2JL4A

Holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
212
structure length
212
Chain Sequence
MKLYNFWRSGTSHRLRIALNLKGVPYEYLAVHLGKEEHLKDAFKALNPQQLVPALDTGAQVLIQSPAIIEWLEEQYPTPALLPADADGRQRVRALAAIVGCDIHPINNRRILEYLRKTFGADEAAINAWCGTWISAGFDAYEALLAVDPKRGRYSFGDTPTLADCYLVPQVESARRFQVDLTPYPLIRAVDAACGELDAFRRAAPAAQPDSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MALEYLPYRUVATE ISOMERASE
publication title Structure of Bacterial Glutathione-S-Transferase Maleyl Pyruvate Isomerase and Implications for Mechanism of Isomerisation.
pubmed doi rcsb
source organism Ralstonia sp. u2
molecule tags Isomerase
total genus 79
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature ec 5.2.1.4: Maleylpyruvate isomerase.
pdb deposition date 2008-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2jl4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2jl4A01
1MD4A 4QQ7A 4MJBA 3KEBA 4L5OA 4N0ZA 1OAZA 5INYA 1WIKA 3BJ5A 2JL4A 4FYBA 4MPGA 1FO5A 3US3A 2K8SA 2Z9SA 20GSA 2HRKB 2GTUA 3MNGA 4TW5A 4HEA2 2PN8A 5JWQB 3RHCA 3PR8A 4RI7A 3D22A 4ZBDA 1OE8A 1T3BA 3H8QA 4JE1A 5DAKA 4ULXA 4BVYA 1USBA 3VURA 1UVZA 5IMFA 4HS1A 1SL1B 4AJ6A 4TR3A 1Z9HA 2E0QA 4KAEA 2JZRA 1V40A 1FVKA 2RUFA 1WE0A 2N5BA 1J9BA 3M8NA 4MCUA 4OMVA 1SJ6A 1B8XA 1UN2A 1PX6A 1XXUA 1O85A 2HZEB 4MZWA 4J2FA 2FWHA 2ON5A 2H1GA 1YKAA 1O81A 1YF0A 4LMWA 1WRYA 3F3RA 5ECQB 3LSZA 1SYRA 3Q19A 4NHZA 3H1NA 1F9MA 3R3EA 5CYYA 1BEDA 3ME7A 5D93A 1AC1A 2YPMA 1GTIA 2YOIA 1ZL9A 1N2AA 3DWVA 1GUKA 2H1AA 2LSTA 3BCIA 3LYKA 3N5OA 2H75A 2RM5A 2HSYA 1GSFA 3TOTA 4HJ2A 2QKEA 4NV2A 4NPBA 3ZL5A 2CVKA 4ECJA 2FA8A 3WT2A 4ECIA 2FUG2 4AGSA 4TR0A 4EF0A 3TDGA 2H74A 2AYTA 2QSIA 2EIQA 4J57E 1GSUA 1KNGA 2YV7A 2EIOA 1A2LA 4K2DA 4DSSB 1ML6A 2FWEA 2VL9A 3CXGA 1K3LA 1YEPA 3G7JA 4OO4A 3DYRA 4KE3A 5H5RA 3SBCA 2X8CA 1Q98A 2IJYA 3F3QA 1PL2A 4N30A 4F0CA 2IPAA 4PNGA 4POBA 2WRTA 2E2GA 1THXA 1RK4A 2WB9A 3W8JA 4BPYA 2YWIA 1EP7A 2VLVA 3M9JA 1TRUA 2A2RA 1I5GA 1NHOA 1A8LA 1T7PB 5IOWA 5BMUA 3HVVA 1G0TA 3GSSA 5C00A 1OC9B 16GSA 2J9HA 5B6NA 1M9BA 4HQSA 1BQ7A 2BMXA 5GZZB 5ELGA 4BL7B 1K0OA 1X5DA 4XCSA 3GV1A 2HSHA 2HE3A 1QGVA 3WGEA 2HSMA 3LG6A 1U6TA 3HY2A 1EEJA 3GX0A 1JZWA 3VFIA 2VL3A 3BOAA 1GNEA 1DSBA 1SK0A 1V57A 1DBYA 2V32A 2OE1A 3UAPA 2FY6A 2YZUA 4EKZA 4D73A 2MMAA 2F3MA 2DIZA 4XS1A 2GZPA 3CMIA 3I6AA 3A5WA 1B4QA 1HNAA 4KGIA 1E2YA 3U5RE 3GKKA 3VLNA 1PSQA 13GSA 1MEKA 1PMTA 2AHEA 5EVOA 2F9SA 1WJKA 19GSA 4XIHA 3L78A 2DBCA 2A4VA 3ZIVA 1PL1A 5GAPD 3WGXA 2P5RA 4FH8A 3KZQA 4ECCA 1C72A 1O8WA 2CAQA 5A4WA 3JCML 3ZITA 1F6MC 4BVXA 3ZRDA 2H19A 3LJRA 3TB2A 1B48A 1WPIA 5CNWA 1SL2B 1FHEA 1SK1A 1JZRA 3IE3A 4ECBA 4F03A 4ILFA 1E6BA 3HVXA 1S3DA 1R5AA 5LNKe 1GH2A 4HZ2A 1J08A 1WMJA 5ECMB 3LYPA 4JRRA 2IMDA 3EVIA 3FHKA 1XPVA 3BD2A 1QUWA 5IMZA 1ERUA 3VPQA 6GSWA 5G1KA 2WS2A 3MAKA 2H0HA 2VLTA 1GTAA 4LL1B 2IMKA 3EE2A 3W6GA 2DSAA 4GXZA 1H75A 3SWLA 1TXXA 2K8VA 1KTEA 1R7HA 3GSTA 3GKXA 1THOA 4GCIA 4AJ8A 5GSSA 4LLRA 1OC9A 3F4TA 4PGTA 5CRDA 1FAAA 1GRXA 4GRFA 3QFAC 5IIZA 3NOFA 1K0AA 1ACVA 3PH9A 1GTUA 3LXZA 4O5RA 6GSSA 3APQA 3IA1A 4ZL8A 4XS4A 4TRXA 1K0NA 3S9FA 1Z7RA 2L6CA 4IP1A 3M1GA 2PVOC 8GSSA 4RUVA 5E59A 3VWXA 6GSVA 4H86A 2VCTA 4F9ZA 5EL8A 2E7PA 3VWUA 5HFKA 4RQRA 2MBTA 4YQUA 4OCEA 2FHEA 2KUCA 2VO4A 5DAKB 2EIRA 1MDIA 4BVYB 3GH9A 3ZVJA 3D4MA 2FLSA 1F3BA 3DKSA 2HNLA 4ML6A 1K0DA 2HXKA 4XRDA 1TDIA 2LRTA 1EGRA 5J4UA 4PUAA 3KH9A 4MA9A 2B5EA 3HD5A 2VLUA 3FZ5A 2VCXA 4PQHA 2L4QA 4NHWA 3IPZA 1QQ2A 4FYUA 3NZNA 1ZCPA 1F2EA 2YNXA 1TW9A 3W8SA 1AUCA 1FB0A 1NM3A 3KP9A 1TOFA 1TU8A 2VCWA 1EWXA 1GP1A 4HZ4A 17GSA 5J41A 3TKSC 4GQFA 1B9XC 1QXHA 3GIXA 2HT9A 2BJXA 2JZSA 4PXOA 2H01A 1JHBA 3IBHA 4CW9A 4EDZA 1A2MA 3A2XA 4MJEA 3J7Yk 1LU4A 4ZB9A 3GMFA 3QPMA 2AB6A 4KCEA 1PN9A 5F06A 4J56E 5HR0A 1U3AA 4LA1A 1XWBA 3GNJA 1X9SB 2WDUA 2PERA 2YZHA 4POMA 1FB6A 4KUNA 5DALA 1K3YA 2K18A 2P31A 9GSSA 3M9KA 4P3YB 1O73A 4X1UA 3WYWA 2AUVA 2GT5A 2H6XA 1A0FA 3C71A 1A8YA 1ABAA 4Z7XA 2LJKA 4MZBA 1M9AA 3P8WA 3K8NA 4E8HA 2NPBA 3FZAA 4WF5A 3CYNA 3D4TA 2VD1A 2B3SA 2EC4A 1MTCA 5JWRB 4F0BA 3HKRA 4G9HA 2L57A 4K7IA 2LQOA 4IS0A 4GF0A 3O6TA 4KA0A 5ECLB 3TJBA 2VL2A 2N5AA 5G31A 3G7YA 2H1DA 2HFDA 4Q5FA 2JSYA 2GSTA 4QL7A 1AQVA 2O7KA 4PUFC 5J9BA 3O76A 2DMLA 2TIRA 3DEXA 1V9WA 1GLPA 2C0GA 3M0FA 1F37A 1N8JA 1RQMA 5ECPB 4L0WA 2H1BA 3TKSE 1M99A 3WT1A 2HSMB 1U87A 1YJ6A 2CZ2A 4K1FA 3HDCA 2OACA 2O87A 3F6FA 5J5NA 3KGKA 4GLTA 1ZMAA 1LBKA 4HQZA 4F2IA 1OVNA 4G0IA 4D73B 4KSMA 5D9XA 3QOUA 3D6IA 1GSSA 4ISDA 4MZCA 5A4VA 4O92A 3L4NA 2OE3A 2MMOA 5JCGA 3IK9A 1Z6NA 3RPNA 3C1SA 