WA 4GLQA 1P9WA 2PD8A 3PHYA 4GJ4A 3BQAA 1S66L 2G7UA 4HI4A 1S4RA 2OWHA 3R7WB 4FSFA 1NWZA 1OTBA 3LIAA 2O9AA 4ETZA 3KSFA 5C5KA 3LIFA 2JKRM 4F3LA 4PKYA 4BMWA 4GS9B 4XT2B 4OOMA 4L9GA 4CLCC 1D06A 2YKHA 4OOLA 1H8MA 2PDRA 3IS2A 3KSIA 3OLOA 2KOIA 5IT5A 3BJNA 1LT0A 4UEYA 3F1OA 3F1PB 3CLOA 2Z6CA 1H3QA 2D02A 4GW9A 2VV6A 5IU1A 2INWA 4WLAA 4EUVA 3PYPA 2QYBA 4Y3IA 3C8CA 3MF0A 4G3WA 5G4ZA 1TS7A 1P0ZA 3H82B 1OTAA 1IOUA 3PBTA 2DMWA 4MN5A 5AVFA 4ARZA 2W27A 1OTEA 5DJTA 2PYRA 4YNRA 4WEJA 1N9LA 1XJ4A 4WEKA 5EFWA 4DMZA 3LI8A 2IA2A 4AFIA 1ZHHB 3EEHA 4NXFA 3BY9A 2VX8A 2Z6DA 4Y5FA 3S7NA 2O99A 1GSXA 3VE4A 4JGQA 1DP8A 3CUEA 2Y79A 3MFXA 3KX0X 2LB9A 3BQ8A 2WKQA 1VHMA 3G6OA 4HIAA 1YKDA 4Z1WA 2OWJA 3MMHA 3O5YA 2FZ0A 1OJ5A 5HWWA 5KIZA 2VZWA 2V1AA 3EWKA 3LUQA 3LICA 3PBRA 3OCLA 2KDKA 3H7WA 3E0YA 3MXQA 2VGLS 2CMNA 3A0VA 2XSSA 1W63Q 1XFQA 3BY8A 3LIBA 3LR4A 4NEED 5HDSA 3UE6A 2VA0A 2W1RA 5HPIA 2GNXA 2OOLA 4R6LA 2K2NA 3CWFA 4NKPA 2HV1A 3T4QA 4MCWA 4ARZB 1OPXA 1MKMA 4CLCB 3TJZC 2VGLM 5DFXA 5J7EA 2QKPA 2ZOHA 2M7VA 2A24A 2OAP1 2P7JA 3CAXA 3DBAA 3FC7A 3BWLA 1UGUA 2PYPA 4UQIS 3ULFA 2HJEA 5LBRA 4P6ZS 2L1MA 2QJ7A 4CLCE 5MC7A 2ZBBA 2A2LA 5HZHA 3UB9A 4YWZA 1N9NA 4HNBA 4CQHA 1S67L 1XJ2A 3VOLA 4HY8A 4IHQA 2KLIA 3LYXA 2W3DA 4KQOA 3RH8B 4H6JB 2OAQ1 2EWWA 5I5LA 2YKFA 2R78A 2VV8A 2M7UA 5L8MA 5F68A 4R38A 3OCNA 1JNUA 1Y28A 3S7QA 1TD5A 5CX7A 3W2ZA 4K08A 2JKTM 4MDZA 5TJJA 3H7WB 3EQUA 2W3HA 3F1NB 4CLCD 5F69A 2P08A 4L9FA 2P04A 3LR3A 1XJ3A 1T1BA 1TS0A 4O8GA 3FPVA 2O0YA 4R3AA 2PT7A 4HH2A 3BW6A 2BASA 3OC2A 3HJIA 3CUEC 3K2NA 2W3FA 4HHDA 4HOIA 4KUOA 4IUHA 4I39A 3P7NA 1KOUA 1ODVA 1P97A 2VJWA 4WF0A 2A24B 2JHEA 2Y8HA 5HL6A 1T19A 2GX5A 4EERA 3LR0A 2JN7A 2PR6A 1NRJA 4B9OA 3JVUA 2HGVA 5DJUA 3D3OA 1UWPX 1DP6A 1MC0A 2J3WA 3IBRA 1GSWA 3IBJA 4WELA 5FL3A 2J3TC 2B02A 5HWTA 2J80A 3EEAA 4EXOA 3NOTC 4RQ9A 3RFBA 1S1ZA 4F3LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JKR I;  2JKT I;  1W63 M;  3TJZ C;  1NRJ A;  2XA7 M;  2VGL M;  2FH5 A;  4UQI M;  2JKR M;  2XA7 S;  2VGL S;  4P6Z M;  4UQI S;  1W63 Q;  2JKT M;  4NEE D;  4P6Z S;  5MC7 A;  2HF6 A; 
#chains in the Genus database with same CATH topology
 5KSH A;  3PBS A;  3K3C A;  4LV0 A;  2ZC7 A;  4LPZ A;  5A93 A;  4LCL A;  2XK1 A;  2VGK A;  5EPH A;  3LID A;  4I3J A;  2P9V A;  2Y2N A;  3CPT A;  1K6R A;  2O9B A;  2OLU A;  2VKS A;  1I5Q A;  1K4F A;  2W0N A;  3BM6 A;  1A0K A;  2EWV A;  1VEU A;  3CJM A;  5G4Y A;  2PAV P;  5EM0 A;  5A8B A;  1S0W A;  3H9W A;  2NUT C;  3OPH A;  5DF8 A;  3MBZ A;  4IVK A;  3N6I A;  3UNW A;  4K0X A;  2J8Y A;  1K57 A;  5L09 A;  4PAU A;  3E2L A;  3F1P A;  4D60 A;  4LLO B;  2A3U A;  1YLY A;  4FD8 A;  4KQR A;  3IX4 A;  5M19 A;  2PHY A;  4ZBE A;  2W3G A;  5DKK A;  1K54 C;  1ONH A;  3T4K A;  3UE3 A;  2O9C A;  3C5A A;  4BBT A;  4QB8 A;  3GDI A;  4I38 A;  3LY3 A;  2HP6 A;  3EGD C;  1S1Y