2JKWA

Pseudoazurin m16f
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
b'ADFEVHMLNKGKDGAFVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALAALGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOAZURIN
publication title Pi-Interaction Tuning of the Active Site Properties of Metalloproteins.
pubmed doi rcsb
source organism Achromobacter cycloclastes
molecule tags Electron transport
total genus 35
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2jkwA00
4YSUA 1OCZB 3GDCA 4KNUA 2ZXWB 1WA1X 2IDFA 3MBWB 3ABGA 4BWTA 3D12B 4YSOA 3UADA 1N70A 5I6KA 3S3DB 3QJQB 2AANA 3WNIA 8PAZA 1L9SA 3L45A 1A65A 4A68A 1W6WA 1ZPUA 3FPYA 3NJMA 5B3SB 3T71A 5I28A 2IDQA 4G71B 3TU6A 2OJ1A 4HAKA 1CURA 3N55A 3X1GA 3HB3B 4YSDA 4AZUA 1SDDB 3IEAA 4N4YB 2TSAA 2R7EA 2ZWNA 2IWKA 3FU7A 2NRDA 1NIEA 1IBZA 4BWUA 4FA7B 4KO9A 4YVUA 2GIMA 1V54B 1GS8A 3DTUB 2DV6A 1L9TA 1JXDA 1BQ5A 1NWPA 3C75A 4NERA 2XX1A 5E9NA 1A4CA 4CSPA 2MTAA 1OE3A 1NZRA 4PAZA 1ZDQA 1OCCB 4M4RB 4JHUA 3NSFA 2DYRB 2WSDA 1NINA 2PP9A 4HALA 1NICA 1NWOA 3KW8A 2EILB 2JFCA 3BVDB 2IWFA 4A2EA 1WS7A 4AI7A 5I6OA 1JZHA 4G7QB 4G7SB 1PF3A 2BO0A 2GI0A 2YAFA 3OD3A 2VSMB 3NJLA 3N2JA 5D4HA 4E9VA 1E67A 1NIDA 3QQXA 1BYOA 1ZIAA 1W8EA 1OE1A 1TEGA 2AZAA 1OE2A 3AZUA 3FU9A 1AR1B 4G7RB 2Y1AA 1EHKB 4AKQA 4BK5C 3CDZA 2EIMB 1NPJA 4CSZA 2E86A 3UABA 4BXSV 2W8CA 4DP6X 3NP3A 4QLWA 1ET8A 1KBWA 2Y69B 4E9XA 2PPEA 3H4FA 1AS7A 4KO7A 4GXFA 5B1AB 4E9WA 2J5WA 2X88A 3FSVA 5AZUA 2VW4A 1RZPA 4E9SA 1AANA 3CDZB 5I5IA 4DP2X 3EF4A 4KNSA 2GB2A 3OQRA 2QPEB 1E30A 5B7EA 4YSQA 1KDJA 4X4KA 3ABMB 1BXUA 2FT6A 1ASQA 2MRYA 5AFAA 4BDVB 1AS6A 2PPFA 2XVBA 3WKQA 4QKTA 3X2QB 4Q8BA 4DPBX 1GW0A 2WO3B 2YAPA 1SJMA 1ILSA 4UAHA 1FA4A 1GS6X 4TXVB 3T6ZA 1PLCA 1AIZA 2P80D 4GP8B 5I6NA 1A8ZA 2DWSA 3S8GB 1CYWA 1KBVA 2N0MA 2VN3A 5I6LA 3JTBA 2OCCB 4DP7X 1XB6A 1CUOA 3FQYA 5TK2A 3CZUB 1J9QA 1KDIA 1JZGA 3PAUA 4BWWA 2YAQA 1BXVA 4HZ1A 3ZIYA 1EZLA 1HAUA 5I5JA 1AZUA 3S3CB 1J9RA 1NDTA 3ZDWA 5D4JA 3PLYA 1SFDA 2Q5BA 2DY2A 1N68A 2XX0A 3ABKB 3QJRB 2VMJA 5D4IA 3BQVA 1F56A 4P5SA 2XV2A 3FU8A 3OM3B 3JT2A 3T6WA 3ASOB 3DIVA 4F7KA 2AZUA 5I5MA 2OV0A 1UATA 2HXAA 3EHBB 2YARA 1PLBA 2PP7A 1JXFA 3QJTB 2PPAA 3FQ1A 2JKWA 1J5CA 3FPXA 5F7BA 1NPNA 4HHWA 2IDSA 3X1NA 2HRHA 5AKRA 2J57A 2BWDA 3NJNA 1PNDA 1RKRA 4GP5B 2IH8A 1TEFA 3PAVA 5B7FA 1AZCA 2CJ3A 2YAOA 4UANA 3WIAA 2J55A 2R7EB 1ZV2A 1M56B 2EIKB 3IE9A 4YSRA 1AAJA 2Q9OA 1JZFA 4E9YA 1AOZA 1AG0A 3FU7B 4HIPA 1DZ0A 1GS7A 4EF3A 1I53A 3X1FA 4Q89A 2FWLB 4JHVA 3GYRA 2QDWA 5IY5B 4A67A 7PAZA 4KOCA 3NJKA 5I26A 4UF7C 2QDVA 2J56A 1JZJA 4YSSA 1AACA 1ADWA 1QHQA 5FC9A 5LDUA 4JKNA 1BYPA 2IDTA 3ZX1A 2AVFA 1CC3A 4KO5A 1HFUA 2BP0A 4GYBA 1MDAA 3EH3B 3X1BA 2H3XC 4ENZA 3WNJA 3AG4B 7PCYA 2XYBA 5B1BB 5EHFA 1J5DA 3QJVB 3NJFA 2PPDA 1JOIA 2XV3A 1T5KA 1YLBB 1BQKA 4DP0X 1VLXA 1WA0X 1AQ8A 3H56A 4DP1X 4FAAB 3TASA 3PCYA 4E9TA 3SQRA 3V9EA 5B1JC 4DPCX 2FQEA 2IDUA 3TBBA 1BXAA 1GSKA 2VW7A 3QJSB 6PCYA 5B1JA 4HHGA 3CVBA 1E5ZA 2BP8A 1XMEB 3OMNB 5F7AA 4YSTA 2UXVA 5B7MA 1JERA 4MFHA 3RYMA 2XXFA 3U25A 3TA4D 1OOWA 1QLEB 3NSCA 1PY0A 1ASOA 2VSKB 3X1EA 1W6LA 2B3IA 4WTQA 1J9TA 1AZNA 1B3IA 2GSMB 2I85A 4KO6A 4NAJA 1SFHA 2UX6A 3HEIB 3IBOA 3PPSA 1R1CA 2GC4C 1AZBA 3UACA 4A2HA 2QPDB 4A2GA 1BEXA 3ZBMA 4YSEA 3FS9A 4HCGA 3WG7B 2DYSB 2LLNA 9PCYA 4DP4X 1WAEA 2IWEA 1ET7A 2BW5A 1PNCA 3OMAB 2XUWA 1WS8A 3FQ2A 3UGEA 3UAEA 1ZDSA 3NYKA 1HAWA 1JVLA 2XU9A 4YL4A 2HLEB 2YXWA 4WKXA 3EH4B 6PAZA 2A3TA 1PCSA 4YSPA 3CVCA 1SF3A 1V55B 1GY2A 1L9PA 1WA2X 4KNTA 4A2FA 3QJUB 2IAAC 2CUAA 1GY1A 1FWXA 4HCFA 5I6MA 2FQDA 1BAWA 1XB3A 3ERXA 2YAEA 1L9RA 3GXUB 2YQBA 2CALA 4DPAX 1SDDA 3FYEB 4YSCA 1SHWA 1A4BA 2FT8A 3H4HA 2VM4A 1ET5A 3AG3B 2YAMA 3UAAA 1OV8A 3IN2A 3AW5A 1L9OA 4W9ZA 4KOBA 4E9RA 2GHZA 1KYAA 1NIFA 1ID2A 2HX9A 4BXVA 2XLLA 4YSAA 1SHXA 2UXFA 3FSAA 2H5UA 3QPKA 3TBCA 3V9CA 2PCFA 1X9RA 4AX3A 1FFTB 1KGYE 4NB7A 1URIA 2BW4A 5B1KA 2HX8A 1BQRA 1KCWA 2UX7A 2HZHA 3FSZA 1DYZA 1MG3C 2WO2B 4G70B 2FT7A 1IKOP 1RZQA 3SBQA 5PCYA 1GYCA 4L0PB 1GR7A 1JXGA 1J9SA 4G72B 5TK4A 3S8FB 2YAHA 1ETJA 1PAZA 1JZIA 1KV7A 1CYXA 4AKOA 3AG1B 3NSYA 1RCYA 4PCYA 1QNIA 2X87A 1E65A 1OF0A 1TKWA 5I6PA 3FT0A 1ZIBA 1SNRA 3G5WA 2QT6A 2GBAA 1PZCA 2BZ7A 3WI9A 1OCRB 1E5YA 2P80A 2ZONA 2PP8A 4RH4A 3EH5B 5PAZA 4DP8X 1NIAA 2RACA 2FJSA 2JXMA 1MG2C 1ASPA 1KCBA 4F2FA 1PZAA 3PXLA 4DP9X 2HRGA 3AY2A 3CG8A 2BP0B 4HCIA 1AZRA 4F2EA 3NJHA 1SF5A 2FTAA 4A2DA 1IC0A 2HX7A 3KW7A 4ZK8A 1PZBA 2YXVA 2H47C 1A3ZA 2EINB 5ANHA 3DKHA 3T6VA 3SBPA 2CCWA 4N8UA 3PAZA 4P5RA 2IH9A 3NJGA 4A66A 3MX0B 2TSBA 2VW6A 5A7EA 2BZCA 3T9WA 1OCOB 3NSDA 3IN0A 4W1TA 3SBRA 2PPCA 1XB8A 2DWTA 4AKPA 1IUZA 2I7SA 2I7OA 2GC7C 3OMIB 1A4AA 2XXGA 3S3BB 1JZEA 3CVDA 1M57B 1X9UA 2AFNA 1IBYA 2B08A 4M3HA 4GY4A 1V10A 2VM3A 4BDVA 2BP8B 3ASNB 1NIBA 2UXGA 3T6XA 1L9QA 3NT0A 2PLTA 1MZZA 3FSWA 2FQFA 4DP5X 3NJIA 4GP4B 2CBPA 3AG2B 3NJJA 1AS8A 1PLAA 4E9QA 4YVNA 2CAKA 2ZOOA 1AG6A 2W88A 1ILUA 1M9WA 1MZYA 1NTDA 3FYIB 3ABLB 1TU2A 2XWZA 2BHFA 1PMYA 2UXTA 2XV0A 1JVOA 3WKPA 2FQGA 2EIJB 3NP4A 4K9JA 2PCYA 2FNWA 2BWIA
chains in the Genus database with same CATH superfamily