4K7OA 1NHYA 4RQXA 1TKDB 1GNWA 1U3IA 2DJ2A 1GUHA 2FGXA 3A2VA 4EUYA 5DDLA 1F3AA 2V41A 4LMVA 4AJ7A 2L5LA 3F0IA 4TN8A 1XWCA 2YCDA 4CHSA 1URMA 3EMXA 4PX1A 5IO2A 5AISA 2GQKA 2IFQA 2H6YA 4HOJA 5C04A 1M2BA 4BVXB 2IMFA 3VI5A 1UA5A 1MD3A 3VK9A 2LNSA 4YAVA 2LNTA 1VF4A 2LJRA 4ZXGA 5L71A 2LRNA 2O85A 2R4VA 1YZXA 3GX8A 1XVWA 5D9TA 3D21A 2C80A 3QMXA 4ZILA 1BAYA 2OBIA 3TUEA 2CZ3A 12GSA 2GDRA 3DXBA 2YP6A 5JCUA 2H73A 2CX4A 3UMAA 3ERWA 5DJMA 1XZOA 1B9YC 5IMCA 3C73A 1ILOA 2RIIA 1GULA 5FWGA 3KIJA 1SK2A 1K0CA 3FR3A 1AQWA 1S3AA 1A0RP 3IC4A 1X0RA 5EPFA 1XIYA 1Q4JA 14GSA 4G0KA 11GSA 1UC7A 2KHPA 4XHMA 5GAND 1T8EB 2QGVA 4I97A 2OADA 1Z5YE 4KSOA 4ZBBA 3I43A 4WR5A 1IYHA 2X8HA 4XS4B 1S3CA 2F8AA 1G6YA 1Y6EA 1SU9A 2GQLA 1EEMA 3KJYA 1PA3A 3KCMA 2KP1A 2H0GA 3KTLA 5HR2A 5D9WA 1XCCA 3EC3A 4O32A 4YQVA 1M2DA 1T1VA 3GTUA 5DVBA 2QC7A 4HUAA 3APOA 1EGOA 3EINA 2YANA 1XVQA 1ZGNA 3IHQA 1HQOA 5CRWA 3KMOA 4K0NA 4POLA 4MF6A 4OFTA 3I9V2 2L5OA 3RHBA 4PURA 2V6OA 3LEFA 1M0UA 3ZFBA 3R2QA 4PQIA 1OE7A 2PUKC 3Q74A 1PKZA 3UVTA 2JADA 5ABRA 2NTOA 1AQXA 6GSXA 4Q5QA 3TKQA 3FEUA 3CTGA 3O3TA 5AN1A 2XPDA 2CT6A 1TRWA 1ZYQB 1I9DA 1Y25A 3RBTA 3TJKA 2C3QA 3FY7A 2CQ9A 2WULA 4FQUA 2C0FA 4K7NA 3EMPA 5GSTA 2FNOA 2KP2A 4NV5A 5HR3A 5J9CA 1NSWA 2GGTA 3UBLA 2ZCTA 1XWGA 1GUMA 1GSQA 1TI1A 3KTBA 4MABA 5ECOB 4GTUA 3TJFA 3KD0A 3HYPA 4PNFA 2LKUA 2DC5A 4DVCA 4PQ1A 1SJIA 1CQHA 1QMVA 2OKAA 2PBJA 4ZB6A 18GSA 2HYXA 5CAXA 6GSTA 5DALB 3QAVA 1HNCA 2BTOT 4HU7A 1MDKA 2WJUA 2MYGA 3UIWA 4G0LA 22GSA 2GQMA 2V6KA 2ZUPA 2H71A 4JR4A 2B5YA 5G30A 1VGLA 4ACSA 2MZCA 5HR1A 4MDCA 2NDOA 1KBNA 4EE0A 3P90A 3HCZA 2JZTA 2GZZA 5G5EA 5COHA 4MLYA 5KN3A 1R26A 4EVMA 2M46A 1PGTA 3UVHA 4OFMA 1R4WA 4QL9A 1XOAA 2XHFA 1SD9A 5IMAA 3EYTA 2VAFA 1BJXA 1ST9A 4KB3A 2I81A 2PWJA 4ZIJA 3UEMA 1PX7A 3F4RA 5ELAA 4V2MA 2CVDA 4IELA 4TVEA 4L8EA 5B7CA 2RUEA 5IO0A 1TRVA 1G7OA 2XC2A 2TRCP 1T4ZA 4TXOA 3UARA 2VM1A 4IJ3A 4TR4A 4USSA 5HFIA 3TJGA 4TKYA 3ZMKA 2C3TA 5IPHA 4Q5RA 1LJRA 1K0MA 1ERTA 3CRUA 4MK3A 4V1Ag 2GSSA 3ZFLA 5H5SA 1BYEA 4RI6A 1EOHA 2M80A 2I3YA 1XWKA 4POKA 1A2JA 5A4UA 3TJJA 1X5CA 1SENA 4MJCA 1HD2A 2LUSA 3P7XA 2I1UA 4I6XA 2KOKA 1T4YA 1XFLA 3MWHA 3PGTA 3QR6A 2H66A 1AIUA 2LV3A 4L0UA 1EOGA 4GSTA 1X9WB 1V2AA 2HRFA 2B7KA 4DEJA 4DSRA 4MMMA 3L9SA 2K9FA 3VWVA 3HZ4A 1SL0B 3IAS2 1WP0A 4F82A 1VF3A 5LD0A 2JSZA 1GTBA 3E9JB 4KDUA 3KXOA 5KEJA 2YN1A 1K3OA 4HDEA 2TRXA 2YJ7A 3IXRA 2P5QA 4HJMA 2IIYA 2V1MA 3HXSA 2GSRA 5ECSA 1M2AA 4TR1A 3QAGA 4IBPA 3HJMA 2IFQB 2D2ZA 4EL1A 2C1YA 4AF2A 1ERVA 3ZYWA 5G5FA 5DCHA 2G2QA 4IW9A 2DJ0A 1TI3A 3HA9A 1SKRB 2XPEA 4TXVA 2YJHA 3IK7A 5KN1A 1YDKA 3OR5A 4X0XA 4G10A 2C8UA 2GLRA 3TRQA 1XBSA 4N10A 3IR4A 3VI7A 2J23A 5F8BA 2B7JA 1V58A 4IN0A 2CA8A 1JZOA 1O6JA 4G19A 2H72A 3TKPA 4GSNA 3QAWA 5F0GA 1J0FA 3KH7A 2YWOA 3L9VA 1G6WA 3CTFA 1TP9A 2FCHA 4K6XA 3QD9A 3J7Yb 2AJQB 3TGZA 2CV4A 1GSDA 2X99A 3EU4A 3DRNA 4BWQA 5D73A 4Q5NA 2VCZA 2DJKA 1FOVA 5IOXA 3ME8A 7GSSA 1KEBA 4FO5A 2M72A 4WXTA 3EU3A 2LRCA 4IQAA 2VD0A 4MF5A 2OBKA 4I8BA 4TOPA 2N5FA 5AIXA 3UOMA 3LFLA 4MH3A 5D96A 4BA7A 3IC8A 2WCIA 2OE0A 4N11A 2VL2C 3A3TA 5B6MA 1X5EA 2GZYA 4I2UA 3IDVA 2ALBA 5CREA 3GTUB 2ES7A 4JBBA 3D5JA 5HQPA 3ZVJD 3DVWA 4WETA 2FWGA 2L59A 2CAIA 4HI7A 3GKMA 1XW5A 5DBQA 3DGQA 1JFUA 3FZ4A 1WOUA 3FZ9A 1JZDA 4JEDA 3FW2A 5ID2A 5DJLA 2OA7A 3ZTLA 1AW9A 4JR6A 10GSA 3MSZA 4I5QA 4DSQA 3BBYA 3ZZXA 2H6ZA 5IMDA 3HJOA 1B4PA 3U6VA 3LXTA 2IWTA 2IL3A 1HNBA 4GWRA 2LJAA 3VPTA 1AAZA 3RAZA 2DMMA 1SKSB 1OYJA 3BCKA 4MF7A 1TK5B 2MBSA 1A24A 2FD3A 5E4WA 3CSIA 2DJ3A 3QDNA 1VF2A 4NAXA 5IMVA 3GFKA 5IQYA 5IPGA 1ZZYA 3GL3A 2HRNA 1BG5A 2VCQA 3KP8A 3FKFA 5G1LA 3VWWA 3N9JA 3H79A 1V98A 5J3RA 3I69A 1EV9A 1YF1A 3HZ8A 1W4VA 3ERFA 2LQQA 3PPUA 5ECRB 2NVLA 3E0UA 2AAWA 3LGCA 2H0IA 2R2JA 2PMTA 4XS6A 2C0EA 3GL5A 3GKNA 4GQCA 2PU9C 2HRKA 1ZYEA 2H30A 3F63A 4K8MA 4IVFA 1O8XA 1Z7PA 4WF4A 5AGYA 1WWJA 5ENUA 2ON7A 2WGRA 1ERWA 4NMUA 1OKTA 1GLQA 6GSYA 2B5XA 3ERGA 4NXIA 3F8UA 2GS3A 2E2MA 3FRCA 3DIEA 1H4OA 4WR4A 1QK8A 4KDXA 4ZL9A 2VM2A 4K9ZA 3Q6OA 2B1LA 4KDYA 4MPFA 1EP8A 2C4JA 3ZREA 2KLXA 2O89A 1Z6MA 5JWOB 5D9VA 5CRGA 5F07A 4EO3A 2L4CA 3GA4A 1M7TA 3GUSA 5FHIA 3UL3A 1O7UA 4I2TA 4TXOB 1SD8A 4WBJA 2B1KA 3L9UA 3FYGA 2VCVA 3EURA 2R5GA 4IHUA 2HZEA 2LS5A 4L5LA 2H8LA 4ID0A 1GL8A 4ZB8A 4K0GA 1JLVA 4ZL7A 3L0HA 4KX4A 6GSUA 1OKDA 2IN3A 4MH2A 1TRSA 2F51A 3Q18A 4JU5A 3P2AA 5B8AA 1TK8B 3HHVA 2PVQA 4MP4A 2HZFA 3DMLA 1GSEA 3GHAA 1VRSD 5JCWA 3HVSA 3GRXA 2X8GA 3H4KA 2DJ1A 3AY8A 4WEYA 5IM9A 2MMZA 2HSNB 1DE2A 4JZQA 1K0BA 2PGTA 3LWAA 1PD21 2RM6A 3LORA 2HLSA 4OFNA 5CP1A 4HU9A 3IV4A 