A;  3ZDJ A;  5HAQ A;  2V9A A;  1G28 A;  3O3V A;  3T4J A;  4EET B;  1GSV A;  3QP4 A;  1YQS A;  1FSW A;  1IYP A;  1LSW A;  4MN6 A;  4C75 A;  5L2F A;  4E3O A;  3KSG A;  3QP6 A;  3EQV A;  3DAV A;  5EV0 A;  5F1F A;  3CI6 A;  3VV4 A;  3SW1 A;  1E3U A;  5FQ9 A;  5FAQ A;  3M2K A;  1N9O A;  3VSL A;  3MQ0 A;  4PKY G;  4S2L A;  4EEP A;  2EX6 A;  5J4E A;  5DTT A;  2L4R A;  3E98 A;  4PM8 A;  5JYP A;  1MZU A;  3KSH A;  4CLC A;  1GA9 A;  4JXW A;  2JKT I;  3NOU C;  1PI4 A;  2WK0 A;  3NJA A;  2H5S A;  2HP9 A;  4MLL A;  2WKI A;  3W4Q A;  5HSQ A;  2ZJ9 A;  5GLD A;  4E3L A;  4PM5 A;  2XR0 A;  3IH8 A;  4PHT A;  2NUP C;  1BUL A;  2M1C A;  2WKE A;  3VOZ A;  3DW0 A;  4O0P A;  2K31 A;  1C3B A;  2HF6 A;  4II7 A;  2PU4 A;  2B95 A;  1PZO A;  4XUZ A;  2PRF A;  3IHB A;  3A3I A;  4S2O A;  5AJG A;  1YLJ A;  1W63 M;  3T50 A;  2UWX A;  4KZ6 A;  4GS9 A;  3C30 A;  3MZD A;  3BFE A;  1S4S A;  4DDS A;  3GTC A;  1MWU A;  4JGR A;  2ZOI A;  2QJ5 A;  4CPK A;  1KVM A;  1TS6 A;  3P09 A;  1T1C A;  4KZA A;  1ES4 A;  1IFQ A;  3MR0 A;  1CEF A;  3T4O A;  3UO9 A;  5DF9 A;  2WUQ A;  4GHI B;  1H8Y A;  2EX8 A;  2FFF B;  3FV7 A;  5J3W A;  3WS1 A;  3IQA A;  2ZM8 A;  2H0T A;  1Q2Q A;  2JC7 A;  3G32 A;  4FSF A;  1BLP A;  2UV0 E;  4X1L A;  2XF3 A;  1IKI A;  2V20 A;  2O9A A;  3BLM A;  1EI5 A;  3SOI A;  1XA1 A;  4KEN B;  2ZQD A;  4X6T A;  4BD1 A;  2EX9 A;  4RX3 A;  5A92 A;  4RVA A;  3Q7V B;  2WZZ A;  4QD4 A;  2PDR A;  3IS2 A;  3KSI A;  3OLO A;  4XXR A;  1NY0 A;  5CHJ A;  3F1O A;  3G30 A;  1YMS A;  4GW9 A;  2VV6 A;  4BQM A;  2XEP A;  4P87 A;  4WLA A;  4EUV A;  5EOE A;  2QYB A;  1IEL A;  4P0M A;  4CJN A;  1OTA A;  2PYR A;  4YNR A;  5DTK A;  3IT9 A;  1N9L A;  4WEK A;  4KZ8 A;  1W7F A;  4DMZ A;  3U4L P;  3LY4 A;  4NXF A;  1Z6F A;  3LEZ A;  1BTL A;  3S7N A;  1VET A;  3VE4 A;  5EUA A;  4JGQ A;  1FR6 A;  1DP8 A;  4PM9 A;  1SCW A;  3KX0 X;  3VP4 A;  2WKQ A;  1VHM A;  4Z1W A;  3PTE A;  1LL9 A;  5FQK A;  1DJB A;  3W4O A;  5J8X A;  4C6Y A;  3DWZ A;  5KIZ A;  3EWK A;  3LUQ A;  2VGJ A;  3H7W A;  4K91 A;  2CMN A;  2XSS A;  1W63 Q;  4QY6 A;  3BY8 A;  5HDS A;  2FFY A;  2VA0 A;  2W1R A;  4QY5 A;  1K56 A;  5HW3 A;  3HVF A;  1BUE A;  2HV1 A;  5FI6 A;  5BOH A;  4QU3 A;  4ARZ B;  3TJZ C;  5DFX A;  1W5D A;  2M7V A;  2OAP 1;  4KZ7 A;  2R9X A;  1PW8 A;  2HJE A;  1BZA A;  3G35 A;  4CLC E;  5FSR A;  3UB5 P;  2A2L A;  5HZH A;  3N8L A;  4CQH A;  1S67 L;  2W3D A;  2VK3 A;  2EWW A;  2XD5 A;  5I5L A;  1PZP A;  1L0G A;  5L8M A;  3IX3 A;  1FIK A;  5EVE A;  3BEB A;  1JNU A;  3S7Q A;  1FCM A;  1TD5 A;  4K08 A;  5TJJ A;  5AQ9 A;  4E3J A;  1TDL A;  3QNC A;  2HP5 A;  3UPP A;  1ESU A;  3LR3 A;  1XJ3 A;  2G2U A;  2IWD A;  1T1B A;  2C5W B;  4GZB A;  1K54 A;  4JF4 A;  3LEQ A;  3HJI A;  4ZJ3 A;  1TDG A;  5G18 A;  4JKT A;  4WF0 A;  1MPL A;  1CEG A;  1FCN A;  2ZC3 B;  4R4S A;  