3LS4H 3VWJC 1TZHB 2MOGA 3N44F 1Z2KA 2O72A 3LIZA 5C3IA 4Z7NE 1YPZB 2ZXWB 5F70A 2OSYA 1QP1A 2VL5A 4LU5H 5T3XL 3KJ6L 4JQVC 5I1AA 5T8IA 4W9HC 4Q7DA 1MJ8L 4R7XA 5IESH 1W6WA 1X5ZA 2V2WA 3THML 3PHAA 1P6AB 4B96A 2GY7B 1F0LA 3QFGA 4I4WA 3Q43A 5EZPA 1AR2A 1B6UA 2WZ6A 3QCTH 4M03A 3VGHA 3V79C 1PD0A 1PEWA 2E3VA 3C5XA 2Y3NA 3ROOB 2GJ6B 3QO1B 2F53E 3LQZA 1SXSA 3ULUL 4PB9H 5DRWB 4WTXA 4Y4FB 4BWUA 3OX8A 2AABL 1U95A 1D5MA 4Y2NA 2I60L 1DUZB 3I3EA 3QEGL 3DTUB 5D1QA 4DO4A 5C1MB 4BQ9A 1P5VB 3QEUA 1GGTA 1E3FA 4YHYB 4AIEA 5K59F 4QHNA 1AP2A 2FB4H 4IBSA 4JRFA 2H32H 5IEKA 1IGTA 2EC9U 1KB5B 3BYYA 3VFRB 5I1HL 3AGWA 4PRHD 3TJHD 4L8DA 3BLPX 5KYWA 3OLGA 4OTXH 2WSDA 4IDJH 2XJKA 4IKJA 1GZHA 4QEGA 1T0NA 4NPYA 5AENA 5KYUB 3GHBH 5L4IA 2R4SL 1OXYA 2ESVB 1UA3A 5C08D 4BKLB 2IMMA 1WS7A 2VXVL 4XH2A 5KW9L 2YD2A 1T3FA 1M7XA 2RJMA 5IF0B 1B6DA 5I6OA 1MJUH 1FH2A 3OJ2C 3O8XC 2ED8A 5D1XD 4DEPC 3HHSB 3WE1A 4HJJL 1BG9A 5EZLB 2E76C 2H1PL 3I3DA 3RTQA 4FFVC 1DN0B 4M48H 1LJMA 5C0IB 1WFTA 2J12B 1J9CT 4HIIB 1OE1A 2FX9H 3FO9A 3H42L 1I82A 1DUYB 1HKLH 1J8RA 3MRIB 1HSAA 1WIOA 1KJ3L 5ALCH 1AQHA 4OU3A 2NYYD 1U36A 5B39A 3J8F7 4S1SL 4HV8A 5DWPA 5FKAA 4ZDHB 4BFOA 1RUPH 3VXUA 3H8NA 4BK5A 3HG0A 4I0PB 3MTRA 4XZUA 5CJXC 1XF4A 4ZG1A 1TQBB 4RQQA 3QA3B 4KMTH 4U1HB 3BP4A 5DJ0A 3SQOL 3VG9C 3FQWB 2R59A 4M6NL 4M9PA 2E9GA 1JGVL 4HXAL 1A7OH 1U8CA 1I7RB 2WLMA 2Q2LA 4JFFE 5HYSB 4DNLA 5HYJD 2KZ1B 4I18B 2PO6C 5FA3B 3IDNA 3ETSA 2WAQA 3QHZH 4GBXA 4PJDA 5E8PA 4BDVB 1PLGL 1AS6A 3QARA 1NCAH 4HIQA 4WFGE 4URTB 5ICXA 3X2QB 3GTNA 3FH8A 4OI8A 4LRNL 2AV7A 1DLHA 1T21B 3QJOA 3RGVB 1BBJB 1PKQB 4G6ML 3BQUC 2Y5EA 3TWYA 3TJEH 1S5HB 1ZLSH 2I24N 1LK3L 3DXAB 2EYRB 3QUMB 2CLRA 1RIVH 4QXWA 2OCCB 1N0LB 4JRXB 3ULSB 1RK1B 3B2UD 4QRRD 1W8OA 3INUH 4HBCH 1HHHB 3DVNB 4PG2A 4UB0H 4L3CA 4L8BB 5I1GL 3EO9H 4TSAH 2HTLD 5BRQA 2WWMD 1AZUA 1DVFC 3INOA 3PL6A 3S5LG 4EUPB 5C0GB 2UY7A 4U1IB 4MJ6B 3GI9H 4BHUI 2DY2A 1KYDA 3DJSA 3VB9A 2VC2B 1GW6A 5DHVA 4XC3L 4UT6H 3U9PL 1OTTC 4NXSA 1NCWH 1Y6MR 3V4LA 4AVJA 1FE8H 4MXWH 2EACA 3JT2A 4QJ3B 3NABH 4F7KA 5IVXA 2VLJE 3RP1A 3ZUCA 1HZHL 2HXAA 3BPCB 3GXFA 4GQPH 5FB8A 2C9VA 2H41A 2NY6C 3EIFA 4ZX6A 3BAJA 4PJHA 4P4RA 3FPXA 1Q1JL 3L9EA 2IDSA 2VXQA 4OIIL 1PNDA 1TO4A 4FQHB 1IEHA 4M5YH 3IMWA 4MXVE 4PJCF 1XGTB 5HHOA 4EI5C 1IGYA 4MS8C 1WLHA 3MRLA 1I4FB 3BN9D 3VQMA 3MJ7A 2RHEA 4JDZA 5EO0B 4WFEE 2ZICA 4ZMWA 1GGCH 5I9QC 7PAZA 4KOCA 2FUQA 4CDHA 1JPGB 2QDVA 4X42A 4AQ8A 3ARZA 5I2IB 4YSSA 2GSGB 1ADWA 1QHQA 1KIRA 4F37K 5AD0A 3BUYA 1FYTD 3MOQA 1ZANL 3QIBA 2CMRH 1CYGA 5A43C 4U1KB 3GMPB 5D1ZA 4X6DB 4MA8L 5C0DA 2VDMB 3MV9A 1KIPA 5HHQA 1HWGB 2Y06L 3HZYA 4JO4H 5FYJE 4U6TA 4CJ0A 1WC7A 4GRWH 1KT2B 2HVKB 2PPDA 3KVQA 1JOIA 3SGKA 2IPTH 3L3IA 4YHOL 1G9EA 4N2EA 3DX8B 2VDOH 1XH3A 1QVOA 5JPNA 3F6LA 5CLWA 1HS6A 2Y24A 5F72S 2P8LB 4OJYA 4F8LA 1I7TB 5C2BL 1YYML 1F11B 1CD0A 2JE8A 4DTGL 3D69B 7TAAA 4N8CL 2FJFA 3SDDB 4ICWA 2RR3A 1CMOA 2QGCA 4HHGA 1A22B 4C58B 5K9OB 1YY8B 1J0ZA 4KI5E 4LARH 4YSTA 3KPPA 5B7MA 2Z7YA 3RYMA 3BPLC 3ZHKA 4ZUSA 1C5BL 3TA4D 2A6JA 4C4UA 4IKNA 2HT3D 2HT4C 5HVWA 1DJIA 2VSKB 1RFDL 1W6LA 1RZJL 3AMLA 5LG6A 4OCXL 1B3IA 5DD0L 4LF3A 5CHNA 3C8KB 4HAFA 3HZVB 4X5XB 1XR8A 3WV0A 1F6AB 2EEDA 1R1CA 1CPUA 2B39A 1FO0A 3VFTA 4F9PA 2HJLB 5BV7L 1A1OA 2H1XA 4KRPD 5JHDB 3BZEB 2VSCA 2YPKA 4K71C 4OZHA 3GEFA 4DUWA 4IBYA 4NNPL 4PREB 3U7AA 4CDGC 2DYSB 3SYPA 5B38A 1S7VB 1XTMA 1MHCA 3CFDA 1QSED 5CU5A 3UAEA 4HWUA 4WDIB 4YL4A 1KV3A 4PJ5B 4YO0B 5ANMA 4ZD3H 1UM4L 2K0RA 3CX5J 3VGFA 1SY6L 3D4CA 3QIUC 1L9PA 3JWDL 2NZ9D 3TCTA 3CDGB 1KTDA 3PHSA 5FM5M 3WEOA 2APVA 5IB3B 3MXWH 3VGGA 2BSRB 4R2GD 2Z8SA 5KVGL 2DYPD 1HYSD 1LO5A 3JV0A 5E6UB 1CLZH 3CFCL 5LLIC 2AQPA 1ZV9A 1L0PA 4BFGA 3AQXA 3TO2A 5TPWH 2YQBA 3SDAC 4Y19B 1AD9A 3FYEB 1C1EH 1SHWA 1FV1A 5IHUH 3O6FB 2Z8VC 1QA9B 4LLWA 3BKMH 1KSRA 2COVD 3MUGB 4JAMB 4KUZL 1FH5L 3C5JB 2EDQA 3AG3B 4KC3B 3WFHA 4LEEA 3Q0HA 2K1MA 3UAAA 2DEXX 2Z7ZA 4N90D 3EGXB 2R1WA 4LCCB 4PS4H 4AJ0A 2HB0A 4BXVA 1DE4A 1UH4A 4Z7UE 1SHXA 2EUWA 4R6UA 1MWAB 1AO7D 4Q6KA 4MJHA 4PJ9A 5B1KA 1BQRA 1KCWA 3DTDA 6FABL 4XNXL 5FOJA 1N18A 3EYFB 2BX5A 3U1SL 2J8OA 1J05B 2VXUH 4QRPE 2BWQA 5B22A 4KZDH 4AW7A 1LO4H 4MNGB 1J9SA 2WXNA 1U0QA 5IROC 1TSRA 4MA7H 2AV1A 1KJVB 5I71C 3W2DH 5IQLA 2CJUH 3F6IA 1CG9B 4U7KA 3NVQA 3SPVB 3V6ZA 1XSJA 6CGTA 5J8OA 1GCFA 2V5MA 2XZQH 1KPVA 1P0SE 4G80A 4V11A 1PZCA 2CO7B 4HH8A 1NEPA 1MVUA 1E5YA 4G42B 4JRYA 4Y1AD 1WTLA 1HXYA 3GSVA 3OZ9L 2C9UA 5PAZA 3TFKD 1OCWH 2DPKA 2IV9A 4KUCF 1MCOH 2EE2A 1QI5A 3PXLA 4LIQL 3AY2A 4O51A 3DX7B 4N0UE 3O3BA 1A6UH 3LXUX 5J9PA 3CX5K 1H3GA 2PTUA 4U31A 5JHLH 1S9YB 5GSVB 5K9KB 1V3JA 4JM0A 1NCCL 4MJIA 1FC1A 3QEHA 3RZCA 3A6BL 1TIUA 4ORGA 3Q7JA 3ATAA 1VENA 3H3PH 2EEAA 3CHOA 5C07B 4DK6A 3F01A 3O9WD 4Q97A 2JI1A 3FFCD 3GEWB 5I1CL 4ZT1A 1A6AA 1EFXD 1YEJH 3KNBA 3OR7B 4LT7A 1XB8A 4IOFD 4GRLD 4QF1B 4WI5A 4S1QL 1FNGB 5FUZH 2G9HB 3K6SB 2KI6A 1IM9A 1S5IH 4GKZA 1A3LL 1A7RL 3NA9H 5SV4A 5BOPA 5JQIB 4AQEB 5EFIB 1NANI 1XGQB 4PGBA 4BEIA 4IOSD 5KTEH 1RPUA 2OYLA 1PX8A 3NT0A 1VERA 2YGQA 5ISZA 5CBEB 4LDOB 2HG5B 1JNLL 2H4EA 