2AV4A 3CRTA 4TR1B 2ZNMA 3UBKA 4XTSA 1EV4A 3DD3A 2DJJA 4DSSA 3H93A 4ZBAA 3RDWA 1G7EA 2UZ8A 1XW6A 1XWAA 4E8EA 3V1WA 4PTSA 3TRXA 1PKWA 1OC3A 5EY6A 4YH2A 3ZIJA 3UJ1A 5G2ZA 1RW1A 2FA4A 1TK0B 1T00A 2L6DA 1YY7A 4XRAA 3IRAA 4G2EA 4LL4B 2VIMA 1ON4A 1GWCA 4KF9A 4KW6A 5DCGA 1BX9A 1AXDA 2JACA 2WZ9A 2IMEA 3FR6A 3F6DA 1FVJA 3E3EA 1YKCA 4OWYA 4BL7A 2LEGA 3GURA 2HQTA 4V1Ap 1OC8A 1TJDA 3F9UA 1NW2A 5CRHA 1A23A 1U88A 3GYKA 4IGJA 4N0VA 4KH7A 5CO3A 4X43A 3NIVA 1MDJA 5D8IA 2REMA 5DQYA 3ZMLA 3A2WA 1JLWA 1DE1A 2HI7A 4IJIA 4FIWA 3TKSA 4WBRD 3C1RA 3CBUA 1QFNA 2PPTA 1FW1A 1CQGA 5LCZA 4CDOA 4EXJA 3ISOA 1GSYA 1SJZA 3QCPA 3ZLPA 2A2SA 1EZKA 1TU7A 5AIVA 4IP6A 3TRPA 3MDKA 2CVBA 5KN0A 3LQ7A 2O8VB 2XBIA 5DQSA 2F8FA 3TKRA 4BWSA 5A5KA 2MMNA 1PQNA 3WGDA 3CSJA 2GT6A 2C3NA 4GSSA 3G7IA 3IOSA 4MJAA 2HRAA 3FK8A 4EDYA 1SYXA 1W89A 3FR9A 2YV9A 5ECIB 2I4AA 5HFGA 4EC0A 4FYCA 2I9HA 3QFBC 2YWNA 3F4SA 5B8BA 2H76A 4ML1A 3DVXA 2LTKA 5ID2B 2C0DA 1YQ1A 2X64A 2YWMA 2JU5A 5F05A 1PRXA 4KNDA 2K6VA 4YAPA 4OD7A 1VF1A 1TTZA 3GN3A 2IMIA 2CX3A 2RLIA 2GVPA 1XOBA 3RPPA 3C7MA 3C8EA 4OO5A 4V2NA 4WKWA 1X9MB 5FT3A 2FWFA 2P0GA 1HYUA 3G9BA 1SKWB 3TCOA 3CSHA 2VOCA 1R5PA 2VUPA 1FG4A 3EWLA 3PINA 3ED3A 2XBQA 5ECKB 3M3MA 3KM6A 2H70A 3IAM2 4IKHA 3APSA 2R37A 4KCAA 2GSQA 3D0ZA 3WD6A 3KMNA 2DLXA 2NBSA 3HJPA 5KN2A 2G0FA 5ECHB 4YQMA 1DUGA 4OCFA 2WFCA 1Z3EA 3GH6A 1YEXA 2DIYA 5ECNB 2R6KA 4NWYA 4IQ1A 2V2GA 4O7HA 5H5QA 2B6MA 1XW9A 2OJLA 1ZOFA 3TOUA 4V2LA 1IYIA 2R3XA
chains in the Genus database with same CATH superfamily
1MD4A 4QQ7A 4MJBA 3KEBA 4L5OA 4N0ZA 1OAZA 5INYA 1WIKA 3BJ5A 2JL4A 4FYBA 4MPGA 1FO5A 3US3A 2K8SA 2Z9SA 20GSA 2HRKB 2GTUA 3MNGA 4TW5A 4HEA2 2PN8A 5JWQB 3RHCA 3PR8A 4RI7A 3D22A 4ZBDA 1OE8A 1T3BA 3H8QA 4JE1A 5DAKA 4ULXA 4BVYA 1USBA 3VURA 1UVZA 5IMFA 4HS1A 1SL1B 4AJ6A 4TR3A 1Z9HA 2E0QA 4KAEA 2JZRA 1V40A 1FVKA 2RUFA 4K2XA 1WE0A 2N5BA 1J9BA 3M8NA 4MCUA 4OMVA 2QA2A 1SJ6A 1B8XA 1UN2A 1PX6A 1XXUA 1O85A 2HZEB 4MZWA 4J2FA 2FWHA 2ON5A 2H1GA 1YKAA 1O81A 1YF0A 4LMWA 3HVNA 1WRYA 3F3RA 5ECQB 3LSZA 1SYRA 3Q19A 4NHZA 3H1NA 1F9MA 3R3EA 5CYYA 1BEDA 3ME7A 5D93A 1AC1A 2YPMA 1GTIA 4PI0C 2YOIA 1ZL9A 1N2AA 3DWVA 1GUKA 2H1AA 2LSTA 3BCIA 3LYKA 3N5OA 2H75A 2RM5A 2HSYA 1GSFA 3TOTA 4HJ2A 2QKEA 4NV2A 4NPBA 3ZL5A 2CVKA 4ECJA 2FA8A 3WT2A 5BRTA 4ECIA 2FUG2 4AGSA 4TR0A 4EF0A 3TDGA 2H74A 2AYTA 2QSIA 2EIQA 4J57E 1GSUA 1KNGA 2YV7A 2EIOA 1A2LA 4K2DA 4DSSB 1ML6A 2FWEA 2VL9A 3CXGA 1K3LA 1YEPA 4YKFA 3G7JA 4OO4A 3DYRA 4KE3A 5H5RA 3SBCA 2X8CA 4G01A 1Q98A 2IJYA 3F3QA 1PL2A 4N30A 4F0CA 2IPAA 4PNGA 4POBA 2WRTA 2E2GA 1THXA 4ICYA 2OT3A 1RK4A 2WB9A 3W8JA 4BPYA 2YWIA 1EP7A 2VLVA 3M9JA 1TRUA 2A2RA 1I5GA 1NHOA 1A8LA 1T7PB 5IOWA 5BMUA 3HVVA 1G0TA 3GSSA 5C00A 1OC9B 16GSA 2J9HA 5B6NA 1M9BA 4YKGA 4HQSA 1BQ7A 2BMXA 5GZZB 5ELGA 4BL7B 1K0OA 1X5DA 4XCSA 3GV1A 2HSHA 2HE3A 1QGVA 3WGEA 2HSMA 3LG6A 1U6TA 3HY2A 1EEJA 3GX0A 1JZWA 3VFIA 2VL3A 3BOAA 1GNEA 1DSBA 1SK0A 1V57A 1DBYA 2V32A 2OE1A 3UAPA 2FY6A 2YZUA 4EKZA 4D73A 2MMAA 2F3MA 2DIZA 4XS1A 3CMIA 2GZPA 4GDFA 3I6AA 3A5WA 1B4QA 1HNAA 4KGIA 1E2YA 3U5RE 3GKKA 3VLNA 1PSQA 13GSA 1MEKA 1PMTA 2AHEA 5EVOA 2F9SA 1WJKA 19GSA 4XIHA 3L78A 2DBCA 2A4VA 3ZIVA 1PL1A 5GAPD 3WGXA 2P5RA 4FH8A 3KZQA 4ECCA 1C72A 1O8WA 2CAQA 5A4WA 3JCML 3ZITA 1F6MC 4BVXA 3ZRDA 2H19A 4MNNA 3LJRA 3TB2A 1B48A 1WPIA 1BF5A 5CNWA 2WVXB 1SL2B 1FHEA 4PI2C 1SK1A 1JZRA 3IE3A 4ECBA 4F03A 4ILFA 1E6BA 3HVXA 1S3DA 1R5AA 5LNKe 1GH2A 4HZ2A 1J08A 1WMJA 5ECMB 3LYPA 4JRRA 2IMDA 3EVIA 3FHKA 1XPVA 3BD2A 1QUWA 5IMZA 1ERUA 3VPQA 6GSWA 5G1KA 2WS2A 3MAKA 2H0HA 2VLTA 1GTAA 4LL1B 2IMKA 3EPTA 3EE2A 3W6GA 2DSAA 4GXZA 1H75A 3SWLA 1TXXA 2K8VA 1KTEA 1R7HA 3GSTA 3GKXA 1THOA 4GCIA 4AJ8A 4A5PA 5GSSA 4LLRA 1OC9A 3F4TA 4PGTA 5CRDA 2WVYA 1FAAA 1GRXA 4GRFA 3QFAC 5IIZA 3NOFA 1K0AA 1ACVA 3PH9A 1GTUA 3LXZA 4O5RA 6GSSA 3APQA 3IA1A 5A34A 4ZL8A 3MIXA 4XS4A 4TRXA 1K0NA 3S9FA 1Z7RA 2L6CA 4IP1A 3M1GA 2PVOC 8GSSA 4RUVA 3HMJG 5E59A 3VWXA 6GSVA 4H86A 2VCTA 4F9ZA 5EL8A 2E7PA 5J4VA 3VWUA 5HFKA 4RQRA 2MBTA 4YQUA 4OCEA 2FHEA 2KUCA 1BG1A 2VO4A 5DAKB 2EIRA 1TXUA 1MDIA 4BVYB 3GH9A 3ZVJA 2EFHA 3D4MA 2FLSA 1F3BA 3DKSA 2HNLA 4ML6A 1M3JA 1K0DA 2HXKA 4XRDA 1TDIA 2LRTA 1EGRA 5J4UA 4PUAA 3KH9A 4MA9A 2B5EA 3HD5A 2DKHA 2VLUA 3FZ5A 2VCXA 4PQHA 2L4QA 4NHWA 3IPZA 1QQ2A 4FYUA 3NZNA 1ZCPA 1F2EA 2YNXA 1TW9A 1SVMA 3W8SA 1AUCA 1FB0A 4W66A 1NM3A 3KP9A 1TOFA 1TU8A 2VCWA 1EWXA 1GP1A 4HZ4A 17GSA 5J41A 3TKSC 4GQFA 1B9XC 1QXHA 3GIXA 2HT9A 2BJXA 2JZSA 4PXOA 2H01A 1JHBA 3IBHA 4CW9A 4EDZA 1A2MA 3A2XA 4MJEA 2WW0A 3J7Yk 1LU4A 4ZB9A 3GMFA 3QPMA 