4Z9Q A;  5EEC A;  2JBF A;  4EER A;  3LR0 A;  2JN7 A;  3UDI A;  4QJG A;  4Y13 A;  4BL3 A;  3W8K A;  2J3W A;  4R23 A;  4WEL A;  3MKF A;  2E8I A;  3AGD A;  1ES5 A;  5E2H A;  2B02 A;  1CQA A;  2J80 A;  2Y4A A;  4IJG A;  5DKL A;  4GOG A;  3V50 A;  4HQA A;  4OOY A;  3HLD A;  5TBM A;  2WGW A;  3MXR A;  2DCF A;  5HDC A;  1WA9 A;  2WAF A;  4GDB A;  3G4P A;  4U3T A;  1H8Z A;  4A5R A;  3FPW A;  3QHY A;  4HJ3 A;  2V8C A;  3A3E A;  4GCZ A;  5L07 A;  4LRX C;  1N4O A;  4G3K A;  1IYO A;  3I7J A;  1YSQ A;  3R4K A;  2XRN A;  2PD7 A;  3UPN A;  3Q7Z A;  3DTK A;  5FEF A;  5AQ7 A;  3Q07 A;  1VQQ A;  2LB5 A;  3ICY A;  1DRM A;  4OLG A;  4L9E A;  2HDS A;  3HLG A;  3V3R A;  3QP5 A;  1WE4 A;  4OP5 A;  4BJP A;  1ERO A;  3C4P A;  4DJ2 A;  4EEU A;  3MZE A;  5FAS A;  5CEB A;  4JGO A;  3DTI A;  4DJ3 A;  1F98 A;  2HJ9 C;  4I5S A;  4B93 A;  1H5X A;  1XFN A;  5DFY A;  4EU0 A;  1NLZ A;  5FDS A;  3NCK A;  5GHZ A;  3CPT B;  4FH4 A;  4N1X A;  3C7U A;  4O01 A;  1JWP A;  3B47 A;  2JE5 A;  1OME A;  2ZQC A;  3PAG A;  3EGX C;  2GZA A;  5A91 A;  2D01 A;  1OJG A;  4EW7 A;  2XA7 S;  4X69 A;  3OBF A;  1OT6 A;  2ZMF A;  1G6O A;  4LRY C;  3UY6 A;  1K4E A;  3WS0 A;  5HD3 A;  4O7D A;  4B88 A;  2XA7 M;  3HUO A;  3IXH A;  3LR5 A;  2Y2O A;  4KQD A;  5GLB A;  5CHU A;  2V1Z A;  2V0U A;  3HLE A;  3E4O A;  3HJK A;  3T4L A;  1KGG A;  5KMW A;  1L0F A;  2OV5 A;  3V3S A;  3FYZ A;  2J3T D;  1ERM A;  3S7O A;  3MJQ A;  1X0O A;  3ZHH A;  4BBU A;  4NXB A;  5TFQ A;  3VE3 A;  1KE4 A;  1XGI A;  3K3D A;  1ALQ A;  3A0R A;  2JKF A;  3G2Y A;  2Z2M B;  1V9Y A;  3VMA A;  4H6J A;  3KO6 A;  2ZC4 B;  1K0K A;  3JVV A;  1ZTU A;  3UMD A;  3UN7 A;  1YLP A;  3ISG A;  3ZYT A;  3TRC A;  4R70 A;  4JXV A;  1LL8 A;  3TE8 A;  4GKU A;  1W8Q A;  3HLC A;  4IED A;  4L0L A;  1S6R A;  3LI9 A;  2EA9 A;  3RTY A;  1K55 C;  2OSU A;  5L10 A;  1ZKJ A;  4ZJ2 A;  4NG2 A;  1Y4O A;  1JWZ A;  2HDR A;  3CIT A;  1XXM A;  3S7P A;  3T1R A;  1ZG6 A;  4GJ4 A;  3BQA A;  1WYC A;  5HL1 A;  5GHY A;  2Y59 A;  2G7U A;  3LO7 A;  3HBR A;  4LV1 A;  3R7W B;  4KZ9 A;  3IHA A;  1NWZ A;  1OTB A;  3KSF A;  5DTS A;  3UDX A;  3FKV A;  4GS9 B;  1RGZ A;  4L9G A;  3ZG7 B;  1D06 A;  4PMA A;  4B4Z A;  4OVD A;  4OOL A;  5IT5 A;  3S1Y A;  2KOI A;  4WZ5 C;  4UEY A;  1M40 A;  3RXW A;  1ES2 A;  2INW A;  1PWD A;  4DF6 A;  4WMC A;  4Y3I A;  3C8C A;  3MZF A;  1TS7 A;  1P0Z A;  3H82 B;  3UPO A;  3PBT A;  4UA7 A;  3UE1 A;  5AVF A;  1LI9 A;  3LI8 A;  3MS6 A;  1PNE A;  3EEH A;  3BY9 A;  5EOO A;  1PYY A;  2Z6D A;  3QP8 A;  3VSK A;  2ZQ9 A;  2Y79 A;  4X1M A;  3MFX A;  1PWG A;  3VFH A;  4FH2 A;  3LGO A;  4Y0U A;  1YKD A;  3Q1F A;  3WS2 A;  2ZQA A;  3MMH A;  2FZ0 A;  4ZJ1 A;  5HWW A;  3LIC A;  4BEN A;  3OCL A;  3MXQ A;  3E0Y A;  2VGL S;  5KSC A;  5FAT A;  4NEE D;  1NZO A;  4EWF A;  4KG2 A;  5HPI A;  3ZGA B;  4S2N C;  