3NJIA 1E42A 3NJJA 5I8OL 1AS8A 2JMRA 2A2QT 3RVTD 4Y5VA 4GSDH 3UC0H 1GGBH 1I9RH 3TN0A 4Q9QH 2J6EL 2ZCKL 4JJ5B 1JIBA 3AFLA 4LP4A 4CADA 1N59A 1E28A 3MRKB 3QUZB 2AQ3A 2EIEA 4OFQA 4FKEA 1JRHL 1JVOA 3FQNA 4WLCA 2EIJB 2QKIC 4G9FB 1DBML 1QRND 5LQBH 3S3JA 1D3CA 2IG2H 1WT5C 4OD1H 2P47B 2XG5B 3L81A 5CN3A 1FL3A 5I18H 1IL1A 1JYVA 4U6XB 3BWAA 2AXWA 1T7XA 5EBMA 2X44D 4JFOB 3C5SA 2A38A 2KZWA 4RFOL 1I8MB 4O02B 3IDJA 4HUMB 4KROB 1G9NC 4GO9A 1BVLB 3F7YB 3Q2LA 5DMIL 4JG0L 3TU6A 4B0MB 5M7QA 3L7FA 3NCCB 2NY7L 1N19A 1BGXL 4KK5C 4NN7C 1XD0A 4U6VH 3W57A 4Q6IB 4IOIB 4YFDB 4MSWA 4QWWC 1SJEA 4YSDA 1FIGH 3IKKA 1QSFA 3LNHA 2R7EA 3AWFA 1JV5B 4XT1C 1IM3A 3IGKA 1MRDH 2X1PA 1I7ZB 3D18B 3Q1EA 5DC0A 5MEQA 1SMOA 3H55A 4N28A 1Z3RA 3MRGB 4UQIM 3IAPA 1WITA 1P1ZB 4TTDC 1NCTA 2MCPL 1JXDA 1OVZA 5CJ8A 1KBBA 2AK1H 2OTUA 2CKBB 2ZF8A 5ACZA 3UMNA 2LU3A 1MCBA 1WG3A 4AH2B 3C5ZA 1IQDB 1M3IA 4FHBD 1J87A 3HW7A 2QJDA 3DGDA 2XYCA 3HPLB 5DQJA 5DMKB 1ZOXA 1F4YL 1RJCA 2OYMA 3UXFA 3MN8A 4FL4B 3DGGB 3RPKA 1GSMA 3TO4D 3KPSE 2XDHA 4B50A 1S9VB 3QDJB 1HINH 4XP6L 3QI9A 4HQQL 4D9LH 4EMZA 1JN6B 3AY4A 5DJCB 1BPLB 1K8IB 4XNZC 5LXGH 2L7QA 4XMLL 2HJKA 4WEBH 4UT7L 1MCSA 4ABWA 4KVNH 1X5HA 4U7MA 4OLWL 5CFAA 4Q0XH 1QRKA 2OJEB 2H32A 4NKIL 3OD3A 1KTJA 3UC2A 3NSJA 4X80L 5BZZA 1TYRA 4W68A 5IW6B 4KK9C 4Z0BL 3EO0A 1ZIAA 3VMOA 1XVSA 2X2IA 1T5XA 4G8GA 4HSQA 2F9BT 3FJTA 3V4UH 4F9LA 3UZEC 1Q0YH 3GS0A 1G7MB 4PU2A 1E4KA 3V6FB 1K3ZA 2XY2A 3FB6B 1QFUL 4NJAH 1KN2H 3QUXC 3IDXL 4P06A 1IT9L 3ZGIA 3UABA 5EF1A 4ABQA 2W8CA 2CO6B 5DS8B 1E8WA 3MLTA 5IT2H 4K94C 4GQZA 1ET8A 4YDKH 2FEJA 5CEZE 1NCBL 1AS7A 3VXQA 1A9BB 1MY5A 3V55A 3ZZLA 3MUY1 4HIXH 1C16A 2OZ4H 1LEKA 4JFZL 5DD1H 4ENED 3GIZL 2RGSA 5EC2B 3UJTH 3LXCA 1KGJA 3IK2A 4JPIA 4R0LC 4WSJA 4HWEL 1HHIB 4I3SL 1MFAH 4J3UA 1NMAH 3EADA 5EBLA 5MENE 2OMYA 4JGJA 4AEIH 2NNAA 4WWNA 3ZZ1A 1ZT1B 2FATL 4Z76B 1JZ2A 3P9MA 2PPFA 1HZLA 2XVBA 3U4BH 4LU5L 1DVZA 4AT6B 2UWEA 2BIOA 4OB5H 4XPAH 5D7JD 5DRNA 2WO3B 2YAPA 3M1OA 1GS6X 4X6FB 3T6ZA 2KZBA 5IVNA 3I85A 5D5ME 5HVHB 4ELME 2EEFA 4JPVL 1K3IA 3RLSA 3QCTL 4Z7OF 4AQ1C 4ERSH 5HDRA 1RJLB 5CMAB 4IBWA 4JFFD 1NC4B 1E7UA 2XA3A 2Y25A 1RD6A 5IB4B 5TF1H 4LHUG 3HIZA 2A0LC 3BAXA 3TEXA 4X5QA 4XCNB 4Z7OB 1T7ZA 1NBYB 3S5LA 1OALA 1Q8MA 3QEQA 2EO7A 4XBGA 3CCHB 5K1JA 3T08A 1MCEA 5D1XA 3W38A 1MWOA 5CEYB 3N1FC 2XX0A 3ZXAC 2FB4L 4QCIA 4J3VA 1JPST 3W5NA 5F93C 3P4OA 5CN2A 3FU8A 2E56A 1TPXB 3DIVA 3IMRA 2LTQB 4UYPA 3SE8L 5IMLA 5I1AB 3EHBB 4LPTA 4OGZA 4OTXL 3L4WA 4IDJL 3DYOA 3AQDA 1RZIA 5SWSE 2V2WB 1SUHA 5CLYA 1G87A 2EDXA 2CH8A 3GHBL 4ZFOL 4I4WB 1T2JA 2W0FA 3F83A 2EVJA 4GRMA 3U7WH 1EA9C 2DDQH 2R27A 1UUSA 1XR9A 2Z3FA 1I3RB 1MJUL 3BGMA 3CSTA 3LQZB 4N2IA 5CUSH 1VACA 4UT6A 4N20A 3DDFA 5IUSA 4JFDE 3ISWA 3QZWG 4NCC2 3HI5H 3OJDA 3OX8B 4QYOA 4D9RE 1D5MB 1JHLH 2VLJD 5D1QB 4YBLC 5ADOH 4M48L 3QEUB 5GS1A 1PGRB 3LNEA 3BFOA 5I26A 4O9HH 5KSAC 5E1QA 2FX9L 4QHNB 1AP2B 1VZGA 1EIBA 3U0TA 4JKNA 2VZSA 5ALCL 2MEJB 1IGTB 3C8DA 3NFNA 5E6ZA 4DK3A 1BW8A 4L8DB 2QL1A 1NKOA 2HLFC 5KYWB 4I87A 1SOKA 1RUPL 1T0NB 4NPYB 4R8WH 3NZUA 5F9JA 3FO1A 3SDXE 3L08A 2P48B 5EOQH 5F7WC 4LESA 4XH2B 2EXWC 1T3FB 4NNXA 4Y5YA 4PN6A 4Y1SA 4KMTL 5L8KB 2OR9H 3GKZA 1EK3A 4KKPA 1E6OH 3LN5A 5F44A 4KI5F 2PMZA 5D7LE 1LO3H 5FKPB 4QRRA 1AQ8A 4Z7VF 3B8YA 4FC3E 4K7PX 3ULUC 5GIRA 3PCYA 2NY4B 1A7OL 5B1JC 3M45A 1OM9A 3TBWB 4FCHA 4PCKA 5GRVL 1J8KA 2H9GA 2Y23A 3FULA 3RTQB 3GIVA 3QHZL 4XVOA 4U1NA 1NCAL 2W9LA 1JTOA 1S3KH 4R7LA 5IBLD 1HSAB 1U41A 3LEXA 4HT1H 1A0QH 4Y4HB 3F7QA 4P2RE 4MQ7A 3VNZA 3B3IA 3WS3A 2XT1B 5B39B 3MROB 4HJGA 4XR8C 4HV8B 4BZ2A 3D0LA 2IC2A 1ZLSL 1PY0A 2ILLA 3QPQC 2X4SA 4MKMA 4NAJA 2OSWA 4N26A 4HU2A 1Z5LA 2P5ED 1XF4B 3M1BA 4HBCL 2F54E 1FPTH 1MCQA 4UB0L 4RQQB 3EO9L 5F96L 2ENPA 5DVPA 3BP4B 5DJ0B 1I7UB 3GI9L 2KZKA 2XWTA 4GI9A 1TO5A 1U8CB 3I6LE 1FAIH 1K5NA 3F58H 4KJWD 1NCWL 4YL9A 1FE8L 2J88L 3NABL 1CGWA 1T66D 1JVLA 2AKRB 4GBXB 4PJDB 3ARWA 5E8PB 3RKDC 3IDYC 3LKQA 2AV7B 1DLHB 1LNUA 2IFFL 3F64A 4MDJA 3FRUA 2J8UA 2P52A 4P2OA 1BZ8A 3K4ZA 3HB3C 4GSUA 3UCQA 1BWWA 4QY8A 1ML0A 1XB3A 5AVUB 1OP5H 4EQ3A 5IP4A 1L9RA 4L4TE 3S7GA 4H7VA 5FYJH 1OQXA 2CLRB 4G5ZL 1FL6A 4M5YL 2AI0L 2DIJA 4WV1C 3VWKD 2ZXAA 4GB9A 4Z7UF 4X99B 1FSKB 4ZW7A 4ZJ9A 4L3CB 1MFVA 1OGAE 2HA1A 1LMIA 1KTLA 3FTVA 3SQBB 1MVFA 3PL6B 1JI2A 1ET5A 2UY7B 3EOBA 4Z3EA 3K81A 1J18A 4MAUH 3VD4A 1SLVA 4KMLB 4JY5H 1EUTA 1HCVA 2IAND 2NNFA 5C0ND 1KYUA 5DHVB 4NIKB 4LHJB 1AKJD 2VDKB 5A2AA 4FA8A 3K2MC 4GAJL 4OV6F 1Q72H 2X12A 4I13B 1IAOA 2CMRL 3QPKA 5F7DA 1ERNA 1SEQH 1WF5A 2FO1A 5FB8B 1GL4B 1URIA 3QDGE 1AZVA 3FK3A 1L3NA 1USZA 4Z23A 4A63A 4P4RB 4JQXC 1FNFA 3FAXA 2GIYA 4JO4L 1KFAH 2BFGA 1PFCA 3B56A 4LXFA 3OV6A 1BLNA 1GYCA 5PCYA 1A9VA 1K85A 2O6DA 2WO4A 5TDNA 5E0FA 2IPTL 5DI8A 4QXUL 3SOTA 4MMZC 2GBUA 1DQQA 1I9JH 2V33A 5HHOB 1IGYB 3AG1B 1FFNA 2V6HA 3MRLB 4DIXA 5HGHB 1E65A 3UDWC 2IFGA 4N0CC 2OMBA 2OSXA 4JDZB 1OW0A 1AZZC 5F9OH 2GVYA 1CFNB 4GOSA 2JCCE 4LARL 1QSEA 1MXDA 2OZNA 3SODB 1XTLA 3C2SA 1KIRB 5AD0B 3HG1A 2YC1A 3BUYB 4HX1B 5AOZA 3VDCA 1O5DT 3DSNB 3QIBB 4OH2A 1Z6JT 1A7BA 4QT5A 4WNQB 4PJAE 3UO1L 