2AB6A 4KCEA 1PN9A 5F06A 4J56E 2EFEA 5HR0A 1U3AA 4LA1A 1XWBA 3GNJA 1X9SB 2WDUA 2PERA 2YZHA 4FXYP 4POMA 1FB6A 4KUNA 5DALA 1K3YA 2K18A 2P31A 9GSSA 3M9KA 4P3YB 3FMWA 1O73A 4X1UA 3WYWA 2AUVA 2GT5A 2H6XA 1A0FA 3C71A 1A8YA 1ABAA 4Z7XA 2LJKA 4MZBA 1M9AA 3K8NA 3P8WA 4E8HA 2NPBA 3FZAA 4WF5A 3CYNA 3D4TA 2VD1A 2B3SA 2EC4A 1MTCA 5JWRB 4F0BA 3HKRA 4G9HA 2L57A 4K7IA 2LQOA 4IS0A 4GF0A 3O6TA 4KA0A 5ECLB 3TJBA 2VL2A 2N5AA 1ZYNA 5G31A 3G7YA 2H1DA 2HFDA 4Q5FA 2JSYA 2GSTA 4QL7A 1AQVA 2O7KA 4PUFC 5J9BA 3O76A 2DMLA 2TIRA 3DEXA 1V9WA 1GLPA 2C0GA 3M0FA 5BMUB 1F37A 1N8JA 1RQMA 5ECPB 4L0WA 2H1BA 3TKSE 1M99A 2WW1A 3WT1A 2HSMB 1U87A 1YJ6A 2CZ2A 4K1FA 3HDCA 2OACA 2O87A 3F6FA 5J5NA 3KGKA 4GLTA 1ZMAA 1LBKA 4HQZA 4F2IA 1OVNA 4G0IA 4D73B 4KSMA 5D9XA 3QOUA 3D6IA 1GSSA 4ISDA 4MZCA 5A4VA 4O92A 3L4NA 2OE3A 2MMOA 5JCGA 3IK9A 1Z6NA 3RPNA 3C1SA 4K7OA 1NHYA 4RQXA 1TKDB 1GNWA 1U3IA 2DJ2A 1GUHA 2FGXA 3A2VA 4EUYA 1SVOA 5DDLA 1F3AA 2V41A 4LMVA 4AJ7A 2L5LA 3F0IA 4TN8A 1XWCA 2WW3A 2YCDA 2O3EA 4CHSA 1URMA 3EMXA 4PX1A 5IO2A 5AISA 2GQKA 2IFQA 2H6YA 4HOJA 5C04A 1M2BA 4BVXB 2IMFA 3VI5A 1UA5A 1MD3A 3VK9A 2LNSA 4YAVA 2LNTA 1VF4A 2LJRA 4ZXGA 5L71A 2LRNA 2O85A 2R4VA 1YZXA 3GX8A 1XVWA 5D9TA 3D21A 2C80A 3QMXA 4ZILA 1BAYA 2OBIA 3TUEA 2CZ3A 12GSA 2GDRA 3DXBA 2YP6A 5JCUA 2H73A 2CX4A 3UMAA 5KOXA 3ERWA 5DJMA 1XZOA 1B9YC 5IMCA 3C73A 1ILOA 3CWGA 2RIIA 1GULA 5FWGA 3KIJA 1SK2A 1K0CA 3FR3A 1AQWA 1S3AA 1A0RP 3IC4A 1N25A 1X0RA 5EPFA 1XIYA 1Q4JA 14GSA 4G0KA 11GSA 1UC7A 2KHPA 4XHMA 5GAND 1T8EB 2QGVA 5A5HA 4I97A 2OADA 1Z5YE 4KSOA 4ZBBA 3I43A 4WR5A 5A34B 1IYHA 2X8HA 4XS4B 1S3CA 2F8AA 1G6YA 1Y6EA 1SU9A 2GQLA 1EEMA 3KJYA 1PA3A 3KCMA 2KP1A 2H0GA 3KTLA 5HR2A 5D9WA 1XCCA 3EC3A 4O32A 4YQVA 1M2DA 1T1VA 3GTUA 5DVBA 2QC7A 4HUAA 3APOA 1EGOA 3EINA 2YANA 1XVQA 1ZGNA 1Y1UA 3IHQA 1HQOA 5CRWA 3KMOA 4K0NA 4POLA 4MF6A 4OFTA 3I9V2 2L5OA 3RHBA 4PURA 2V6OA 4N3ZA 3LEFA 1M0UA 3ZFBA 3R2QA 4PQIA 4EIPA 1OE7A 2PUKC 3Q74A 1PKZA 3UVTA 2JADA 5ABRA 2NTOA 1AQXA 6GSXA 4Q5QA 3TKQA 3FEUA 4AKXB 3CTGA 3O3TA 5AN1A 4PHZC 2XPDA 2CT6A 1TRWA 3MYDA 1ZYQB 1I9DA 1Y25A 3RBTA 3TJKA 2C3QA 3FY7A 2CQ9A 2WULA 4FQUA 2C0FA 4K7NA 3EMPA 5GSTA 2FNOA 2KP2A 4NV5A 5HR3A 5J9CA 1NSWA 2GGTA 3UBLA 2ZCTA 1XWGA 1GUMA 1GSQA 2O36A 1TI1A 3KTBA 4MABA 5ECOB 4GTUA 3TJFA 3KD0A 3HYPA 4PNFA 2LKUA 2DC5A 4DVCA 4PQ1A 1SJIA 1CQHA 1PFOA 1QMVA 2OKAA 2PBJA 4ZB6A 18GSA 2HYXA 5CAXA 6GSTA 4AKHA 5DALB 3QAVA 1HNCA 2BTOT 4HU7A 1MDKA 2WJUA 2MYGA 3UIWA 4G0LA 22GSA 2GQMA 4Z2UA 2V6KA 2ZUPA 2H71A 4JR4A 2B5YA 5G30A 1VGLA 4ACSA 2MZCA 5HR1A 4MDCA 2NDOA 3A5IA 1KBNA 4EE0A 1XG8A 3P90A 4AKIA 3HCZA 2JZTA 2GZZA 5G5EA 5COHA 4MLYA 5KN3A 1R26A 4EVMA 2M46A 1PGTA 3UVHA 2R0PA 4OFMA 1R4WA 4QL9A 1XOAA 5A1NA 2XHFA 1SD9A 5IMAA 3EYTA 2VAFA 1BJXA 1ST9A 4KB3A 2I81A 2PWJA 4ZIJA 3UEMA 2UV8G 1PX7A 3F4RA 5ELAA 4V2MA 2CVDA 4IELA 2WW2A 4TVEA 4L8EA 5B7CA 2RUEA 5IO0A 1TRVA 1G7OA 2XC2A 2TRCP 1T4ZA 4TXOA 3UARA 2VM1A 4IJ3A 4TR4A 4USSA 5HFIA 3TJGA 4TKYA 3ZMKA 2C3TA 5IPHA 4Z2RA 4Q5RA 1LJRA 1K0MA 1ERTA 3CRUA 4MK3A 4V1Ag 2GSSA 3ZFLA 5H5SA 4Z2TA 1BYEA 4RI6A 1EOHA 2M80A 3TU3B 3CHXC 2I3YA 1XWKA 4POKA 1A2JA 5A4UA 3IHGA 3TJJA 1X5CA 1SENA 4MJCA 1HD2A 2LUSA 2VKZG 3P7XA 2I1UA 4I6XA 2KOKA 1T4YA 1XFLA 3MWHA 3PGTA 3QR6A 2H66A 1AIUA 2LV3A 4L0UA 1EOGA 4GSTA 1X9WB 1V2AA 2HRFA 2B7KA 4DEJA 4DSRA 4MMMA 3L9SA 2K9FA 2HSNA 3VWVA 3HZ4A 1SL0B 3IAS2 1WP0A 4F82A 1VF3A 5LD0A 2JSZA 1GTBA 3E9JB 4KDUA 1ZYPA 3KXOA 5KEJA 2YN1A 4E68A 1K3OA 4HDEA 2TRXA 2YJ7A 3IXRA 3LW9A 2P5QA 4HJMA 2IIYA 2V1MA 3HXSA 2GSRA 5ECSA 1M2AA 4TR1A 3QAGA 4IBPA 3HJMA 2IFQB 2D2ZA 4EL1A 2C1YA 4AF2A 1ERVA 3ZYWA 1SVLA 5G5FA 5DCHA 1FOHA 2G2QA 4IW9A 2DJ0A 1TI3A 3HA9A 1SKRB 2XPEA 4TXVA 2YJHA 3IK7A 5KN1A 1YDKA 3OR5A 4X0XA 4G10A 2C8UA 2GLRA 3TRQA 1XBSA 4N10A 3IR4A 3VI7A 2J23A 5F8BA 2B7JA 1V58A 4IN0A 2CA8A 1JZOA 1O6JA 4G19A 2H72A 3TKPA 4GSNA 3QAWA 5F0GA 1J0FA 3KH7A 2YWOA 3L9VA 1G6WA 3CTFA 1TP9A 2FCHA 1S4BP 4K6XA 3QD9A 3J7Yb 4O5QA 2AJQB 2R0GA 3CQFA 3TGZA 2CV4A 1GSDA 2X99A 3EU4A 3DRNA 4BWQA 5D73A 4Q5NA 2VCZA 2DJKA 1FOVA 5IOXA 3ME8A 7GSSA 1KEBA 4FO5A 2M72A 4WXTA 3EU3A 2LRCA 5A5HB 4IQAA 2VD0A 4MF5A 2X49A 2OBKA 4I8BA 4TOPA 2N5FA 5AIXA 3UOMA 3RGBC 3LFLA 2O5VA 4MH3A 5D96A 4BA7A 3IC8A 2WCIA 2OE0A 4N11A 2VL2C 3A3TA 5B6MA 1X5EA 2GZYA 4I2UA 3IDVA 2ALBA 5CREA 3GTUB 2R0CA 2ES7A 4JBBA 3D5JA 5HQPA 3ZVJD 3DVWA 4WETA 2FWGA 2L59A 2CAIA 4HI7A 3GKMA 1XW5A 5DBQA 3DGQA 1PN0A 1JFUA 3FZ4A 1WOUA 3FZ9A 1JZDA 4BIKA 2H1LA 4JEDA 3FW2A 5ID2A 5DJLA 2OA7A 3ZTLA 1AW9A 4JR6A 10GSA 3MSZA 4I5QA 4DSQA 3BBYA 3ZZXA 2H6ZA 5IMDA 4X4JA 3HJOA 1B4PA 