2ZD8 A;  1KDW A;  2K2N A;  5EVI C;  5GHX A;  4GN2 A;  1MWR A;  1MKM A;  2VGL M;  5J7E A;  2P7J A;  3CAX A;  2P74 A;  3DBA A;  3FC7 A;  1UGU A;  2PYP A;  1AWI A;  4UQI S;  3ULF A;  3ZNY A;  5LBR A;  4P6Z S;  2J9O A;  1Y54 A;  2ZBB A;  1E3U D;  1Q2P A;  3UB9 A;  1N9N A;  5F1G A;  4HNB A;  1XJ2 A;  3ZCZ A;  4IHQ A;  1EWZ A;  4KQO A;  2OAQ 1;  4JBF A;  2VV8 A;  5F83 A;  3T1S A;  3CZD A;  3SS3 A;  4KQQ A;  4PPR A;  5CX7 A;  2JKT M;  1D1J A;  4MDZ A;  2WZX A;  3H7W B;  3F1N B;  4CLC D;  3O86 A;  2P08 A;  1ZC2 A;  3BEC A;  1HLU P;  1PI5 A;  1KDS A;  2P04 A;  4R3A A;  1O07 A;  2BLS A;  4KZ5 A;  3CUE C;  2EXA A;  4IUH A;  1PW1 A;  4KUO A;  1ODV A;  4LV3 A;  3IF6 C;  1MKI A;  2JHE A;  1T19 A;  2Q9N A;  2WGI A;  1AXB A;  1CJF A;  2ZL1 A;  2ZC5 B;  1UWP X;  3KYE A;  4S2P A;  3IBR A;  4PM6 A;  3A3F A;  2HZ5 A;  4EXO A;  4OLD A;  4F3L B;  4RA7 A;  3IXB A;  2MJ6 A;  2QMI A;  3VP3 A;  4E3M A;  4EES A;  3ITB A;  4R0Q A;  1NYM A;  1L0E A;  3FKW A;  5TR7 A;  3TG9 A;  4HP9 A;  3PXP A;  5CHM A;  3C38 A;  4HH3 A;  4JLF A;  4OP8 A;  1P9R A;  4WN5 A;  3IH9 A;  2JCH A;  3HCY A;  1OTD A;  1LI0 A;  3WWX A;  5TGF A;  2XQZ A;  4Q0H A;  4N1H A;  1K6S A;  3Q7V A;  4JXS A;  4LCM A;  1XP4 A;  3UDF A;  4Q0J A;  2X01 A;  3ZG8 B;  3GEC A;  2DRW A;  3MXS A;  1L3L A;  1TS8 A;  2OLV A;  1FR1 A;  3NIA A;  4D2O A;  1CF0 A;  1NXY A;  3B3X A;  1YT4 A;  3MQO A;  2V0W A;  3UB8 A;  2L0W A;  1KE0 A;  5TBM B;  4G3V A;  4X56 A;  2ZC6 B;  2WGW B;  1GHM A;  1NZU A;  4YOF A;  1PWC A;  5I94 A;  3PBN A;  1O7E A;  4HP4 A;  3GVB A;  2KX6 A;  3BRM A;  2QHK A;  3G34 A;  4E3I A;  4ESP A;  5IS1 A;  3ZG9 B;  1STZ A;  1ONG A;  4HJ6 A;  1K55 A;  4OQI A;  5GLA A;  1H0M A;  1UWN X;  3PR6 A;  3WS4 A;  4MMN A;  3Q82 A;  4M4X A;  4E6W A;  1T1A A;  4WYY A;  3DTM A;  2XFS A;  4DXC A;  2H10 A;  3UB7 A;  1SKO A;  2HDQ A;  2EFX A;  4YIN A;  4JGP A;  4HJ4 A;  3L7H A;  5CXW A;  3NOP C;  3OOV A;  5AQB A;  4Y0T A;  4DDY A;  1YLZ A;  1FIL A;  5K5B A;  4FTX A;  4ME4 A;  5E2G A;  2W1T A;  2K7S A;  4EBL A;  3MSH A;  4Q8I A;  2WAD A;  3PBO A;  5D3O A;  1K56 D;  4N92 A;  4S2K A;  5CGS A;  2JKR I;  4DE3 A;  3M6H A;  2Y2L A;  3E2K A;  4WZ5 A;  1CI9 A;  3BFC A;  2PR5 A;  3GR2 A;  1QMF A;  4U0T A;  3CHW P;  5EE8 A;  3ITA A;  2XGN A;  4MBF A;  3V39 A;  2XD1 A;  3KYZ A;  5AVE A;  5HFO A;  3TSG A;  4Q0I A;  1OT9 A;  4DE1 A;  4Y0O A;  3SS4 A;  3N7W A;  3TW8 A;  3JYI A;  5F6A A;  1JWV A;  4BL2 A;  4JPM A;  4XT2 A;  1EW0 A;  1Z09 A;  4FOF A;  1NLY A;  1E25 A;  3UME A;  1RP5 A;  4WUJ A;  3A0S A;  3O88 A;  1YAX A;  3E4Q A;  3IWO A;  5HD5 A;  4C3Q A;  3BLS A;  4HES A;  5F5Y A;  3D72 A;  1D7E A;  4Y15 A;  4KG5 A;  3T4S A;  2VEA A;  1V9Z A;  2HPB A;  5FQI A;  3WS5 A;  5EM1 A;  5E2F A;  3PAE A;  1GHP A;  2RL3 A;  5HDD A;  4NXG A;  3N8S A;  4EBN A;  4OH0 A;  1T18 A;  2P9V