2CHNA 2HX7A 3EKCA 5C0DB 1NAMA 1KIPB 3QQ4A 4Q9RH 5E8DH 5HHQB 1MI5D 3E7JA 4UBDD 3T3PE 5AVWB 3HZYB 3ARPA 1WC7B 3FTWA 2W0PA 4XZ4A 3MX0B 2TSBA 1AXSB 1SUJA 3RG1C 3T9WA 3L3IB 3E2HB 4KHXL 1XH3B 3BP7A 1QVOB 3J07A 5JPNB 3A4AA 2Q7NA 3A23A 3WTSA 1R0AL 4S0HA 4LSVL 1KWKA 1H5BC 4F7EA 3TL5A 2P5WE 1U8NA 3V0WH 3VQ1C 2FJFB 2VABA 1VEOA 2PR4H 3CJJA 4ZD3L 5KOVC 2R69A 3EZ8A 1OTUC 2X9ZA 2HFTA 3CN3A 2R83A 3R8QA 3KPPB 1F5WA 3C6SA 4ZUWA 4X9YA 4NYLA 1AO7A 4ZUSB 1RK0A 2A6JB 1B3JA 3LOWA 2A9BA 3BLBA 1CLZL 2NYZA 1Q94B 3S2AA 5EDXA 5F1IA 1XF5B 2CAKA 3CK0L 5TPWL 3L3HB 4AM0Q 5J11B 4LF3B 5CHNB 2W91A 3NJVA 1U3JA 1ILUA 1EDQA 1A9EA 1C1EL 4M1CD 4F3FB 4OZHF 5IHUL 1QFPA 1XR8B 3ZYZA 4YPGA 3I50H 1TU2A 4R7VA 3TWCL 5ALBH 2MOVA 3BKML 1AFVL 1G1OA 3KYOA 4LGRB 5FWQA 4AMKH 1FO0B 1PMYA 3AMKA 3VFTB 4DO6A 3M07A 3VA2C 1A1OB 2D2CC 2F74A 2YPKB 5HBBA 4OZHB 3BKCH 2OX5A 1IC5H 1Y07A 3MUJA 3VI3E 2XQBL 4PS4L 1MHCB 4X4ZA 3CFDB 5H2BA 3UPRA 3SBWA 4JZJC 2MJWA 3CU7A 3SDCA 1RJYA 3BH8A 5ANMB 4GXUN 1D6VL 2DH3A 4BWTA 4H0IA 4YSOA 2BOLA 1CGUA 2XETA 1KTDB 4M6MH 3QXWA 3GWJA 3SJVA 3T8VA 3U4EB 4A68A 1FLRL 4NKDA 1LD9A 4XWOC 1KIUA 3Q5OA 5EZOL 1LO5B 2VXUL 4N3TA 1BG1A 4KZDL 1G5AA 4HULB 4UTBL 2WSPA 3MBED 5DK2A 1UGKA 1P9MA 2VXSH 1MCHA 1MF2H 3E3QC 4MA7L 4NBYB 1HOCA 5GGSA 1AD9B 2CDGA 3VYNA 2CJUL 1FV1B 3HC4L 1JE6A 4BZ1H 1LQSR 1GHFL 3O9WA 4LGPB 3FFCA 4LLWB 5J06A 3DDGA 1T20B 3VM7A 1EFXA 2XZQL 1SYSA 4UQ9A 3WFHB 3BP6A 2P5PA 1VFBA 5GZND 1EZSA 1YVLA 1TCMA 4X4MA 5E6SB 1OCWL 2EKJA 1SVCP 2R1WB 1IV8A 4ZXBC 3QSKB 5CGMA 4KKQA 3BJ91 2JB5H 2GK0A 4LPVA 4C56E 1A6ZA 1ORSA 1A6UL 3PIQA 3OBAA 3GUTA 25C8H 3OHXB 4JHUA 3UG3A 5JHLL 4QLRA 1OANA 2WCGA 4XOAA 1NGQH 5IW1A 2W9EL 1DSWA 1WZKA 2B20A 2K3TA 3GBNL 3U6XA 4MNQD 3QYCA 2QKSA 4G8FB 1YEJL 4O4YH 4YDVA 1ORQA 1QW8A 2AV1B 5L8JB 1DQJA 1YO4A 3ALWA 3RVUD 3QIWC 2CXKA 5FUCE 3V6ZB 4NC1E 2VJ8A 5FUZL 4IDLA 3U79A 2Z0BA 1KPVB 1GOFA 3AT8A 4G80B 1S5IL 1MVUB 2EDNA 4JRYB 2WP3T 1JL8A 3NA9L 5SX5K 4N0FA 1HXYB 3GSVB 5LDSA 3KPSD 4D3CL 1X4XA 4NDMA 3K46A 1TEGA 5KTEL 3FU9A 4RMBA 4B7IA 1EEQA 1U8KA 2NQ3A 3VQLA 1AJ7L 4G7RB 5IMKB 1TENA 2VJXA 2F68X 4O51B 4TOYH 2WXFA 5I6XC 4MKTA 3GXPA 3O3BB 3NUKA 1W15A 5J9PB 2E27H 4DETA 2EIMB 4GSDL 3CH1A 3UC0L 1I9RL 5ELIA 3DPDA 3NZHH 4MJIB 2ZG2A 3QEHB 3RZCB 3TH3T 2WXQA 3NP3A 4S0SD 4K8RC 4LPUA 4ORGB 1EEZA 1E0OB 1ONQB 4AMXA 3LVEA 4QTIH 5B1AB 3RJOA 1IO4C 2X88A 1A6AB 4WWPA 2VKWA 2EXYC 3HE7D 3KNBB 1U3HC 4I0KA 3WFBH 1F90H 2XQYG 1OGPA 2NPLX 1AANA 5GGQH 1NUNB 2IG2L 4OD1L 3NPSB 2GB2A 3U0PB 4OZ4A 5I18L 3ABMB 4GKZB 4MMYA 1W72H 1HTYA 4BK8A 3JQOB 3BGFB 4WJ5A 4PGBB 3VM5A 3WKQA 1HNYA 4QRFA 5EIVA 3WIFA 3GI8H 5CEZD 3KMDA 1FG9C 4K3DH 5ISZB 2BHZA 5EU6E 5AW1B 1C9SA 4FXGA 3UJJH 5H4ZA 4NM8L 5I1DB 3ETBF 2DB8A 4XE5B 3BP5A 5FYLE 1IFRA 1CICC 4Y5VB 1HE8A 1Z9MA 3TO4A 3TN0B 2C1PB 1KBVA 1P4LA 1FIGL 1DCEA 2N7BA 2R4RH 3V4PH 3N3EA 1N59B 4CADB 5ICZA 1AHWC 3MJGX 4NNYB 3K4AA 3QORB 1MRDL 2X1OA 1BXVA 2XACC 4Y2OA 4L18A 3SD2A 4YZFF 2Z8RA 5I5JA 2R0ZL 3FQNB 1TJXA 5D4JA 1WEJH 2ZTBA 2AHIA 2ZKWA 5EZJA 1N5YH 5EA0H 4XN4A 2X10A 4KKBD 1FL3B 1IAII 2NY2C 4IIQC 4P5SA 2XV2A 4UT9L 1IL1B 3BUPA 4B9JA 4U1SA 3BWAB 4TTGA 1VPOH 1J5HA 5F71A 2Z1KA 5EBMB 4HH9A 3AGVA 3C5SB 3AU0A 1R4XA 2VXTH 3ZDZF 1EANA 1XV8A 2B14A 4LPCA 3IDJB 5E2TH 5EO9B 2VYRE 1F4XH 1HINL 3FQ1A 4XB3A 1L0YA 4LSTH 1B0GA 4HA1A 1J5CA 1NPNA 2D7TL 4D9LL 1V7NH 5F0PB 3ZDZB 4FKKA 4RESB 2IH3A 4MSWB 1RKRA 1SJEB 4WEBL 5KANG 1QSFB 1ZHBB 5G4MA 4FQXC 1H15A 4KVNL 2R7EB 5ESVA 3CLWA 1M56B 2ZYHA 3IE9A 3EXLA 1IM3B 1CWVA 1XGZA 1NEUA 3IFPA 4RFNC 5I0YA 1RIUH 5MEQB 2FBJH 5TE6H 1S46A 3ARGC 1G0DA 3ATBA 1BOYA 2OTUB 1XH2A 3BAYA 2ZP8A 2F7PA 2N3JA 3QWQB 5ACZB 4K3GA 3B9KC 3V4UL 5F7MC 1TNNA 2J71A 5L2KD 1Q0YL 3NTCH 2XG4A 2AVFA 3C5ZB 4OCYH 3QG6A 3VW3L 4OCLC 5CD3A 2NY0B 4PJ8A 5DQJB 4DUVA 4NJAL 2FE0A 2OMUA 3IDIA 1KOAA 1KN2L 1ZWIA 1IC7H 1NFIA 5MHSE 4OZIE 1XGYH 2F5BH 2H3KA 3MAWA 2RQEA 4W81A 5L4JA 3WN5C 2V5RA 1CXHA 3SIKA 5IT2L 3QI9B 4YDKL 4PJIE 3CNKA 5HDBE 2ZXDA 3SE4C 1GIGH 4F80A 3L13A 4M5ZH 4WUKL 3ZO0A 1QTYT 4FNQA 2HJKB 4HIXL 2OZ4L 4F7MA 3EBAA 4JFFA 5DD1L 3WU1A 3ZIMA 5CR1A 5FGSA 1KGIA 1NMAL 2HTKC 2VITB 1MFEH 1TQCB 2H32B 2NR6C 2ZUQC 1TTAA 2P49B 4AEIL 3WD5L 3RUGF 4PI0A 1IBGH 1BZQK 2VW7A 2ATAA 3DOHA 3EO0B 3CVBA 1AGEA 3UBXA 4ANUA 3ZGHA 4ZMZA 3AXHA 2F58L 1EHXA 3RUGB 4FZ8H 5EU5A 1DQKA 1NOAA 3NIFE 5DEJA 4HWNA 2XXFA 3KHQA 4X4XA 1JCVA 4PY7A 3QCVH 2ORBH 2W60A 4K5MA 5K33A 4TSCH 5FK9A 3NZ8A 4PW4A 3X3FH 2PNDA 4F27A 3DTXA 3LZPA 1RLBA 4DFIA 3CZEA 3H2QA 2B3IA 1VFUA 2BVPA 2KC0A 4KO6A 3MLTB 4W6XB 2CLZA 4U1LA 3LKNA 1UD3A 2O26U 5TF1L 3VXQB 5TE4H 3EXJA 4O2FA 4J2QA 3V0VA 4PCTA 1PKOA 1TOXA 3ORJA 4M3JA 1LEKB 2QPDB 4M4PA 1MJ7H 4P4KD 4PW9A 3VXOA 2Z91A 3CV5A 4JPIB 5DXWA 4I2XE 5EBLB 3O2VH 2OMYB 2VWEC 3BAKA 4WEUD 4EN2A 2FZ3A 2IWEA 2D0GA 2VLJA 4A7GA 5F7HA 1IB5A 4DGVH 2NNAB 2PXYC 3MLVH 3P9MB 2UWEB 5DRNB 1V55B 4X6CF 2D7QA 3F00A 3VMNA 1D2OA 3DRQA 1GY1A 3WNNA 4NP4L 2YMTA 3HNSL 2I27N 1FUNA 4KTDH 1HEJC 3JWOH 3U7WL 2V9UA 3OKKA 1QLRA 4QTFA 2DDQL 5CD5D 5C08B 4YSCA 4PJBE 5FAAA 5HHNB 1XSOA 4POZD 1IAIL 5CZXC 3HI5L 5IG7A 3S5LB 2Q3AA 3QEQB 2FHBA 1OTSD 4XBGB 