3U6VA 3LXTA 2IWTA 2IL3A 1HNBA 4GWRA 2LJAA 3VPTA 1AAZA 3RAZA 2DMMA 1SKSB 1OYJA 3BCKA 4MF7A 1TK5B 2MBSA 1A24A 2FD3A 5E4WA 3CSIA 2DJ3A 3QDNA 1VF2A 4NAXA 5IMVA 3GFKA 5J40A 5IQYA 5IPGA 4ZB7A 1ZZYA 3GL3A 2HRNA 1BG5A 2VCQA 3KP8A 3FKFA 5G1LA 3RFRC 3VWWA 3N9JA 3H79A 1V98A 5J3RA 3I69A 1EV9A 1YF1A 3HZ8A 5J47A 1W4VA 3ERFA 2LQQA 3PPUA 5ECRB 5J4YA 2NVLA 3E0UA 2AAWA 3LGCA 2H0IA 2R2JA 2PMTA 4XS6A 2C0EA 3GL5A 3GKNA 4GQCA 2PU9C 2HRKA 1ZYEA 2H30A 3F63A 4K8MA 4IVFA 1O8XA 1Z7PA 4WF4A 5AGYA 1WWJA 5ENUA 2EFDA 2ON7A 2WGRA 1ERWA 4NMUA 5A1NB 1OKTA 1GLQA 6GSYA 2B5XA 3ERGA 4NXIA 3F8UA 2GS3A 2E2MA 3FRCA 3DIEA 1H4OA 4WR4A 1QK8A 4KDXA 4ZL9A 2VM2A 4K9ZA 3Q6OA 2B1LA 4KDYA 4MPFA 1EP8A 2WZSA 2C4JA 3ZREA 2KLXA 2O89A 2A4HA 2EFCA 1Z6MA 5JWOB 5D9VA 5CRGA 5F07A 4EO3A 2L4CA 3GA4A 1M7TA 3GUSA 5FHIA 4CY8A 3UL3A 1O7UA 4I2TA 4TXOB 1SD8A 4WBJA 2B1KA 2DKIA 3FYGA 3L9UA 2VCVA 3EURA 1M3IA 2R5GA 4IHUA 2HZEA 2LS5A 4AKGA 4L5LA 2H8LA 4ID0A 1GL8A 4ZB8A 4K0GA 1JLVA 4ZL7A 3L0HA 4KX4A 6GSUA 1OKDA 2IN3A 4MH2A 1TRSA 2F51A 3Q18A 4JU5A 3P2AA 5B8AA 1TK8B 3HHVA 2PVQA 4MP4A 2HZFA 4EIQA 3DMLA 1GSEA 3GHAA 1VRSD 5JCWA 3HVSA 3GRXA 2X8GA 3H4KA 2DJ1A 3AY8A 4WEYA 5IM9A 2MMZA 2HSNB 1DE2A 4JZQA 1K0BA 2PGTA 3LWAA 1PD21 2RM6A 3LORA 2HLSA 4OFNA 5CP1A 4HU9A 3IV4A 2AV4A 3CRTA 4TR1B 2ZNMA 3UBKA 4XTSA 1EV4A 3DD3A 2DJJA 4DSSA 3H93A 4ZBAA 3RDWA 1G7EA 2UZ8A 1YEWC 1XW6A 1XWAA 4E8EA 3V1WA 4PTSA 3TRXA 1PKWA 1YVLA 1OC3A 5EY6A 4YH2A 3ZIJA 3UJ1A 5G2ZA 1RW1A 2FA4A 4QMKA 1TK0B 1T00A 2L6DA 1YY7A 4XRAA 3IRAA 4G2EA 5KOWA 4LL4B 2VIMA 1ON4A 1GWCA 4KF9A 4KW6A 5DCGA 1BX9A 1AXDA 2JACA 2WZ9A 2IMEA 3FR6A 3F6DA 1FVJA 3E3EA 2WVZA 1I1IP 1YKCA 4OWYA 4BL7A 2LEGA 3GURA 2HQTA 4V1Ap 1OC8A 1TJDA 3F9UA 1NW2A 5CRHA 1A23A 1U88A 4HSCX 3GYKA 4IGJA 4N0VA 4KH7A 5CO3A 4X43A 3NIVA 1MDJA 5D8IA 2REMA 5DQYA 3ZMLA 3A2WA 1JLWA 1DE1A 2HI7A 4IJIA 4FIWA 3TKSA 4WBRD 3C1RA 3CBUA 1QFNA 2PPTA 1FW1A 1CQGA 5LCZA 1S3RA 4CDOA 4EXJA 3ISOA 1GSYA 1SJZA 3QCPA 3ZLPA 2A2SA 1EZKA 1TU7A 5AIVA 4IP6A 3TRPA 3MDKA 2CVBA 5KN0A 3LQ7A 2O8VB 2XBIA 5DQSA 2F8FA 3TKRA 4BWSA 5A5KA 2MMNA 1PQNA 3WGDA 3CSJA 2GT6A 2C3NA 4GSSA 3G7IA 2QA1A 3IOSA 4MJAA 2HRAA 3FK8A 4EDYA 1SYXA 1W89A 3FR9A 2YV9A 5ECIB 2I4AA 5HFGA 4EC0A 4FYCA 2I9HA 3QFBC 2YWNA 3F4SA 5B8BA 2H76A 4ML1A 3DVXA 2LTKA 5ID2B 2C0DA 1YQ1A 2X64A 2YWMA 2JU5A 2WVXA 2A2PA 5F05A 1PRXA 4KNDA 2K6VA 4CY6A 4YAPA 4OD7A 4O5UA 1VF1A 1TTZA 3GN3A 2IMIA 2CX3A 2RLIA 2GVPA 1XOBA 2X4AA 3RPPA 3C7MA 3C8EA 4OO5A 4V2NA 4WKWA 1X9MB 5FT3A 2FWFA 2P0GA 1HYUA 3G9BA 1SKWB 3TCOA 3CSHA 2VOCA 1R5PA 2VUPA 1FG4A 3EWLA 3PINA 3ED3A 2XBQA 5ECKB 3M3MA 3KM6A 2H70A 3IAM2 4IKHA 3APSA 2R37A 4K5RA 2GSQA 3D0ZA 4KCAA 3WD6A 3KMNA 2DLXA 2NBSA 3HJPA 4AI6A 5KN2A 2G0FA 5ECHB 4YQMA 1DUGA 4OCFA 2WFCA 1Z3EA 3GH6A 1YEXA 2DIYA 5ECNB 2R6KA 4NWYA 4IQ1A 2V2GA 4O7HA 5H5QA 2B6MA 1XW9A 2OJLA 1ZOFA 3TOUA 4V2LA 4K5SA 1IYIA 2R3XA
chains in the Genus database with same CATH topology
1MD4A 4QQ7A 4MJBA 3KEBA 4L5OA 4N0ZA 1OAZA 5INYA 1WIKA 3BJ5A 2JL4A 4FYBA 4MPGA 1FO5A 3US3A 2K8SA 2Z9SA 20GSA 2HRKB 2GTUA 3MNGA 4TW5A 4HEA2 2PN8A 5JWQB 3RHCA 3PR8A 4RI7A 3D22A 4ZBDA 1OE8A 1T3BA 3H8QA 4JE1A 5DAKA 4ULXA 4BVYA 1USBA 3VURA 1UVZA 5IMFA 4HS1A 1SL1B 4AJ6A 4TR3A 1Z9HA 2E0QA 4KAEA 2JZRA 1V40A 1FVKA 2RUFA 4K2XA 1WE0A 2N5BA 1J9BA 3M8NA 4MCUA 4OMVA 2QA2A 1SJ6A 1B8XA 1UN2A 1PX6A 1XXUA 1O85A 2HZEB 4MZWA 4J2FA 2FWHA 2ON5A 2H1GA 1YKAA 1O81A 1YF0A 4LMWA 1WRYA 3F3RA 5ECQB 3LSZA 1SYRA 3Q19A 4NHZA 3H1NA 1F9MA 3R3EA 5CYYA 1BEDA 3ME7A 5D93A 1AC1A 2YPMA 1GTIA 2YOIA 1ZL9A 1N2AA 3DWVA 1GUKA 2H1AA 2LSTA 3BCIA 3LYKA 3N5OA 2H75A 2RM5A 2HSYA 1GSFA 3TOTA 4HJ2A 2QKEA 4NV2A 4NPBA 3ZL5A 2CVKA 4ECJA 2FA8A 3WT2A 5BRTA 4ECIA 2FUG2 4AGSA 4TR0A 4EF0A 3TDGA 2H74A 2AYTA 2QSIA 2EIQA 4J57E 1GSUA 1KNGA 2YV7A 2EIOA 1A2LA 4K2DA 4DSSB 1ML6A 2FWEA 2VL9A 3CXGA 1K3LA 1YEPA 4YKFA 3G7JA 4OO4A 3DYRA 4KE3A 5H5RA 3SBCA 2X8CA 4G01A 1Q98A 2IJYA 3F3QA 1PL2A 4N30A 4F0CA 2IPAA 4PNGA 4POBA 2WRTA 2E2GA 1THXA 4ICYA 2OT3A 1RK4A 2WB9A 3W8JA 4BPYA 2YWIA 1EP7A 2VLVA 3M9JA 1TRUA 2A2RA 1I5GA 1NHOA 1A8LA 1T7PB 5IOWA 5BMUA 3HVVA 1G0TA 3GSSA 5C00A 1OC9B 16GSA 2J9HA 5B6NA 1M9BA 4YKGA 4HQSA 1BQ7A 2BMXA 5GZZB 5ELGA 4BL7B 1K0OA 1X5DA 4XCSA 3GV1A 2HSHA 2HE3A 1QGVA 3WGEA 2HSMA 3LG6A 1U6TA 3HY2A 1EEJA 3GX0A 1JZWA 3VFIA 2VL3A 3BOAA 1GNEA 1DSBA 1SK0A 1V57A 1DBYA 2V32A 2OE1A 3UAPA 2FY6A 2YZUA 4EKZA 4D73A 2MMAA 2F3MA 2DIZA 4XS1A 2GZPA 4GDFA 3CMIA 3I6AA 3A5WA 1B4QA 1HNAA 4KGIA 1E2YA 3U5RE 3GKKA 3VLNA 1PSQA 13GSA 1MEKA 1PMTA 2AHEA 5EVOA 2F9SA 1WJKA 19GSA 4XIHA 3L78A 2DBCA 2A4VA 3ZIVA 1PL1A 5GAPD 