B;  1TEM A;  2Z2L B;  4S2J A;  4S2N A;  4HI4 A;  1JTG A;  1S4R A;  2OWH A;  5AQA A;  4BD0 A;  2XFT A;  3ZVT A;  3GV9 A;  1VEU B;  5EVI A;  4ETZ A;  5C5K A;  3MFD A;  3V5M A;  1G68 A;  1NRF A;  2JKR M;  2A49 A;  4P85 A;  4OOM A;  2H0Y A;  4OQH A;  2YKH A;  3WRT A;  3AGF A;  1LT0 A;  3IWQ A;  3F1P B;  3CLO A;  5E43 A;  4R3B A;  2Z6C A;  3ZFZ A;  1H3Q A;  3OPR A;  4JF5 A;  5IU1 A;  2XDM A;  3HUM A;  3M2J A;  3PYP A;  4FUW A;  1KE3 A;  3MF0 A;  4G3W A;  3QP2 A;  1XGJ A;  1IOU A;  3ZVW A;  2DMW A;  3G2Z A;  2W27 A;  5HAR A;  5JYO A;  3FWL A;  4AFI A;  4B4X A;  1CI8 A;  3CG5 A;  5GLC A;  5FI2 A;  3SS5 A;  2O99 A;  1GSX A;  4FCF A;  1MWS A;  1GA0 A;  1SKF A;  3CUE A;  4GD8 A;  3VOY A;  4EQI A;  2PU2 A;  4UA6 A;  4HIA A;  2B5R A;  3IF6 A;  1JTD A;  2C6W B;  4OQG A;  1IEM A;  5KZH A;  4X68 A;  3T1Q B;  2XH9 A;  4LV2 A;  4WM9 A;  2V1A A;  2HDU A;  2XLN A;  3PBR A;  4DKI A;  4EV4 A;  1FSY A;  5FAO A;  1XPB A;  4OKP A;  3A0V A;  1ZG4 A;  3LR4 A;  4KZ3 A;  3BFD A;  3OPL A;  4R6L A;  2EX2 A;  5FEG A;  2WGV A;  3HLB A;  1PIO A;  3T4Q A;  1MXO A;  2ZLY A;  5EVI D;  4MCW A;  4CLC B;  1IYS A;  1NYY A;  2QKP A;  2ZOH A;  2A24 A;  4JF6 A;  3BWL A;  4LFU A;  2QJ7 A;  1XA7 A;  2IWB A;  4YWZ A;  3T12 B;  4F94 A;  1SHV A;  5DVA A;  3S4X A;  5FI7 A;  2KLI A;  4OPY A;  5FAP A;  3RH8 B;  2YKF A;  4ZDX A;  4DRT A;  4HBT A;  3IWI A;  2Y2J A;  3OPP A;  4R38 A;  2ZQ8 A;  4NET A;  1I2S A;  3O87 A;  4EBP A;  4OPR A;  1IYQ A;  3G31 A;  3IXD A;  4L9F A;  3UE0 A;  4RYE A;  1TS0 A;  4O8G A;  3FPV A;  4BLM A;  4HH2 A;  2QZ6 A;  5CED A;  4OQ0 A;  2BAS A;  3HLW A;  3P98 A;  4HHD A;  4HOI A;  2CC1 A;  5M1A A;  3C4O A;  2EFU A;  2VJW A;  1MBL A;  1ACF A;  4QHC A;  5A90 A;  1LLB A;  5HL6 A;  3VP1 A;  2Q9M A;  1J9M A;  1PRQ A;  1ESI A;  4B9O A;  4JXG A;  5DJU A;  1DP6 A;  1MC0 A;  3BFG A;  4E3N A;  1GSW A;  2J3T C;  1ERQ A;  4GD6 A;  1I2W A;  5HWT A;  3NOT C;  3RFB A;  1W8Y A;  3A3J A;  4I3I A;  2RCX A;  1BYW A;  1DJC A;  3IS2 B;  3U2A A;  3B33 A;  3NC8 A;  5U47 A;  3F1O B;  1F2K A;  4E04 A;  4K0W A;  4Y7P A;  3AGE A;  1F5M A;  3JPU A;  5GL9 A;  1XKZ A;  3R7W A;  4ETX A;  1YM1 A;  4R1G A;  4KZB A;  2W3E A;  1YSP A;  4GDN A;  1HVB A;  1OTI A;  4LGW A;  4DN0 A;  1FCO A;  4EQ1 A;  5M18 A;  1YLT A;  2I72 A;  1TF1 A;  4IBX A;  2BTF P;  5DF7 A;  3V67 A;  2FH5 A;  3EOI A;  4R3J A;  3UB6 A;  4NXE A;  3L9K A;  4IVI A;  1GHI A;  2ZL1 B;  1VET B;  3NDE A;  4OON A;  1BLS A;  4BBV A;  2WKP A;  4LRZ E;  3NDG A;  3H82 A;  1N9B A;  2QWS A;  3ZQ5 A;  4UHU A;  4WMC D;  2GJ3 A;  3NHQ A;  4I3A A;  4UQI M;  3QP1 A;  2H28 A;  1WYB A;  1VB6 A;  4P6Z M;  2EXB A;  5HAI A;  4Y2F A;  1XJ6 A;  4KG6 A;  4XUX A;  1BLH A;  3PBQ A;  3QNB A;  3T4T A;  3W4P A;  2Y2H A;  4WL9 A;  3B42 A;  3SH7 A;  4WBG A;  3Q81 A;  3HLF A;  2VV7 A;  3ZG5 A;  5CGX A;  