3WTTA 2F2HA 4XI5C 1BMGA 5D1XB 4O9HL 4P23C 4QCIB 3WBDA 2Q8BH 2AF2A 2XN2A 1ID2A 3P4OB 1KTBA 2VDNB 1KLFA 3ARDC 1MHEA 5IFAH 1JPEA 3GSNA 5CS7A 5DZAA 1KCVH 2PCFA 3DX6A 3PP3K 1P4IH 1HDMA 2HX8A 1OAZH 1RZIB 2KQNA 1WBYA 3REWA 4R8WL 1MFCL 1JF1A 3MYJB 4Y0GA 5EOQL 1PQZA 2NZ1A 1LWHA 2W0FB 4LLVA 4GRMB 5LO7A 1XMWA 3CU1A 5SX4I 2OR9L 4P9HC 4HFUH 3BGMB 1ETJA 1XR9B 4BQ8A 2P5EA 3N1MC 4UQAA 4L9LA 4LDCA 4RGNC 4BBWA 1VACB 4OM1H 2VDRB 1OF0A 3OJDB 5HHVH 2VQTA 3G5WA 4QYOB 2GFBA 3HAEG 5F7KC 1I1CA 4OUOA 2M2DA 1EAPB 3DBSA 5GS1B 1AR1C 4Y5XC 4RH4A 3QYNA 3SKJL 5IHZA 2KL6A 4I1RA 1YEDA 3V0GA 1S3KL 4PRPD 2WBXA 5EV7A 1ZE3H 3U0TB 4BKTC 3HE6C 4HT1L 4YBQC 3NFNB 4AYGA 4F2EA 5L7XH 4JVWA 5DJ2A 3CHXA 3G6AA 3NJHA 3P3TA 5DFWH 4JM2C 4U05A 1PZBA 1EO8H 2LE9A 1UENA 4RMTA 5DZVA 3T3MF 4A6YH 3MLUH 3FB8A 5F9JB 3FO1B 3JSSA 2F8XC 1SN2A 5BW7C 4P5RA 4CUCA 3H2PA 1C7TA 3K2UL 3ZDYF 4NNXB 4Y5YB 1IAMA 5C0CE 1T04A 4LB8A 1XHHA 3BSHA 3LN5B 3T3MB 2PPCA 4QRRB 5JO5B 3LPOA 4NEHB 1IUZA 1SXCA 5DZ9A 1UJTA 2GC7C 1NCHA 4P5TD 1CFBA 2YPLE 3UTQA 1YCSA 3V0FA 2H9GB 3G5YA 4XP9H 2CM5A 3WY3A 2A77H 4JFEE 3GIVB 2BFVL 2C9XA 2Z8WC 3IJ7A 4K55A 4P5MA 3TPKA 4K9EH 4BRVA 4XN1A 5DO2D 2ZJSH 3N06B 1FBIH 5D7IE 3FSWA 4W9FC 2FQFA 1JNHA 4MQ7B 4GRWB 2HSIA 3B3IB 3APCA 3WS3B 4GP4B 2OK0L 3FTYA 1DBKH 4JNXA 2A74A 3KS0J 3D0LB 3QUYD 4KKLD 3IJ9A 2VDOB 5FYJL 1KXVA 2X4SB 1MPAH 1KY7A 2W88A 3APMA 2BIPA 1Z5LB 2KKQA 4PWEA 3FYIB 5E5LA 3V0IA 3M1BB 3AT0A 4AYBA 2CGRH 1OAXH 1FORH 1IVLA 4AQAA 1N64L 5BVPH 1X5YA 1U3ZA 2PW1A 4MAUL 2J7LA 4JY5L 5ITBH 4HLZG 2DQHH 2XWTB 2BWIA 2CK0H 4ZX4A 1K5NB 1SRDA 5GJSL 2EDEA 1JXJA 5HPOA 1FN4A 3RB5A 4E5XA 2J8UF 1Q72L 2DKSA 1WA1X 3DJRA 1TZOA 4IRJD 3O2DL 3JZ7A 5DMJB 3ZYOA 5BPPA 3FH7A 1SEQL 3LKQB 3O4OB 4B9CA 1IGJA 4QRPA 4DO5A 4NFDA 1DJGA 3FRUB 2EP6A 4KJYA 4KVCH 1FYTB 2J8UB 2I5YH 3P2TA 4EBQH 2AQ1A 4P2OB 2Z9TA 1VCBC 1KFAL 3BUBA 3FN0H 2Y7QB 4QY8B 3V9FA 4BUGA 4XBMA 3BFQG 4K7FA 4LNRA 4KY2A 2L7JA 1FL6B 2D0HA 5FLVA 5AZ2L 1OWWA 4RZCA 3WXVH 2ALWA 2B3RA 4RWYH 3ARRA 4QRUA 3LB6D 1KTLB 2NRDA 1TJGH 3CTTA 5TJWK 4ZO7A 1QFOA 4N8VA 1YMMD 5F9OL 3EOBB 4NZFA 4FF9A 2KS0A 1HL4A 1YJDC 1NWPA 1B2YA 2ZWZA 3RBGA 2CLVA 4XAKD 1QW9A 4N0UA 3JTTA 5I0DA 2W9DL 3TA3D 4X7TA 3GTTA 3V0HA 1BZ7A 4XVUD 2APBA 3DJTA 4D9QD 1IAOB 3B7UX 5F7DB 4XVSH 3WUZA 4KK6C 4XMUA 3RWFA 2OR7A 4HEPG 3TZVD 1YHPA 2YJLA 4XPHH 4E68A 3NK4A 4Y16C 4Q9RL 5E8DL 3MFGB 3PWPE 2DJMA 4M7JH 1U8OA 4LVOB 4L3EE 3TV8A 3MQIA 2FSEA 4OD2A 4EZJA 1BLNB 4OKDA 2KDGA 5TDNB 3VXRD 5DI8B 2A9AA 5D2NC 1DQQB 2WY3B 2HKHL 4CAGA 1FFNB 4CC4C 1TCRA 2NT1A 4HU8A 1BD2D 4IBZA 1TJMA 2V9QA 3HI6H 1QHOA 4XCFH 1O6TA 3V0WL 2GUOA 1TQBC 4WY7L 4G8IA 2PR4L 4J3OH 2BSED 5BOZG 4KKAD 1OE2A 1QSEB 1XL6A 3G5ZA 3UX9B 1KENL 3NJXA 2YC1B 3SYAA 3RIAF 2V3FA 12E8H 3VFOA 4QT5B 3KZ8A 1ZCRA 3PP4L 2R56H 4G1EA 4MJ5A 5E9DD 3CMOH 3ARTA 2VUKA 3GXTA 3MLZL 4PJGE 1NAMB 3QQ4B 1RI8A 5D72L 3VGAC 1UJ3B 4R2GB 2DQEH 2CK2A 2EVHA 3HZ3A 5AW4B 1IBDA 3I50L 3FXIC 1M1SA 2C7UA 2X1XR 1KTCA 2N56A 3MBEA 4GXFA 5ALBL 5GRJH 5ADOL 4KTEH 5AZUA 3L3OA 4Q4IA 3DURA 5D96C 3QE5A 1J1PH 3BP7B 4FJYA 3MI6A 3M7OA 3BKCL 2X3CA 4RIRA 1IC5L 2CM6A 3BAEH 2XJLA 4F7EB 5BZDA 3EJJX 1U8NB 3FBQA 2VABB 4TUJB 1SLXA 4TQIA 5GZNA 2AITA 2QSVA 3ZPDA 4FABH 4DPBX 4ONHA 4E41E 2IBZY 2B1OA 5HHPA 4M6ML 4ZUWB 4MCMA 2WTPA 3RKPA 3MACH 4NYLB 1AO7B 2H0EA 4M6OL 2IGTA 4OLYH 1RK0B 4B5EA 1MW2A 4DK5A 5F1IB 1DANT 2DM2A 2EAEA 1CYWA 3G6JE 4N9GA 1MF2L 1F1GA 3MO1B 5CGBA 1CXEA 4BE6A 2QVFB 3KR3H 5TK2A 4JJHA 5TDPA 4YPGB 4MNQA 1TU2B 4BZ1L 2QSTA 3KYOB 3KDPB 1INDL 4R4BA 2YQ3A 2YGOA 3IGAA 1LO2H 2F74B 4GS7B 4TNEA 1NEZA 1BIIA 2OX5B 4AM0A 2ZAGA 5F9WB 4ONGH 1LE9A 4OCMC 3MRJA 5H2BB 3UPRB 5T1MA 3KYKH 3G5XA 2JB5L 5FGBA 4HKJA 1VRSA 3SDCB 1RJYB 1KGUA 3V4VA 3BH8B 3KPSA 3ASOB 2CWRA 1DVUA 25C8L 2BM3A 1UATA 2J2ZA 2K70A 4HUXA 3A3YB 4UQ2A 3F7PC 3SJVB 3V4PA 2PPAA 4NKDB 3DLQR 5EBGA 1NGQL 1LD9B 5CU9A 2CBOA 1KIUB 5HVGB 2EC8A 4OIFA 2FSDA 3H2WA 3SY0A 3VQ2C 2J57A 4DN3H 3S96A 5I15H 3ARFA 2AEIT 5DK2B 2YD4A 1AOHA 5B7FA 1P6WA 1AZCA 5K9QI 1UQSA 5HI5C 3K2IA 5EU3A 1JDCA 1Z5YD 2ATKA 3O9WB 2FEEI 3FFCB 2OSLA 4EIUA 4LCIH 1EFXB 1SYSB 5JW4R 3HE7A 4XOEA 3PF2A 3BP6B 2LU4A 1E3ZA 1PY4A 1VFBB 1HX0A 4TSBH 1P7KA 1SXZA 5T5FA 4A04A 2ZWLT 4FQCH 1YY9D 2WK2A 3PE9A 1I9IH 2FO8A 4L8SA 4DGIH 5CJBA 3BESR 3GHEL 2GK0B 4TOYL 5J6SA 4NZTH 1CC3A 1W0WA 2WD0A 4UV4H 1A6ZB 1ORSB 1QEWB 2BP0A 4FNSA 4NQSA 4F57H 4N2OA 3PIQB 1MDAA 1UHVA 3ESUF 3SDDC 3GUTB 3GKWL 1PAMA 1LEGA 4LOEA 4CMMA 3US1A 1A66A 5FYLH 4H0HB 7PCYA 2XYBA 2N1TE 2ZWKA 3G08B 3MUUA 4R97B 5D7SH 2WOBA 5IMOA 5IW1B 5EG6C 2JQZA 1KEMH 2B8OT 1WCQA 4EE2A 3FQXA 1HCZA 5MENA 3FBKA 1N26A 4JO8A 1ORQB 4YDVB 3H9ZA 3ARED 3VACA 1AMYA 4YXLH 1F90L 1DQJB 1GC1C 2QQQA 1U2CA 3T6QC 5DHYA 5GGQL 5J89A 1D6EA 2J5LB 4APQC 3WHE1 3FNKA 4Y9FA 1DVSA 5L88H 4IRSD 5IREA 1W72L 5CFHA 2Z64C 3OB0K 4N0FB 5MHSD 2D2OA 4NDMB 4XHJC 4YIQA 3TEUA 1QKZH 1JFHA 1D5ZB 4UNUA 5D5MA 2G5RA 1U8KB 3GI8L 4QRTA 4RMUA 3GDBA 4K3DL 3P3UA 2WP3O 3N43F 1OK0A 3UJJL 4F5CE 4JZNA 1EBPA 2AJUH 4MCYB 1VGEH 4ZNEE 5F9AC 2OM5A 4UWQB 1ES0A 3UTTE 3CH1B 4JHBA 1ASOA 5T5NG 4YS4A 3N43B 1DO5A 1CB4A 3FTUA 4NZUH 1KZYA 