3WGXA 2P5RA 4FH8A 3KZQA 4ECCA 1C72A 1O8WA 2CAQA 5A4WA 3JCML 3ZITA 1F6MC 4BVXA 3ZRDA 2H19A 4MNNA 3LJRA 3TB2A 1B48A 1WPIA 1BF5A 5CNWA 1SL2B 1FHEA 1SK1A 1JZRA 3IE3A 4ECBA 4F03A 4ILFA 1E6BA 3HVXA 1S3DA 1R5AA 5LNKe 1GH2A 4HZ2A 1J08A 1WMJA 5ECMB 3LYPA 4JRRA 2IMDA 3EVIA 3FHKA 1XPVA 3BD2A 1QUWA 5IMZA 1ERUA 3VPQA 6GSWA 5G1KA 2WS2A 3MAKA 2H0HA 2VLTA 1GTAA 4LL1B 2IMKA 3EPTA 3EE2A 3W6GA 2DSAA 4GXZA 1H75A 3SWLA 1TXXA 2K8VA 1KTEA 1R7HA 3GSTA 3GKXA 1THOA 4GCIA 4AJ8A 4A5PA 5GSSA 4LLRA 1OC9A 3F4TA 4PGTA 5CRDA 1FAAA 1GRXA 4GRFA 3QFAC 5IIZA 3NOFA 1K0AA 1ACVA 3PH9A 1GTUA 3LXZA 4O5RA 6GSSA 3APQA 3IA1A 5A34A 4ZL8A 3MIXA 4XS4A 4TRXA 1K0NA 3S9FA 1Z7RA 2L6CA 4IP1A 3M1GA 2PVOC 8GSSA 4RUVA 3HMJG 5E59A 3VWXA 6GSVA 4H86A 2VCTA 4F9ZA 5EL8A 2E7PA 5J4VA 3VWUA 5HFKA 4RQRA 2MBTA 4YQUA 4OCEA 2FHEA 2KUCA 1BG1A 2VO4A 5DAKB 2EIRA 1TXUA 1MDIA 4BVYB 3GH9A 3ZVJA 2EFHA 3D4MA 2FLSA 1F3BA 3DKSA 2HNLA 4ML6A 1K0DA 2HXKA 4XRDA 1TDIA 2LRTA 1EGRA 5J4UA 4PUAA 3KH9A 4MA9A 2B5EA 3HD5A 2DKHA 2VLUA 3FZ5A 2VCXA 4PQHA 2L4QA 4NHWA 3IPZA 1QQ2A 4FYUA 3NZNA 1ZCPA 1F2EA 2YNXA 1TW9A 1SVMA 3W8SA 1AUCA 1FB0A 4W66A 1NM3A 3KP9A 1TOFA 1TU8A 2VCWA 1EWXA 1GP1A 4HZ4A 17GSA 5J41A 3TKSC 4GQFA 1B9XC 1QXHA 3GIXA 2HT9A 2BJXA 2JZSA 4PXOA 2H01A 1JHBA 3IBHA 4CW9A 4EDZA 1A2MA 3A2XA 4MJEA 3J7Yk 1LU4A 4ZB9A 3GMFA 3QPMA 2AB6A 4KCEA 1PN9A 5F06A 4J56E 2EFEA 5HR0A 1U3AA 4LA1A 1XWBA 3GNJA 1X9SB 2WDUA 2PERA 2YZHA 4POMA 1FB6A 4KUNA 5DALA 1K3YA 2K18A 2P31A 9GSSA 3M9KA 4P3YB 3FMWA 1O73A 4X1UA 3WYWA 2AUVA 2GT5A 2H6XA 1A0FA 3C71A 1A8YA 1ABAA 4Z7XA 2LJKA 4MZBA 1M9AA 3K8NA 3P8WA 4E8HA 2NPBA 3FZAA 4WF5A 3CYNA 3D4TA 2VD1A 2B3SA 2EC4A 1MTCA 5JWRB 4F0BA 3HKRA 4G9HA 2L57A 4K7IA 2LQOA 4IS0A 4GF0A 3O6TA 4KA0A 5ECLB 3TJBA 2VL2A 2N5AA 1ZYNA 5G31A 3G7YA 2H1DA 2HFDA 4Q5FA 2JSYA 2GSTA 4QL7A 1AQVA 2O7KA 4PUFC 5J9BA 3O76A 2DMLA 2TIRA 3DEXA 1V9WA 1GLPA 2C0GA 3M0FA 5BMUB 1F37A 1N8JA 1RQMA 5ECPB 4L0WA 2H1BA 3TKSE 1M99A 3WT1A 2HSMB 1U87A 1YJ6A 2CZ2A 4K1FA 3HDCA 2OACA 2O87A 3F6FA 5J5NA 3KGKA 4GLTA 1ZMAA 1LBKA 4HQZA 4F2IA 1OVNA 4G0IA 4D73B 4KSMA 5D9XA 3QOUA 3D6IA 1GSSA 4ISDA 4MZCA 5A4VA 4O92A 3L4NA 2OE3A 2MMOA 5JCGA 3IK9A 1Z6NA 3RPNA 3C1SA 4K7OA 1NHYA 4RQXA 1TKDB 1GNWA 1U3IA 2DJ2A 1GUHA 2FGXA 3A2VA 4EUYA 1SVOA 5DDLA 1F3AA 2V41A 4LMVA 4AJ7A 2L5LA 3F0IA 4TN8A 1XWCA 2YCDA 4CHSA 1URMA 3EMXA 4PX1A 5IO2A 5AISA 2GQKA 2IFQA 2H6YA 4HOJA 5C04A 1M2BA 4BVXB 2IMFA 3VI5A 1UA5A 1MD3A 3VK9A 2LNSA 4YAVA 2LNTA 1VF4A 2LJRA 4ZXGA 5L71A 2LRNA 2O85A 2R4VA 1YZXA 3GX8A 1XVWA 5D9TA 3D21A 2C80A 3QMXA 4ZILA 1BAYA 2OBIA 3TUEA 2CZ3A 12GSA 2GDRA 3DXBA 2YP6A 5JCUA 2H73A 2CX4A 3UMAA 5KOXA 3ERWA 5DJMA 1XZOA 1B9YC 5IMCA 3C73A 1ILOA 3CWGA 2RIIA 1GULA 5FWGA 3KIJA 1SK2A 1K0CA 3FR3A 1AQWA 1S3AA 1A0RP 3IC4A 1N25A 1X0RA 5EPFA 1XIYA 1Q4JA 14GSA 4G0KA 11GSA 1UC7A 2KHPA 4XHMA 5GAND 1T8EB 2QGVA 5A5HA 4I97A 2OADA 1Z5YE 4KSOA 4ZBBA 3I43A 4WR5A 5A34B 1IYHA 2X8HA 4XS4B 1S3CA 2F8AA 1G6YA 1Y6EA 1SU9A 2GQLA 1EEMA 3KJYA 1PA3A 3KCMA 2KP1A 2H0GA 3KTLA 5HR2A 5D9WA 1XCCA 3EC3A 4O32A 4YQVA 1M2DA 1T1VA 3GTUA 5DVBA 2QC7A 4HUAA 3APOA 1EGOA 3EINA 2YANA 1XVQA 1ZGNA 1Y1UA 3IHQA 1HQOA 5CRWA 3KMOA 4K0NA 4POLA 4MF6A 4OFTA 3I9V2 2L5OA 3RHBA 4PURA 2V6OA 4N3ZA 3LEFA 1M0UA 3ZFBA 3R2QA 4PQIA 4EIPA 1OE7A 2PUKC 3Q74A 1PKZA 3UVTA 2JADA 5ABRA 2NTOA 1AQXA 6GSXA 4Q5QA 3TKQA 3FEUA 4AKXB 3CTGA 3O3TA 5AN1A 2XPDA 2CT6A 1TRWA 3MYDA 1ZYQB 1I9DA 1Y25A 3RBTA 3TJKA 2C3QA 3FY7A 2CQ9A 2WULA 4FQUA 2C0FA 4K7NA 3EMPA 5GSTA 2FNOA 2KP2A 4NV5A 5HR3A 5J9CA 1NSWA 2GGTA 3UBLA 2ZCTA 1XWGA 1GUMA 1GSQA 1TI1A 3KTBA 4MABA 5ECOB 4GTUA 3TJFA 3KD0A 3HYPA 4PNFA 2LKUA 2DC5A 4DVCA 4PQ1A 1SJIA 1CQHA 1QMVA 2OKAA 2PBJA 4ZB6A 18GSA 2HYXA 5CAXA 6GSTA 4AKHA 5DALB 3QAVA 1HNCA 2BTOT 4HU7A 1MDKA 2WJUA 2MYGA 3UIWA 4G0LA 22GSA 2GQMA 4Z2UA 2V6KA 2ZUPA 2H71A 4JR4A 2B5YA 5G30A 1VGLA 4ACSA 2MZCA 5HR1A 4MDCA 2NDOA 3A5IA 1KBNA 4EE0A 3P90A 4AKIA 3HCZA 2JZTA 2GZZA 5G5EA 5COHA 4MLYA 5KN3A 1R26A 4EVMA 2M46A 1PGTA 3UVHA 2R0PA 4OFMA 1R4WA 4QL9A 1XOAA 5A1NA 2XHFA 1SD9A 5IMAA 3EYTA 2VAFA 1BJXA 1ST9A 4KB3A 2I81A 2PWJA 4ZIJA 3UEMA 2UV8G 1PX7A 3F4RA 5ELAA 4V2MA 2CVDA 4IELA 4TVEA 4L8EA 5B7CA 2RUEA 5IO0A 1TRVA 1G7OA 2XC2A 2TRCP 1T4ZA 4TXOA 3UARA 2VM1A 4IJ3A 4TR4A 4USSA 5HFIA 3TJGA 4TKYA 3ZMKA 2C3TA 5IPHA 4Z2RA 4Q5RA 1LJRA 1K0MA 1ERTA 3CRUA 4MK3A 4V1Ag 2GSSA 3ZFLA 5H5SA 4Z2TA 1BYEA 4RI6A 1EOHA 2M80A 3TU3B 2I3YA 1XWKA 4POKA 1A2JA 5A4UA 3IHGA 3TJJA 1X5CA 1SENA 4MJCA 1HD2A 2LUSA 2VKZG 3P7XA 2I1UA 4I6XA 2KOKA 1T4YA 1XFLA 3MWHA 3PGTA 3QR6A 2H66A 1AIUA 2LV3A 4L0UA 1EOGA 4GSTA 1X9WB 1V2AA 2HRFA 