1E4D A;  2Y55 A;  5HAP A;  1KGF A;  3P01 A;  1DP9 A;  2PBD P;  3BYD A;  3N8R A;  4MEZ A;  5CTM A;  1F9I A;  4QPR A;  5FQM A;  1NJ4 A;  3NUL A;  1BLC A;  5FQQ A;  1YLW A;  3NBL A;  1SDE A;  1BSG A;  5HWV A;  3MQQ A;  1YMX A;  2ZMV A;  1L0D A;  4IUK A;  4KUK A;  4MNR A;  1DJA A;  4HEF A;  3C2W A;  4WZ4 A;  1L2S A;  3IF5 A;  1K38 A;  1LSX A;  4E6X A;  2ZM0 A;  2XRO A;  4MN7 A;  3E4P A;  2DNS A;  5FDH A;  4UA9 A;  4DE0 A;  4MBK A;  3FG8 A;  4H8R A;  5FQJ A;  1K57 C;  4GHI A;  1J3W A;  2I9V A;  4IBR A;  3RXX A;  2Y2G A;  5IHV A;  1ES3 A;  4ZRR A;  2J7V A;  4U0X A;  1K25 A;  3SZT A;  1SZV A;  1VM1 A;  1TVF A;  2V1B A;  1LSV A;  3DTE A;  1LHY A;  1DY6 A;  2VLG A;  4BWI A;  4ZAM A;  3WRZ A;  5CEC A;  2G2W A;  5HPF A;  1SKO B;  1GCE A;  1FOF A;  3F1N A;  4ZTK A;  3GMW A;  3IX8 A;  3NEC A;  2PBY A;  3D9Y A;  3KYQ A;  3HRE A;  3N4I A;  4X53 A;  4GB7 A;  4QWO A;  2W1T B;  3D4F A;  1PFL A;  4Y17 A;  2WKR A;  3T1X A;  2BG1 A;  2Q0O A;  1RCJ A;  3LIE A;  2R9W A;  2B18 A;  3TOI A;  2Y2K A;  3VFF A;  3LFV A;  4GLQ A;  1P9W A;  2PD8 A;  3PHY A;  1M6K A;  2E8J A;  1S66 L;  1MY8 A;  2Y2Q A;  2ZQ7 A;  3LIA A;  3IXG A;  2V8F A;  5EVL A;  3LIF A;  4F3L A;  1G5U A;  4PKY A;  4BMW A;  4XT2 B;  4CLC C;  5CER A;  3SH9 A;  3OZH A;  1H8M A;  1SDN A;  3BJN A;  3VP2 A;  2J9P A;  4OPQ A;  1W79 A;  2D02 A;  3HUN A;  3VP0 A;  5G4Z A;  2QPN A;  4LEN A;  3ZG0 A;  4DE2 A;  4MN5 A;  4EUZ A;  4N9K A;  2ZMA A;  4ARZ A;  2IWC A;  5F82 A;  1OTE A;  5DJT A;  2WAE A;  4WEJ A;  1XJ4 A;  5EFW A;  2IA2 A;  3S22 A;  1ZHH B;  2X02 A;  2VX8 A;  4Y5F A;  2WKH A;  2AVX A;  5EVI B;  3NI9 A;  1YPR A;  3A3D A;  3ZNT A;  2LB9 A;  3BQ8 A;  4MBH A;  3G6O A;  4X25 A;  3BFF A;  3GRJ A;  2OWJ A;  5E2E A;  3O5Y A;  1OJ5 A;  3DWK A;  2VZW A;  2KDK A;  4RX2 A;  5CRF A;  1HD8 A;  1XFQ A;  1JVJ A;  3LIB A;  3UE6 A;  3HL9 A;  2GNX A;  2Y2I A;  2OOL A;  3LCE A;  2WYX A;  3NY4 A;  1KGE A;  4ID4 A;  1G6A A;  3CWF A;  2GDN A;  4N9L A;  4NKP A;  4PM7 A;  2Y2P A;  4R4R A;  1OPX A;  1HTZ A;  3MKE A;  3C7V A;  4S2I A;  3GSG A;  2Y91 A;  1IKG A;  4P6B A;  3M6B A;  2L1M A;  5MC7 A;  4X55 A;  1FQG A;  3VOL A;  4HY8 A;  3LYX A;  2V2F F;  3SH8 A;  4H6J B;  1HZO A;  5HX9 A;  2R78 A;  2JKG A;  1CK3 A;  3IF6 B;  2M7U A;  5F68 A;  3OCN A;  4OPZ A;  1Y28 A;  3W2Z A;  3FZC A;  1KVL A;  1XX2 A;  2X71 A;  3EQU A;  2W3H A;  5F69 A;  3CMZ A;  4GNU A;  1RGY A;  5CTN A;  4M3K A;  2O0Y A;  2PT7 A;  3BW6 A;  2Y2M A;  3OC2 A;  2ZM2 A;  3K2N A;  4S2M A;  2W3F A;  4DXB A;  4I39 A;  4NK3 A;  3P7N A;  4HBU A;  1U60 A;  4UAA A;  1KOU A;  1P97 A;  3RJU A;  2A24 B;  4YFM A;  5CGW A;  4KZ4 A;  3GQZ A;  2Y8H A;  5FA7 A;  2GX5 A;  2PR6 A;  1NRJ A;  1MWT A;  1QME A;  3JVU A;  2HGV A;  3D3O A;  3IBJ A;  5FL3 A;  1LL5 A;  1BT5 A;  3EEA A;  2ACG A;  4RQ9 A;  4E3K A;  1S1Z A; 