4IBVA 1EEZB 2CJTA 4D7BA 2WZ0A 3HEIB 4D0BA 4TYUA 4QMEA 4N85A 2NY3C 5DUPH 1ZLVK 2CR3A 3B9EA 3L2MA 4UOZA 4JY4A 1GTNA 4Z7NB 4YSEA 1ROWA 1OZTG 1N5YL 3HZMA 3VXME 4JGMA 4OZ4B 3K1KC 2BW5A 2VR5A 1IFGA 4MMYB 4P0DA 1G7PA 1VPOL 2A9DA 4DOHE 2WXKA 2YXWA 5B4MD 1N8ZA 4WJ5B 3OAYK 3ZE2E 4MD5A 3WIFB 1F18A 1CIUA 2ZPKH 4N68A 2MCMA 4A2FA 2DQIH 1F4XL 3IRZA 3CN2A 4FXGB 2FBRA 4P59L 4LCCC 2WBJC 1NC2A 2CUAA 3BHBA 3GMLA 5E5MA 1DJYA 1V7NL 5GRZA 3BP5B 3C60D 2HFFB 4JANA 4AEFA 5IGXL 3TO4B 1CFQA 3P73A 1GGIH 1P4LB 2JJTA 4HXBH 4MQXC 3WLBA 5ICZB 3KLQA 4XPGH 4R7NA 3HS0C 4P5KA 4Z7WE 4G59C 1RIUL 1UZGA 4L29A 4L4VD 3SGDI 3S4SA 2B5IC 5EZJB 2VZVA 3VRLF 4Q2ZA 4TUOA 4B97A 4NZDA 4W9ZA 4ZOEA 3IXTA 5DD3H 1CLVA 1NIFA 3NTCL 3PGCA 4U1SB 3ARQA 3A21A 4OCYL 1O6VA 1E9OA 4HH9B 1IVTA 3SDXA 1G84A 3ESMA 1ZA6A 1IC7L 3B5TA 1XGYL 3FSZA 2C9SA 1ZLUH 2LVEA 5IWLC 1R3JA 1B0GB 2FEEL 1KNOB 1NUDA 2X09A 4G9DA 1GIGL 4F58H 1IKOP 1RZQA 2BVYA 1I8LA 4NQCD 4OLEA 5D7LA 4ODBD 3FHQA 3SBQA 5E6ID 2IH3B 2F15A 5J3HC 1IRAY 3SO5A 1URLA 3CUPA 2IAMD 3UEZA 3OKOA 4XN9A 2B2XH 5ESVB 1T1ZA 3NFSH 1GGUA 1IQWH 3IFPB 3U46A 3PJSA 2W81C 4ZFFA 1BQHG 2D7PA 1SNRA 2APSA 4HWBH 5I8CA 5AAPA 1ACXA 5I8KH 1IBGL 3O6LH 1GVIA 3RWGA 3PWLA 4UTAA 3BCFA 3EH5B 1LWRA 4AYID 1NUFA 3VWJD 1NIAA 4FZ8L 4F2FA 4KGJA 2AQSA 2XG4B 4PRDA 3QG6B 4MB5A 3QCVL 2ORBL 3MV8E 3V0JA 1KGCD 4ES8A 4F1ZA 2P45B 3FTZA 4PJ8B 1MEXL 4TSCL 3C9NA 1HE7A 2OMUB 3IDIB 3X3FL 5C0EA 5J57B 4HCRH 5B3JF 5KSBA 4K5NA 1NFIB 3BWZA 1IGML 1NGYA 1QASA 1H6FA 1X6LA 4XMKL 4HD9A 2ICES 5TE4L 4PJ7F 1RUQH 2VW6A 5FYKD 3MJWA 5A7EA 4F7MB 4JFFB 3GLZA 4JFYA 1MJ7L 1UD8A 2AQ2A 5TFSH 3FUKA 3FB7B 1BFTA 5CXPA 2R1XA 2OL3L 4OFYA 3O2VL 2OLDA 2W0KA 2EDKA 1Z9NA 5J1AA 1FVDA 3IB4A 4DGVL 1WFOA 3BE1H 4PRIE 4OLVL 4MASA 3MLVL 4QDGA 4FCAA 3W0WE 1AGEB 3UBXB 1U42A 4WO4D 3OQ3B 4A6YA 1Q0XH 3LPPA 5I1LA 1XIWD 5EU5B 3EJZD 2W65A 4X4XB 3I9GL 4L4TA 4OGAC 4PY7B 4PGJA 5KAQG 3TF4A 2W60B 1BBDH 5FK9B 3NZ8B 2X4NA 3AG2B 1PLAA 3B2PA 3DTXB 1XBDA 3PREA 4KTDL 3GJFK 5BXFA 2BVPB 1DEEA 3IGFA 4P2AA 2CLZB 3OKEA 3ULVD 5CJOL 3BX7C 4NENA 4U1LB 3LKNB 3TNNA 2PW2A 2IVFC 4O2FB 2RMNA 4PV9A 1EO5A 4QRQA 5AYUL 4FQLH 4JR9H 4I3SH 3VXOB 3Q06A 4MXQC 3U30B 1OF2A 4W4NA 4M7ZB 2PCYA 3O6KH 3Q6FA 3S6CA 1HL9A 2C4FU 2FZ3B 2VLJB 2Q8BL 5E24E 1DBJH 4BSJA 3QDGA 5D7KE 3K8LA 3TOPA 3FB5A 5IFAL 3ZKNC 1PG7H 4Z95H 5EZIH 4LCWE 1KCVL 4K4KA 4TQEH 1OD7A 1P4IL 3S35X 2AQQA 1NCUA 4N2NA 3HRPA 1OAZL 3MRNA 2D73A 4HMDA 3S3DB 4EOWH 3WTVA 1L9SA 3L45A 2X4OB 3DRQB 3MNZA 4JLRA 3V6OC 1CI5A 4EIGB 3KLLA 5F8QC 2BLFA 5F6HJ 3N55A 3NA4A 4ZMVA 3B2VH 3OKKB 3AVEA 1DSFH 1QLRB 4HFUL 2HT2C 4KI1A 5ACMA 4FL4C 4BINA 1MCKA 2F8VA 2O5YL 2KERA 4OM1L 4YWGH 1N67A 4XPTH 3ZE1F 1H6TA 5HHVL 5IG7B 2JCCA 4EKXA 1V54B 3VCLB 3WN6A 3WNPA 4ZYKA 1B4RA 3GMRA 4J3SA 4GG6A 3ZE1B 4H40A 4X9GA 3FZUD 2XX1A 2WB7A 5HYEA 1UD5A 1KLFB 5FW8A 1MHEB 3GSNB 3M46A 5IJVA 4IGBA 4LEOA 4YGAB 5I75B 2PCFB 1JK8A 3DX6B 3U9WA 4MTMA 1HDMB 2EH7H 4J23A 2BNQE 1EO8L 4HWZA 1WBYB 2PP9A 3REWB 4LBAA 4P2QE 4HALA 4A6YL 3MLUL 1JF1B 1NWOA 2EILB 1PQZB 3VFUA 4LLVB 4CVXA 1JGUH 3DK0A 2VDLB 1U8JA 4N5ED 2P5EB 1CT8A 4L9LB 2OYKA 5DU7A 2J6WA 4BFKA 3PWNA 2FECL 2F7RA 2GFBB 4DW2H 4JFTA 1NSNL 5D4HA 3ZDXF 2YMXH 3KGTA 4IJTA 5IHZB 5JOPD 4MZ3A 1AXIB 1WPCA 3QQXA 1YEDB 2P8PA 2GJ6D 3BVVA 3QH3B 5KUKA 1J1OH 2MKWA 4L0ZA 4K9EL 1OTTD 2ZJSL 1FBIL 2D3VA 3JWNC 4KKZA 2K6YA 1AH1A 4OZFH 5DJ2B 3G6AB 2WVUA 2G3XA 4KQ0A 2NY6D 5DK3A 2JB6B 1VIWA 3FB8B 2BS71 3LKRA 4G3YH 2L04A 1FCGA 3WFEH 4QLWA 4V1DE 4S1RH 1F6LL 2PPEA 5HGAA 2CGRL 3H4FA 4IJ3B 4YZWA 1F45A 1OAXL 1FORL 2E0PA 5D2LA 2GEQA 1T04B 2XTJC 7CGTA 3IWVA 4KH2A 4EI5D 1MOEA 1RIHH 1XAKA 4MS8D 1A4KA 1EGJL 3S9DB 2DQHL 5I30H 3IMBA 5INDA 4Q4EA 2CK0L 3UTQB 4NWTL 1YMMA 3G5YB 5B7EA 3D8MA 1EZUA 3MNMA 2VUOA 3OMZA 4JHZA 3R8BB 1OLLA 4HJTA 1LDPH 5ABZA 1UM5H 1AKJB 1IZJA 4P5MB 5GZOC 1X5JA 3TA3A 5LG1A 1BF5A 3ULUE 2XFXA 4EBQL 5DRZA 1DQVA 1JNHB 3E6HA 5JDJA 3FN0L 3KE0A 4R4NC 3TZVA 5DHXB 3UIZA 4P46A 2P80D 2YEVB 1E2VA 4GP8B 2A74B 3L8QA 1A8ZA 5KSUA 4XTRC 1SOQA 3VTTA 2YUVA 5KS9A 4NZ8A 3IJHA 5I16B 5FX3A 3NBNA 2X9YA 3WXVL 2X2UA 2NSMA 3FT1A 3KLAA 2E7MA 1F4HA 1TJGL 5HI3C 4AUYA 5JA9A 3G9VA 4AQAB 1J11A 3QFJE 3ZDWA 3EH2A 4E41D 3A4FA 1KBPA 1FNEA 1CDGA 1P7BA 1BD2A 3UZQA 1LGVA 1QBML 1IKNC 4A2MA 1M6UA 3BQVA 1FN4B 2OMVA 4E5XB 2WN2A 3T0ED 4PWFA 5IB5A 3IM1A 1MUJA 3LZFH 1T03H 2VLKD 2YA2A 2AJYH 5F2FA 4XPHL 1RK7A 1V8HA 1IGJB 3KGRA 2Y2TA 4ABVA 4M7JL 1JXFA 4H2AA 4KJYB 4XGZA 4LEBA 3G9AB 5E9DA 3KYNA 1MFDL 1WUZA 5F6IB 1RVFL 3WFZA 2C7FA 4HHWA 1YYLL 4HD5A 5GGTH 4A38A 4ZQKA 2HT4D 3F2LA 3N85H 1MI5B 4FZEL 4K7FB 4LNRB 4AGNA 3QZNA 2BNRD 3NZSA 1OARH 4RZCB 4ABUA 3RGVD 2AK4E 5E99H 5GS0C 4RAVA 1IE5A 3HI6L 4XCCL 4EF3A 1NBZA 3QXAA 4Q89A 4N8VB 4XCFL 4NOFA 1EUUA 2EUXA 5AB0A 3MCG1 4A67A 2CLVB 3G3LA 4JN2A 4N0UB 3JYCA 5FW7A 3JTTB 4JRXD 4HUCA 4X8XA 1AI1H 4X7TB 2SEBA 1BZ7B 3NCJL 4HGKC 2HMIC 1PY9A 5KUMA 2E6PA 4KI5C 3RWFB 1A7NL 3RTQC 4XO9A 3DUUA 3QIUD 1EJFA 1T2QH 1YYCA 4KKRA 4TMPA 2L7EA 1U8OB 4CGUB 1H8LA 2DQEL 1AGDA 1TITA 3DX9B 3VGEA 4OD2B 2FSEB 4Y4HC 3BZDA 1DJSA 3P4LA 1B2WL 5GRJL 2HKFL 3WY2A 4ACPA 4UQEA 2QSQA 