2B7KA 4DEJA 4DSRA 4MMMA 3L9SA 2K9FA 2HSNA 3VWVA 3HZ4A 1SL0B 3IAS2 1WP0A 4F82A 1VF3A 5LD0A 2JSZA 1GTBA 3E9JB 4KDUA 1ZYPA 3KXOA 5KEJA 2YN1A 4E68A 1K3OA 4HDEA 2TRXA 2YJ7A 3IXRA 3LW9A 2P5QA 4HJMA 2IIYA 2V1MA 3HXSA 2GSRA 5ECSA 1M2AA 4TR1A 3QAGA 4IBPA 3HJMA 2IFQB 2D2ZA 4EL1A 2C1YA 4AF2A 1ERVA 3ZYWA 1SVLA 5G5FA 5DCHA 1FOHA 2G2QA 4IW9A 2DJ0A 1TI3A 3HA9A 1SKRB 2XPEA 4TXVA 2YJHA 3IK7A 5KN1A 1YDKA 3OR5A 4X0XA 4G10A 2C8UA 2GLRA 3TRQA 1XBSA 4N10A 3IR4A 3VI7A 2J23A 5F8BA 2B7JA 1V58A 4IN0A 2CA8A 1JZOA 1O6JA 4G19A 2H72A 3TKPA 4GSNA 3QAWA 5F0GA 1J0FA 3KH7A 2YWOA 3L9VA 1G6WA 3CTFA 1TP9A 2FCHA 4K6XA 3QD9A 3J7Yb 4O5QA 2AJQB 2R0GA 3TGZA 2CV4A 1GSDA 2X99A 3EU4A 3DRNA 4BWQA 5D73A 4Q5NA 2VCZA 2DJKA 1FOVA 5IOXA 3ME8A 7GSSA 1KEBA 4FO5A 2M72A 4WXTA 3EU3A 2LRCA 5A5HB 4IQAA 2VD0A 4MF5A 2X49A 2OBKA 4I8BA 4TOPA 2N5FA 5AIXA 3UOMA 3LFLA 2O5VA 4MH3A 5D96A 4BA7A 3IC8A 2WCIA 2OE0A 4N11A 2VL2C 3A3TA 5B6MA 1X5EA 2GZYA 4I2UA 3IDVA 2ALBA 5CREA 3GTUB 2R0CA 2ES7A 4JBBA 3D5JA 5HQPA 3ZVJD 3DVWA 4WETA 2FWGA 2L59A 2CAIA 4HI7A 3GKMA 1XW5A 5DBQA 3DGQA 1PN0A 1JFUA 3FZ4A 1WOUA 3FZ9A 1JZDA 2H1LA 4JEDA 3FW2A 5ID2A 5DJLA 2OA7A 3ZTLA 1AW9A 4JR6A 10GSA 3MSZA 4I5QA 4DSQA 3BBYA 3ZZXA 2H6ZA 5IMDA 4X4JA 3HJOA 1B4PA 3U6VA 3LXTA 2IWTA 2IL3A 1HNBA 4GWRA 2LJAA 3VPTA 1AAZA 3RAZA 2DMMA 1SKSB 1OYJA 3BCKA 4MF7A 1TK5B 2MBSA 1A24A 2FD3A 5E4WA 3CSIA 2DJ3A 3QDNA 1VF2A 4NAXA 5IMVA 3GFKA 5J40A 5IQYA 5IPGA 4ZB7A 1ZZYA 3GL3A 2HRNA 1BG5A 2VCQA 3KP8A 3FKFA 5G1LA 3VWWA 3N9JA 3H79A 1V98A 5J3RA 3I69A 1EV9A 1YF1A 3HZ8A 5J47A 1W4VA 3ERFA 2LQQA 3PPUA 5ECRB 5J4YA 2NVLA 3E0UA 2AAWA 3LGCA 2H0IA 2R2JA 2PMTA 4XS6A 2C0EA 3GL5A 3GKNA 4GQCA 2PU9C 2HRKA 1ZYEA 2H30A 3F63A 4K8MA 4IVFA 1O8XA 1Z7PA 4WF4A 5AGYA 1WWJA 5ENUA 2EFDA 2ON7A 2WGRA 1ERWA 4NMUA 5A1NB 1OKTA 1GLQA 6GSYA 2B5XA 3ERGA 4NXIA 3F8UA 2GS3A 2E2MA 3FRCA 3DIEA 1H4OA 4WR4A 1QK8A 4KDXA 4ZL9A 2VM2A 4K9ZA 3Q6OA 2B1LA 4KDYA 4MPFA 1EP8A 2C4JA 3ZREA 2KLXA 2O89A 2A4HA 2EFCA 1Z6MA 5JWOB 5D9VA 5CRGA 5F07A 4EO3A 2L4CA 3GA4A 1M7TA 3GUSA 5FHIA 4CY8A 3UL3A 1O7UA 4I2TA 4TXOB 1SD8A 4WBJA 2B1KA 2DKIA 3FYGA 3L9UA 2VCVA 3EURA 2R5GA 4IHUA 2HZEA 2LS5A 4AKGA 4L5LA 2H8LA 4ID0A 1GL8A 4ZB8A 4K0GA 1JLVA 4ZL7A 3L0HA 4KX4A 6GSUA 1OKDA 2IN3A 4MH2A 1TRSA 2F51A 3Q18A 4JU5A 3P2AA 5B8AA 1TK8B 3HHVA 2PVQA 4MP4A 2HZFA 4EIQA 3DMLA 1GSEA 3GHAA 1VRSD 5JCWA 3HVSA 3GRXA 2X8GA 3H4KA 2DJ1A 3AY8A 4WEYA 5IM9A 2MMZA 2HSNB 1DE2A 4JZQA 1K0BA 2PGTA 3LWAA 1PD21 2RM6A 3LORA 2HLSA 4OFNA 5CP1A 4HU9A 3IV4A 2AV4A 3CRTA 4TR1B 2ZNMA 3UBKA 4XTSA 1EV4A 3DD3A 2DJJA 4DSSA 3H93A 4ZBAA 3RDWA 1G7EA 2UZ8A 1XW6A 1XWAA 4E8EA 3V1WA 4PTSA 3TRXA 1PKWA 1YVLA 1OC3A 5EY6A 4YH2A 3ZIJA 3UJ1A 5G2ZA 1RW1A 2FA4A 4QMKA 1TK0B 1T00A 2L6DA 1YY7A 4XRAA 3IRAA 4G2EA 5KOWA 4LL4B 2VIMA 1ON4A 1GWCA 4KF9A 4KW6A 5DCGA 1BX9A 1AXDA 2JACA 2WZ9A 2IMEA 3FR6A 3F6DA 1FVJA 3E3EA 1YKCA 4OWYA 4BL7A 2LEGA 3GURA 2HQTA 4V1Ap 1OC8A 1TJDA 3F9UA 1NW2A 5CRHA 1A23A 1U88A 3GYKA 4IGJA 4N0VA 4KH7A 5CO3A 4X43A 3NIVA 1MDJA 5D8IA 2REMA 5DQYA 3ZMLA 3A2WA 1JLWA 1DE1A 2HI7A 4IJIA 4FIWA 3TKSA 4WBRD 3C1RA 3CBUA 1QFNA 2PPTA 1FW1A 1CQGA 5LCZA 4CDOA 4EXJA 3ISOA 1GSYA 1SJZA 3QCPA 3ZLPA 2A2SA 1EZKA 1TU7A 5AIVA 4IP6A 3TRPA 3MDKA 2CVBA 5KN0A 3LQ7A 2O8VB 2XBIA 5DQSA 2F8FA 3TKRA 4BWSA 5A5KA 2MMNA 1PQNA 3WGDA 3CSJA 2GT6A 2C3NA 4GSSA 3G7IA 2QA1A 3IOSA 4MJAA 2HRAA 3FK8A 4EDYA 1SYXA 1W89A 3FR9A 2YV9A 5ECIB 2I4AA 5HFGA 4EC0A 4FYCA 2I9HA 3QFBC 2YWNA 3F4SA 5B8BA 2H76A 4ML1A 3DVXA 2LTKA 5ID2B 2C0DA 1YQ1A 2X64A 2YWMA 2JU5A 2A2PA 5F05A 1PRXA 4KNDA 2K6VA 4CY6A 4YAPA 4OD7A 4O5UA 1VF1A 1TTZA 3GN3A 2IMIA 2CX3A 2RLIA 2GVPA 1XOBA 2X4AA 3RPPA 3C7MA 3C8EA 4OO5A 4V2NA 4WKWA 1X9MB 5FT3A 2FWFA 2P0GA 1HYUA 3G9BA 1SKWB 3TCOA 3CSHA 2VOCA 1R5PA 2VUPA 1FG4A 3EWLA 3PINA 3ED3A 2XBQA 5ECKB 3M3MA 3KM6A 2H70A 3IAM2 4IKHA 3APSA 2R37A 4K5RA 2GSQA 3D0ZA 4KCAA 3WD6A 3KMNA 2DLXA 2NBSA 3HJPA 4AI6A 5KN2A 2G0FA 5ECHB 4YQMA 1DUGA 4OCFA 2WFCA 1Z3EA 3GH6A 1YEXA 2DIYA 5ECNB 2R6KA 4NWYA 4IQ1A 2V2GA 4O7HA 5H5QA 2B6MA 1XW9A 2OJLA 1ZOFA 3TOUA 4V2LA 4K5SA 1IYIA 2R3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MD4 A;  4QQ7 A;  4MJB A;  3KEB A;  4L5O A;  4N0Z A;  1OAZ A;  5INY A;  1WIK A;  3BJ5 A;  2JL4 A;  4FYB A;  4MPG A;  1FO5 A;  3US3 A;  2K8S A;  2Z9S A;  20GS A;  2HRK B;  2GTU A;  3MNG A;  4TW5 A;  4HEA 2;  2PN8 A;  5JWQ B;  3RHC A;  3PR8 A;  4RI7 A;  3D22 A;  4ZBD A;  1OE8 A;  1T3B A;  3H8Q A;  4JE1 A;  5DAK A;  4ULX A;  4BVY A;  1USB A;  3VUR A;  1UVZ A;  5IMF A;  4HS1 A;  1SL1 B;  4AJ6 A;  4TR3 A;  1Z9H A;  2E0Q A;  4KAE A;  2JZR