#chains in the Genus database with same CATH homology
 4IJG A;  5DKL A;  3PBS A;  4I3I A;  5KSH A;  3K3C A;  2MJ6 A;  1BYW A;  4HQA A;  4LPZ A;  4EES A;  5TBM A;  3IS2 B;  3LID A;  3U2A A;  4I3J A;  3B33 A;  3F1O B;  5HDC A;  1WA9 A;  4E04 A;  4HP9 A;  3PXP A;  3FPW A;  4HJ3 A;  1F5M A;  3C38 A;  2O9B A;  4HH3 A;  2VKS A;  3R7W A;  4ETX A;  1P9R A;  4GCZ A;  2W3E A;  2W0N A;  1YSP A;  2EWV A;  4WN5 A;  4LRX C;  1OTI A;  3HCY A;  4DN0 A;  1OTD A;  5G4Y A;  4G3K A;  5A8B A;  4EQ1 A;  1YSQ A;  2NUT C;  3H9W A;  4Q0H A;  3R4K A;  2XRN A;  2PD7 A;  1TF1 A;  3V67 A;  2FH5 A;  3EOI A;  3UB6 A;  4NXE A;  2LB5 A;  4PAU A;  3ICY A;  3F1P A;  4Q0J A;  4LLO B;  3GEC A;  2PHY A;  1DRM A;  1TS8 A;  4L9E A;  2W3G A;  5DKK A;  3T4K A;  3UE3 A;  2O9C A;  4BBT A;  4BJP A;  4BBV A;  2WKP A;  3GDI A;  4I38 A;  4LRZ E;  4DJ2 A;  3H82 A;  4EEU A;  2QWS A;  3EGD C;  3ZQ5 A;  4JGO A;  2GJ3 A;  3MQO A;  3NHQ A;  4I3A A;  4UQI M;  4DJ3 A;  2H28 A;  2V0W A;  1VB6 A;  1S1Y A;  3UB8 A;  4P6Z M;  2L0W A;  5TBM B;  4G3V A;  1F98 A;  2HJ9 C;  4I5S A;  4B93 A;  4Y2F A;  1XJ6 A;  4YOF A;  1XFN A;  5DFY A;  4EU0 A;  2V9A A;  1G28 A;  1NLZ A;  3PBN A;  4HP4 A;  3PBQ A;  3T4J A;  2KX6 A;  4EET B;  4O01 A;  3T4T A;  2QHK A;  1GSV A;  3B47 A;  4WL9 A;  3B42 A;  5IS1 A;  1STZ A;  1LSW A;  3EGX C;  4MN6 A;  2GZA A;  2VV7 A;  4HJ6 A;  2D01 A;  3KSG A;  1OJG A;  1UWN X;  3PR6 A;  4EW7 A;  3P01 A;  2XA7 S;  1DP9 A;  4MMN A;  3OBF A;  4M4X A;  3EQV A;  1F9I A;  1OT6 A;  1T1A A;  4QPR A;  2ZMF A;  1G6O A;  3CI6 A;  3VV4 A;  3SW1 A;  3UB7 A;  5HWV A;  4LRY C;  3MQQ A;  2ZMV A;  4IUK A;  4JGP A;  1N9O A;  4HJ4 A;  4KUK A;  5HD3 A;  3MQ0 A;  4PKY G;  3NOP C;  2XA7 M;  3OOV A;  3C2W A;  3LR5 A;  4EEP A;  5J4E A;  4KQD A;  5K5B A;  1LSX A;  2XRO A;  2V0U A;  3E4O A;  3HJK A;  3T4L A;  4ME4 A;  2L4R A;  3E98 A;  2W1T A;  4MN7 A;  2K7S A;  3E4P A;  1MZU A;  3PBO A;  3FG8 A;  3KSH A;  2J3T D;  4CLC A;  2JKR I;  3S7O A;  3MJQ A;  2JKT I;  1X0O A;  3NOU C;  4BBU A;  3NJA A;  4NXB A;  4GHI A;  2I9V A;  2PR5 A;  5HSQ A;  3VE3 A;  4ZRR A;  3K3D A;  4PHT A;  2NUP C;  3KYZ A;  3A0R A;  5AVE A;  1V9Y A;  4Q0I A;  2M1C A;  1OT9 A;  4H6J A;  4O0P A;  2K31 A;  2HF6 A;  2V1B A;  4II7 A;  3KO6 A;  1LSV A;  3JVV A;  2VLG A;  3TW8 A;  1ZTU A;  3UMD A;  5AJG A;  5F6A A;  4BWI A;  1W63 M;  3T50 A;  3ZYT A;  5HPF A;  4GS9 A;  3C30 A;  4XT2 A;  3TRC A;  1EW0 A;  4R70 A;  4FOF A;  3F1N A;  1NLY A;  1LL8 A;  3UME A;  4WUJ A;  3A0S A;  3TE8 A;  1S4S A;  4L0L A;  1YAX A;  3LI9 A;  3KYQ A;  3E4Q A;  5HD5 A;  4JGR A;  2ZOI A;  2EA9 A;  2QJ5 A;  3RTY A;  2W1T B;  1TS6 A;  1T1C A;  5F5Y A;  3D72 A;  1D7E A;  3T4S A;  2VEA A;  1IFQ A;  3MR0 A;  2WKR A;  1V9Z A;  3T4O A;  3LIE A;  5DF9 A;  4GHI B;  2B18 A;  5HDD A;  4NXG A;  3CIT A;  3LFV A;  3S7P A;  1T18 