1UG9A 2QMKA 3AUVA 2DQMA 4GAGH 4KJQC 4KTEL 4NRYA 4PD4J 1J1PL 4WI2A 3Q1SH 1TCRB 1ZLDA 3FHAA 2K8MA 2DWDA 3BAEL 4KJPD 3KWTA 4H20H 3QXDB 2GUOB 4LP8A 4XCYA 3D7PA 3TBBA 1LM8V 1GSKA 5ECJE 3SOBH 5EU6A 1JUFA 4FABL 4GIPD 5E7FA 4MBRA 1EBAA 1AIFB 3G5ZB 2XIIA 1IC4H 5C0FA 2K45A 3MACL 1OP3K 3VFOB 4AUJA 4MJ5B 3AM8A 2ADJA 4G1EB 3EYSH 3R0MA 3RU8H 5I73C 4WTQA 2WQRA 2ZUSA 1AXTH 5HYSG 5KBDA 2ITCA 3KR3L 1RUKL 3AC0A 2C7UB 3MBEB 5C3TA 1NGPH 4WI0A 3L3OB 2ICEC 3NQKA 4LLMA 3KLHD 4RIRB 1ZD6A 1WTGT 3ZBMA 4BFRA 3BUIA 3IRCA 1J0JA 2BHUA 4WEMB 5BZDB 1INEL 3T2LA 3KYKL 4YK4B 1FSKC 4HEME 5C09E 3Q3GA 5F7FA 4MWFA 4PJEF 2MCAA 1J5IA 4PBDA 3OLIA 4AIZA 4WF7A 1GMEA 2WNXA 3ARBA 5E4EB 3CVCA 4L1LA 3FF7A 1NM4A 4ONHB 5HHPB 1GY2A 3BRDA 3GXMA 3CLEH 5JIQA 3SE3C 1X5GA 4POYA 1LVEA 2Z0UA 2ENYA 2FQDA 1BAWA 5I15L 1ZK9A 3HN8A 5H35A 3UPAA 1AYOA 4N9GB 2AEQL 3FUFA 2G5BA 1NGWA 4GQRA 1U58B 2WXPA 1PZSA 4BCZA 4PLKC 5TDPB 3SDYL 4MNQB 4PG9A 4AOFA 3VI4A 4LCIL 3NFPA 1L0XA 4R4BB 3H4HA 4XWGH 5AYQA 4Q14A 4QGYA 1HI6A 2YAMA 5IQ7L 1NEZB 2CRYA 4NQDE 1BIIB 4PD4K 4TSBL 5G2NA 4AM0B 4FQCL 4DGIL 2WKOA 1I9IL 1LE9B 1X4ZA 4HS6A 4ORZC 3NEOA 2QVMA 1QLEL 2QEJA 3CAFA 2DQDH 3DV4A 3G5XB 2XZAH 4IRSA 5T1MB 1DHKA 2OI9B 4HKJB 5JLZA 3STZA 4OZIA 3V4VB 3KPSB 4NM4H 3RBSA 3B7SA 4WUUE 4ZPVA 3TBCA 2VL4A 5T3ZE 3S37H 1WWWX 7FABH 2A9MH 3FRPA 3FO0L 4HUXB 2MQ3A 3VVWA 3V4PB 5FYLL 3MLRH 2H8PA 1R5VA 4KBPA 4LLAA 4JL1A 3BT0A 1FHNA 1KEML 2NXYB 3E9UA 4G70B 3K6NA 3SY0B 1LO0H 3S96B 1YAZA 3ARFB 1GR7A 1M7DB 4P2YA 3QQ3A 3ZE0F 1UQSB 4Q58C 3OPZL 3T4AA 4YXLL 1PAZA 4C83A 4GMTL 4F8QA 1VDGA 3EGSA 2ATKB 1QNIA 2OSLB 1GAFL 4M7LH 3HE7B 1MFUA 5L88L 5MI0B 2BZ7A 2NSXA 1BMWA 1TZGL 1J8SA 1P7KB 2D7MA 2NTSP 3QUGA 4Y2DC 3ZUNC 1OT4A 2NUTB 4FFYL 1QKZL 1M7UA 3ILDA 4OLUH 3N40P 1T1XA 2JCWA 2WWKT 1XEUA 4FLQA 2EDRA 1XQ4A 3I02A 2AJUL 1W0WB 4NQSB 2BP0B 5FS5A 2GBVA 1LEGB 4KZEH 2E8YA 4ZK8A 3QS2A 2A73A 3WDHA 3LRGA 3RY6C 5IMOB 5BS0D 3BIBX 2MNJB 3M8OH 2X7LA 5D93C 5IFJA 4KK5D 5AW2B 4HWBA 2BVTA 3OKYA 2OS7A 5DFVC 5DUPL 4I2XA 3GO1H 4U3CA 3FQXB 4UI2A 2YUXA 2V17H 3I3BA 2D8KA 2DWTA 4BFEA 5DHYB 2Y72A 4CC0A 1UKQA 1D6EB 3CSBA 5JPMA 2PCXA 3MV8D 4L4VA 4DEUA 1JZEA 3CVDA 4OBSA 4BQ6A 3BUDA 1W16A 2GBTA 4TTDD 1IBYA 2WLZA 4PBXA 1FVEA 4GY4A 4HCRA 4YIQB 3ASNB 4DFHA 4OZGE 4OFKA 3GMQA 2WVSA 4L37A 2R0LL 4M9OA 4QRTB 5D5MB 3BH9A 4XO3A 2PLTA 4JZNB 1MHPH 2IO5A 3ZW3A 1ES0B 1LK2A 1JMZA 1ZV5A 2VH5H 4PJBA 3VDAA 5DJXA 3EDJA 1TG8A 3QCUH 3OF6D 1PJ9A 1WAPA 3BVXA 4GXUM 3RIFK 5GS2H 1UZ6E 2CZNA 1MZYA 1NTDA 3N41F 2MWCA 2PKDA 4XPGL 3TPUA 4D0BB 4LPXA 2NDFA 2NXZD 2R29A 2IAMA 2YQ2A 1C5CH 3DYPA 3VD9A 3U2JA 4JY4B 4Z8FH 5BRZD 4DAGH 2DQCH 3UGUA 2GYSA 5FO2A 3HZMB 4WKXA 1OCZB 5DD3L 4K2UH 3GDCA 4GQQA 1TJHH 4WTZG 1G7PB 1J0HA 2CCVA 4KK9D 1N8ZB 2V7HA 3ALPA 4MD5B 1ADQH 3VWJA 3V5KA 1TFPA 3CSFA 3RI5F 1GA2A 4U0QB 2XN9D 3NIDE 3S5YA 2QADD 3QJQB 2L7UA 3WNIA 4ZX5A 5K1NA 1NC2B 3GMLB 4KAQH 3BHBB 4YUEH 3NJMA 5E5MB 3TYGL 3VMPA 5B3SB 1BA9A 4F58L 1J7VR 4JANB 2YRBA 3QUXD 1CFQB 1AGCB 2BCKB 1RZGA 3GSOA 1C5DA 1EXGA 4JHAL 4WWKC 3K3QA 3OHXC 3TCXA 3WLBB 4OFIA 2B2XL 3UBXI 3CZKA 3NFSL 4R7NB 1IQWL 4P5KB 2Z31D 3G04A 4HWBL 3SE9H 1NIEA 1NMBH 2QZQA 4L29B 3CFEA 4HC1H 3O6LL 3MR9A 3S4SB 4JFUA 3UPCA 2XRAL 4Q2ZB 4TUOB 2EZ0C 3GUFA 2WWNA 1KCUH 3IXTB 3QJXA 3IRPX 3PGCB 1DDTA 1E9OB 1K72A 4WO4A 3SDXB 4YMPA 2ITFA 3ALXA 3WNLA 4AVKA 4ZTPH 2BY2A 3I75A 3FONA 1R3JB 1T0MA 1VZHA 4BH8A 3D4ZA 4G9DB 3VX1A 5D7LB 1KGWA 2BSBA 4ZMLA 1E27A 1MXGA 3AS3A 3CZFA 3MA9H 2YPLA 3CUPB 3OKOB 2UZXA 1NL0H 1E4XH 3QISA 1T1ZB 4FJ6A 1WD8A 4KROD 2R2CA 2I9LA 4GNKB 4ZFFB 3U46B 3PJSB 3D85D 1F1AA 5I8CB 4P4KB 2VSMB 3GD1C 2NCMA 1S7TB 3O8XA 3RWGB 1YG9A 3WS6C 3ARSA 1JVKA 4K94H 5D7IA 5JMRA 4ZW6A 4HSAC 1OSEA 5KSBF 3KM1A 3TCLA 5IJKC 4PRDB 1BBDL 3C9NB 3T2QA 5C0EB 1KPRA 5KSBB 1NPJA 4N6RA 3MXVH 3DX4A 2CHZA 2DIEA 2E86A 3AS2A 3UTPE 1NGYB 1KCKA 3JV5A 3GBEA 3MREA 5D8JL 1Y1UA 3SO3C 4ETQA 3MV11 4QGTA 1YQVH 2OAAA 1T4KB 4H8WL 3WJLC 4IKLA 1A64A 4JR9L 1EEYA 4JFYB 4N1CA 3VSTA 3C09C 2Q1EA 3TN0C 5CJXA 2NNRA 3QDJD 1FRGH 4WI7A 3O6KL 3WKYA 4OCWH 5KYXA 3EF4A 1P2CA 5HYIA 5ICYB 1FVDB 5J1AB 1DBJL 3QORC 3OQRA 3HPJA 1E30A 3EOTH 3PUCA 4OZFA 1LLAA 3CC5A 5JIHA 1PG7L 4NUPA 4Z95L 4GMSH 1KCRH 1UD4A 4MA3A 4X98A 2PO6A 1G7IB 3PQYD 2W65B 4GUOA 1FA4A 4L4TB 1QAWA 2AAVA 4X6EA 5GSRA 3LMJH 2X4NB 4OFPA 3Q2WA 4OQTL 5T3XD 1Q90A 1JBJA 5BXFB 4KX7A 3BQUA 4AGPA 2VN3A 1DEEB 2XIBA 5EEZA 3ZMEA 4KK8D 3TNNB 4NENB 5HVFB 4FJZA 1CXLA 1XB6A 4YWGL 1EJOH 1U9KA 4XC1H 1JZGA 2WLNA 4ANXA 4ZFQA 3P3RA 4PV9B 2YAQA 4P3DA 2JELL 3FU0A 4WK0B 2E7CA 3EYOA 2WMPB 3MRFA 3L6FA 1OF2B 2VE6A 1IMHC 1VFMA 1TT6A 5DGQA 2ZNWA 1DVFA 4XX5A 1G1KA 5LHDA 4WW2F 3QDGB 3CVIH 4RX4D 3HAEH 3FB5B 5H4YA 1MRFH 4LFHD 4NQED 1Z9LA 3MUHL 2EH8L 4ZBJA 4L3EA 2GW5A 4YDLC 1L6XA 2DLGA 2EH7L 4X5RA 1BWMA 3MRNB 3QG7L 4G43A 5T33L 3MNZB 2MQ0A 3LH2H 3VGDA 4KQ4H 5F7BA 1B88A 3ZQWA 3P3YA 4PSRA 3LQAH 2A1WH 1FFRA 1AD0B 1JGUL 2NY0C 3OKLA 4LVHB 3PAVA 3PNRB 3V7AE 5JUEH 2O61A 2GQHA 1NM9A 2FGZA 3GRWA 4GG6F 3APFA 5A2KH 3SGJC 4EI5A 1P6FA 1A47A 3AY4C 4NQUA 4Y7OC 4ZYKB 2Z7UA 2VISB 1MJ8H 2VR3A 3STLA 4ICXA 3THMH 4FXKB 4GG6B 4OF3A 