A;  5J3W A;  4GLQ A;  1P9W A;  2PD8 A;  3PHY A;  4GJ4 A;  3BQA A;  1S66 L;  2G7U A;  4HI4 A;  1S4R A;  2OWH A;  3R7W B;  4FSF A;  1NWZ A;  1OTB A;  3LIA A;  2O9A A;  4ETZ A;  3KSF A;  5C5K A;  3LIF A;  2JKR M;  4F3L A;  4PKY A;  4BMW A;  4GS9 B;  4XT2 B;  4OOM A;  4L9G A;  4CLC C;  1D06 A;  2YKH A;  4OOL A;  1H8M A;  2PDR A;  3IS2 A;  3KSI A;  3OLO A;  2KOI A;  5IT5 A;  3BJN A;  1LT0 A;  4UEY A;  3F1O A;  3F1P B;  3CLO A;  2Z6C A;  1H3Q A;  2D02 A;  4GW9 A;  2VV6 A;  5IU1 A;  2INW A;  4WLA A;  4EUV A;  3PYP A;  2QYB A;  4Y3I A;  3C8C A;  3MF0 A;  4G3W A;  5G4Z A;  1TS7 A;  1P0Z A;  3H82 B;  1OTA A;  1IOU A;  3PBT A;  2DMW A;  4MN5 A;  5AVF A;  4ARZ A;  2W27 A;  1OTE A;  5DJT A;  2PYR A;  4YNR A;  4WEJ A;  1N9L A;  1XJ4 A;  4WEK A;  5EFW A;  4DMZ A;  3LI8 A;  2IA2 A;  4AFI A;  1ZHH B;  3EEH A;  4NXF A;  3BY9 A;  2VX8 A;  2Z6D A;  4Y5F A;  3S7N A;  2O99 A;  1GSX A;  3VE4 A;  4JGQ A;  1DP8 A;  3CUE A;  2Y79 A;  3MFX A;  3KX0 X;  2LB9 A;  3BQ8 A;  2WKQ A;  1VHM A;  3G6O A;  4HIA A;  1YKD A;  4Z1W A;  2OWJ A;  3MMH A;  3O5Y A;  2FZ0 A;  1OJ5 A;  5HWW A;  5KIZ A;  2VZW A;  2V1A A;  3EWK A;  3LUQ A;  3LIC A;  3PBR A;  3OCL A;  2KDK A;  3H7W A;  3E0Y A;  3MXQ A;  2VGL S;  2CMN A;  3A0V A;  2XSS A;  1W63 Q;  1XFQ A;  3BY8 A;  3LIB A;  3LR4 A;  4NEE D;  5HDS A;  3UE6 A;  2VA0 A;  2W1R A;  5HPI A;  2GNX A;  2OOL A;  4R6L A;  2K2N A;  3CWF A;  4NKP A;  2HV1 A;  3T4Q A;  4MCW A;  4ARZ B;  1OPX A;  1MKM A;  4CLC B;  3TJZ C;  2VGL M;  5DFX A;  5J7E A;  2QKP A;  2ZOH A;  2M7V A;  2A24 A;  2OAP 1;  2P7J A;  3CAX A;  3DBA A;  3FC7 A;  3BWL A;  1UGU A;  2PYP A;  4UQI S;  3ULF A;  2HJE A;  5LBR A;  4P6Z S;  2L1M A;  2QJ7 A;  4CLC E;  5MC7 A;  2ZBB A;  2A2L A;  5HZH A;  3UB9 A;  4YWZ A;  1N9N A;  4HNB A;  4CQH A;  1S67 L;  1XJ2 A;  3VOL A;  4HY8 A;  4IHQ A;  2KLI A;  3LYX A;  2W3D A;  4KQO A;  3RH8 B;  4H6J B;  2OAQ 1;  2EWW A;  5I5L A;  2YKF A;  2R78 A;  2VV8 A;  2M7U A;  5L8M A;  5F68 A;  4R38 A;  3OCN A;  1JNU A;  1Y28 A;  3S7Q A;  1TD5 A;  5CX7 A;  3W2Z A;  4K08 A;  2JKT M;  4MDZ A;  5TJJ A;  3H7W B;  3EQU A;  2W3H A;  3F1N B;  4CLC D;  5F69 A;  2P08 A;  4L9F A;  2P04 A;  3LR3 A;  1XJ3 A;  1T1B A;  1TS0 A;  4O8G A;  3FPV A;  2O0Y A;  4R3A A;  2PT7 A;  4HH2 A;  3BW6 A;  2BAS A;  3OC2 A;  3HJI A;  3CUE C;  3K2N A;  2W3F A;  4HHD A;  4HOI A;  4KUO A;  4IUH A;  4I39 A;  3P7N A;  1KOU A;  1ODV A;  1P97 A;  2VJW A;  4WF0 A;  2A24 B;  2JHE A;  2Y8H A;  5HL6 A;  1T19 A;  2GX5 A;  4EER A;  3LR0 A;  2JN7 A;  2PR6 A;  1NRJ A;  4B9O A;  3JVU A;  2HGV A;  5DJU A;  3D3O A;  1UWP X;  1DP6 A;  1MC0 A;  2J3W A;  3IBR A;  1GSW A;  3IBJ A;  4WEL A;  5FL3 A;  2J3T C;  2B02 A;  5HWT A;  2J80 A;  3EEA A;  4EXO A;  3NOT C;  4RQ9 A;  3RFB A;  1S1Z A;  4F3L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...