5BUAA 5AB1A 1J1OL 4UM9D 3VB8A 5DO8A 2JLPA 1JZJA 3N40F 4GEIA 4JFSA 5HY9A 2NY1D 3WLWC 4ALAC 5GRYA 5IJVB 5GGTA 5EEVA 3K74B 4IGBB 4LEOB 4RETB 3RKDD 3T3PB 1M53A 5I0ZA 1JK8B 2OXHA 3ULUH 1QO3A 2WQVA 4PGCA 5FHAH 4HWZB 4ELMA 2P42B 1VADA 1U33A 2AK4D 35C8L 4ZSOE 4G3YL 3EJCA 3WFEL 3LKPA 4BSVA 3HB3D 3EGDB 3VFUB 4HPOL 3NIGE 4BFIA 4CVXB 3DO4A 3B83A 5D6CA 1R3HA 3EHBD 1U8JB 1RIHL 1CT8B 1VA9A 1VEMA 5I30L 2VLMD 3KH4A 1U8IA 3PWNB 4IBUA 5KJ7E 3OAUL 3T8MA 4E41A 1J0KA 5EUOA 1R3IH 5IK3A 3SGEI 1VCAA 2IXQB 1G5GA 1V7MH 2X28A 6PCYA 1LDPL 2DJSA 4HLZH 3LRSA 1UM5L 4F7TA 3T0EA 3KVPA 2YPVL 5D7EA 1ZE3C 4LFHG 2ATPA 2OYPA 2VLKA 3LHPH 3ZTDC 1L7TL 4A7UA 2B4CH 3CMGA 2Y5QA 3QGVA 3D1MC 3JV6A 3KBHE 5JW4Q 4PGEB 3LKRB 2QQNH 1J12A 5H37G 5IBTH 2H1PH 2YXMA 3V6BR 2ZX9A 2UX6A 1AGFA 1H8OA 1PTZA 1SXBA 5HGAB 1W0YT 2WQSA 5D2LB 3H42H 3UACA 4W9DC 1CR9H 2JI2A 5INDB 4W93A 1WE5A 1FGVH 1YMMB 2ZE0A 4HDIB 2B9AA 4S1SH 1G43A 3CPLA 4OGXL 2VMCA 2YQGA 2E9WA 1U4FA 3LZFL 4K73A 1T03L 4PR5A 2IPKA 3NYKA 3UL4A 8CGTA 3VSUA 2AJYL 2NNXA 3LEYH 1SF3A 3TA3B 5IHBA 2D4DA 2YK1L 2XFXB 4KNTA 3REVA 5DJ6A 5DRZB 1I3GH 1HQ4A 3E6HB 5KS9F 2V5YA 3TZVB 1B0RA 3SQOH 3QIUA 1IGFL 3NDYE 4P46B 1MIEL 5GGTL 4PIRF 3LN4A 5KSUB 3MMEA 3HJEA 1JGVH 2BCMA 4UOW1 2VB5A 3BVNA 5KS9B 3GMNA 3IJHB 4ADJA 1EWHA 4QIRA 4I0CC 3U6XS 5C0BE 3VXRB 1PLGH 5E99L 3KLAB 4AIOA 3SDAA 3HLKA 1YPZE 3NDZE 1ESOA 2FD6L 2OXGA 1PD6A 1D5XB 3EOYG 3IMTA 2YBRA 3VXUD 1FNEB 3MRQA 4AE0A 1BD2B 4LP5A 4LNVA 3UZQB 1F13A 4GW5A 3P11L 4BYHA 2HH0L 1AI1L 1Q9LA 2OMVB 3LZNA 3QFDA 5IB5B 5C3LD 1OP9A 1LK3H 4WHDA 1MUJB 1VFOA 2J25A 4HP5A 5HPMB 4PTTA 3LV3A 4W9KC 5IVZB 4Y9EA 2F0CA 2NNCA 2GAZA 4XGZB 1L6ZA 5E9DB 1KB9K 3KYNB 3L9RA 5H8DA 5L0QB 3CBRA 4ZQKB 5K69A 1BQLH 3P2DA 5CEXA 2BVOA 3U9PH 3N6YA 1JZIA 3IAQA 2X87A 4O2CA 1TKWA 4RAVB 4H20L 4NKMA 1NBZB 3QXAB 2QT6A 4NFBA 1JV2A 4I1NB 4JPKH 2R2EA 1OCRB 1WRFA 4M1GH 5LBSH 2VLRD 5K59E 5EEYA 4JN2B 5MEPA 4ZNEA 4F8NA 1ED3A 1IC4L 3NACH 3MDJA 3UTTA 3IS1X 2SEBB 1DBBH 2AXFA 2E8ZA 2WWMC 3VTMA 5DQ9A 3PL6D 4NZJA 3EDEA 3DUUB 3WFDH 1Z9OA 1UOLA 3RU8L 4L2YA 3BD5A 3GS4A 4FQJH 4DGUA 4WAFA 4G11A 3CN1A 4WFHD 3MOBH 4MDIA 3DMMD 1AGDB 4UM8A 3OAWA 1OM3H 4MRCA 2R1YA 3LPWA 4KX8A 5DSCA 3NJGA 1NGPL 4LKCB 1UTDA 4RGOH 1MAML 3RWEA 2BZCA 4QHKJ 3VXMA 2HPTA 3WUWG 4FLOA 2P9RA 4HS8H 2V2TA 4AKPA 4FYTA 1OK8A 4QO1A 2DWDB 4X0KB 5JORA 2VDPB 2DIAA 2X42A 3FUEA 5B39G 5JW4M 5CCGE 4X0NA 4XCYB 5JNYA 3Q6GL 1G94A 2V5TA 5EU6B 1LWJA 3A22A 4UIMB 5KANI 5D2NE 1ETA1 1GYAA 5J12B 4M5TA 5T5NF 3BN9C 2GJZA 3UP1A 5C0FB 3OC8A 4OLXL 4XNQA 2VSDA 5T1DH 4YHOH 1MW1A 5T3ZH 2ADJB 3VU1A 3VFSA 3FTSA 4PGZA 3P0YL 1KJ2L 4UAOB 2ZOOA 1YYMH 3D05A 2YEQA 4RMVA 4N8CH 4HK0A 3EF7A 4IBQA 3WMPA 5CKGA 3S97C 3QIBD 4WI0B 2UXTA 5D1ZD 2WYIA 4XWGL 1THCA 3QYMA 3MV9D 4LLMB 3PP3H 3RWIA 3TC9A 1NJ9A 1YMHA 2CDEA 5FYJU 3GQFA 3UERA 2FCBA 2JLLA 4PYGA 4GKLA 3TH2T 2DQDL 2XZAL 3CVHH 1KXHA 1PKQE 2QKIA 3FUNA 3Q3GB 4MWFB 4NM4L 5DD0H 4AIZB 1BF8A 1UCBL 1WT5A 1Z0MA 3ARBB 3S37L 4BSWA 4OM0H 2A9ML 1A7QL 2K8QA 4OD3H 4B9FA 1FP5A 2B59B 3DXAE 5TDOB 1D7FA 2XZZA 1A65A 1CDYA 3FT3A 2O6PA 5I28A 4PJFA 5JXED 2IF7A 2QGBA 1LO0L 1ROCA 1J0IA 4OSUH 3X1GA 2VAAA 5BS0A 2G5BB 4PJXA 1NGWB 1QATA 4LRIC 5JQ6H 1MCPH 2TRYA 2HKAA 3GM8A 4Y9BA 4PG9B 4HPYL 5A2FA 3VI4B 2EICA 2UZPA 4M7LL 2YSTA 1BJ8A 4M62H 1COBA 4N24A 4PWKA 1QQDA 1UACH 4EXPX 4AEEA 5FGCB 4AYSA 1YNLH 2Q7AA 4U1GB 4NC1C 3L4XA 3QT2A 1X7QB 3MV8A 4HS6B 2NYKA 4OLUL 4AJWA 4IRSB 3DV4B 4ZO9A 3OL2A 3STZB 2C3XA 5JLZB 3BEVA 1OW0C 2MTAA 4KRPC 2AXHA 4ZPVB 1UFUA 3FRPB 4WHCA 2X89A 2D3LA 4I7ZC 4NKOA 5FUOH 2H8PB 1R5VB 5JMOC 2YBGA 2DWXA 3ARYA 4NRZA 3FT9A 5GS3A 3H0TA 2TAAA 5I23A 2MTPA 1F4AA 2VN6A 3SY6A 5DEFA 1OD9A 2XN1A 3OF6A 1OL0A 2NZ9C 3QQ3B 4PJCE 3SKOA 1MHHB 1IGIH 2P28B 3T4AB 2I9TA 2V17L 3S5ZA 4C83B 3D39E 1QUNA 1UJ3C 2N0KA 4R2GC 5DTFB 5CLTA 4LMQI 3WYRA 1HYSC 4X8GA 3LZQA 3QBTB 4G1MA 2CXGA 2Y4SA 4PLJD 2XPGA 3NIFB 1U3NA 4FLRA 2ZSVA 4K8RH 5C97A 4EO5A 2AZAA 1T1XB 2NY2D 1U2YA 2FLMA 1IJ9A 1WAAF 1MHPL 3I02B 3BO8B 3AS1A 3CFJA 2WWKO 3KLSA 2VH5L 4HUUA 1G9MH 1YN7A 3NCYP 3UZEA 4N2GA 2A73B 3P30L 3HLAA 4JQIH 4X9IA 1PCXA 3I6GA 2X7LB 3CXDH 3WTYA 4NQXA 5IFJB 1F3JB 2LFGA 3QUXA 2BOBA 2GJJA 4I2XB 4YEFA 3DHMA 1C5CL 4PJ9D 4JM4L 5HDQH 2JK5A 4N1HB 4Z8FL 2V2XA 2DQCL 5L4FA 4J27A 3LKOA 3BVUA 4FYSA 5JPMB 1XO8A 4L4VB 4DP2X 4K2UL 3W1ZA 1TJHL 4R0LA 4YSQA 5KAQF 5BOJA 1BXUA 1FVEB 5EORH 3PJLA 1ADQL 3QQNA 1Q9OA 3A6BH 4JDTL 4WCYL 3OKNA 3GMQB 4L37B 1KYOK 1ODUA 3B9KD 4JG1H 3BH9B 3PV6A 1URZA 5I1CH 4UAHA 4KAQL 4YUEL 4HF5H 2MHAA 5IHLB 3K91A 2VR4A 1LK2B 3L4UA 4PJBB 1NMCB 4BFNA 4K3JH 5B38G 4MMXC 5FF6A 3H85A 4NQCB 4RMSA 1OY3B 1Z7JA 2WN3A 1PYWA 4MJ4A 1I85C 2IAMB 4JRWA 4KU1A 4ZS7H 3CD4A 4KKNA 2PWGA 2ZAIA 1JSYA 4HC1L 4PJ5E 1NOFA 3P4NA 2AAAA 3F7KA 3RAJL 2OCJA 4MJID 4MAYC 3D85A 1UOVA 2ZOWA 1KCUL 1QFWM 1NFKA 4MB1A 3ABKB 4DN4H 5E8EA 3O9WC 2YUWA 2BNQA 1XF1A 1ZS8B 1AYRA 3LAFA 3T6WA 1D7CA 2V7HB 4OF0A 4YNYA 3VWJB 4IOFC 3S34H 4GRLC 5DCCA 3VXSD 4ZTPL 2A4EA 3B7TA 1G6RA 5DJYA 1N2RB 1IM9D 5T1JA 3HVDA 3R4RA 4N0YH 1RZGB 3GSOB 1C5DB 1TEFA 1GMIA 4JFPA 1NL0L 1E4XL 2EECA 2F8IA 2APXA 4Q52A 1F8TL 5ISZD