A;  1V40 A;  1FVK A;  2RUF A;  1WE0 A;  2N5B A;  1J9B A;  3M8N A;  4MCU A;  4OMV A;  1SJ6 A;  1B8X A;  1UN2 A;  1PX6 A;  1XXU A;  1O85 A;  2HZE B;  4MZW A;  4J2F A;  2FWH A;  2ON5 A;  2H1G A;  1YKA A;  1O81 A;  1YF0 A;  4LMW A;  1WRY A;  3F3R A;  5ECQ B;  3LSZ A;  1SYR A;  3Q19 A;  4NHZ A;  3H1N A;  1F9M A;  3R3E A;  5CYY A;  1BED A;  3ME7 A;  5D93 A;  1AC1 A;  2YPM A;  1GTI A;  2YOI A;  1ZL9 A;  1N2A A;  3DWV A;  1GUK A;  2H1A A;  2LST A;  3BCI A;  3LYK A;  3N5O A;  2H75 A;  2RM5 A;  2HSY A;  1GSF A;  3TOT A;  4HJ2 A;  2QKE A;  4NV2 A;  4NPB A;  3ZL5 A;  2CVK A;  4ECJ A;  2FA8 A;  3WT2 A;  4ECI A;  2FUG 2;  4AGS A;  4TR0 A;  4EF0 A;  3TDG A;  2H74 A;  2AYT A;  2QSI A;  2EIQ A;  4J57 E;  1GSU A;  1KNG A;  2YV7 A;  2EIO A;  1A2L A;  4K2D A;  4DSS B;  1ML6 A;  2FWE A;  2VL9 A;  3CXG A;  1K3L A;  1YEP A;  3G7J A;  4OO4 A;  3DYR A;  4KE3 A;  5H5R A;  3SBC A;  2X8C A;  1Q98 A;  2IJY A;  3F3Q A;  1PL2 A;  4N30 A;  4F0C A;  2IPA A;  4PNG A;  4POB A;  2WRT A;  2E2G A;  1THX A;  1RK4 A;  2WB9 A;  3W8J A;  4BPY A;  2YWI A;  1EP7 A;  2VLV A;  3M9J A;  1TRU A;  2A2R A;  1I5G A;  1NHO A;  1A8L A;  1T7P B;  5IOW A;  5BMU A;  3HVV A;  1G0T A;  3GSS A;  5C00 A;  1OC9 B;  16GS A;  2J9H A;  5B6N A;  1M9B A;  4HQS A;  1BQ7 A;  2BMX A;  5GZZ B;  5ELG A;  4BL7 B;  1K0O A;  1X5D A;  4XCS A;  3GV1 A;  2HSH A;  2HE3 A;  1QGV A;  3WGE A;  2HSM A;  3LG6 A;  1U6T A;  3HY2 A;  1EEJ A;  3GX0 A;  1JZW A;  3VFI A;  2VL3 A;  3BOA A;  1GNE A;  1DSB A;  1SK0 A;  1V57 A;  1DBY A;  2V32 A;  2OE1 A;  3UAP A;  2FY6 A;  2YZU A;  4EKZ A;  4D73 A;  2MMA A;  2F3M A;  2DIZ A;  4XS1 A;  2GZP A;  3CMI A;  3I6A A;  3A5W A;  1B4Q A;  1HNA A;  4KGI A;  1E2Y A;  3U5R E;  3GKK A;  3VLN A;  1PSQ A;  13GS A;  1MEK A;  1PMT A;  2AHE A;  5EVO A;  2F9S A;  1WJK A;  19GS A;  4XIH A;  3L78 A;  2DBC A;  2A4V A;  3ZIV A;  1PL1 A;  5GAP D;  3WGX A;  2P5R A;  4FH8 A;  3KZQ A;  4ECC A;  1C72 A;  1O8W A;  2CAQ A;  5A4W A;  3JCM L;  3ZIT A;  1F6M C;  4BVX A;  3ZRD A;  2H19 A;  3LJR A;  3TB2 A;  1B48 A;  1WPI A;  5CNW A;  1SL2 B;  1FHE A;  1SK1 A;  1JZR A;  3IE3 A;  4ECB A;  4F03 A;  4ILF A;  1E6B A;  3HVX A;  1S3D A;  1R5A A;  5LNK e;  1GH2 A;  4HZ2 A;  1J08 A;  1WMJ A;  5ECM B;  3LYP A;  4JRR A;  2IMD A;  3EVI A;  3FHK A;  1XPV A;  3BD2 A;  1QUW A;  5IMZ A;  1ERU A;  3VPQ A;  6GSW A;  5G1K A;  2WS2 A;  3MAK A;  2H0H A;  2VLT A;  1GTA A;  4LL1 B;  2IMK A;  3EE2 A;  3W6G A;  2DSA A;  4GXZ A;  1H75 A;  3SWL A;  1TXX A;  2K8V A;  1KTE A;  1R7H A;  3GST A;  3GKX A;  1THO A;  4GCI A;  4AJ8 A;  5GSS A;  4LLR A;  1OC9 A;  3F4T A;  4PGT A;  5CRD A;  1FAA A;  1GRX A;  4GRF A;  3QFA C;  5IIZ A;  3NOF A;  1K0A A;  1ACV A;  3PH9 A;  1GTU A;  3LXZ A;  4O5R A;  6GSS A;  3APQ A;  3IA1 A;  4ZL8 A;  4XS4 A;  4TRX A;  1K0N A;  3S9F A;  1Z7R A;  2L6C A;  4IP1 A;  3M1G A;  2PVO C;  8GSS A;  4RUV A;  5E59 A;  3VWX A;  6GSV A;  4H86 A;  2VCT A;  4F9Z A;  5EL8 A;  2E7P A;  3VWU A;  5HFK A;  4RQR A;  2MBT A;  4YQU A;  4OCE A;  2FHE A;  2KUC A;  2VO4 A;  5DAK B;  2EIR A;  1MDI A;  4BVY B;  3GH9 A;  3ZVJ A;  3D4M A;  2FLS A;  1F3B A;  3DKS A;  2HNL A;  4ML6 A;  1K0D A;  2HXK A;  4XRD A;  1TDI A;  2LRT A;  1EGR A;  5J4U A;  4PUA A;  3KH9 A;  4MA9 A;  2B5E A;  3HD5 A;  2VLU A;  3FZ5 A;  2VCX A;  4PQH A;  2L4Q A;  4NHW A;  3IPZ A;  1QQ2 A;  4FYU A;  3NZN A;  1ZCP A;  1F2E A;  2YNX A;  1TW9 A;  3W8S A;  1AUC A;  1FB0 A;  1NM3 A;  3KP9 A;  1TOF A;  1TU8 A;  2VCW A;  1EWX A;  1GP1 A;  4HZ4 A;  17GS A;  5J41 A;  3TKS C;  4GQF A;  1B9X C;  1QXH A;  3GIX A;  2HT9 A;  2BJX A;  2JZS A;  4PXO A;  2H01 A;  1JHB A;  3IBH A;  4CW9 A;  4EDZ A;  1A2M A;  3A2X A;  4MJE A;  3J7Y k;  1LU4 A;  4ZB9 A;  3GMF A;  3QPM A;  2AB6 A;  4KCE A;  1PN9 A;  5F06 A;  4J56 E;  5HR0 A;  1U3A A;  4LA1 A;  1XWB A;  3GNJ A;  1X9S B;  2WDU A;  2PER A;  2YZH A;  4POM A;  1FB6 A;  4KUN A;  5DAL A;  1K3Y A;  2K18 A;  2P31 A;  9GSS A;  3M9K A;  4P3Y B;  1O73 A;  4X1U A;  3WYW A;  2AUV A;  2GT5 A;  2H6X A;  1A0F A;  3C71 A;  1A8Y A;  1ABA A;  4Z7X A;  2LJK A;  4MZB A;  1M9A A;  3P8W A;  3K8N A;  4E8H A;  2NPB A;  3FZA A;  4WF5 A;  3CYN A;  3D4T A;  2VD1 A;  2B3S A;  2EC4 A;  1MTC A;  5JWR B;  4F0B A;  3HKR A;  4G9H A;  2L57 A;  4K7I A;  2LQO A;  4IS0 A;  4GF0 A;  3O6T A;  4KA0 A;  5ECL B;  3TJB A;  2VL2 A;  2N5A A;  5G31 A;  3G7Y A;  2H1D A;  2HFD A;  4Q5F A;  2JSY A;  2GST A;  4QL7 A;  1AQV A;  2O7K A;  4PUF C;  5J9B A;  3O76 A;  2DML A;  2TIR A;  3DEX A;  1V9W A;  1GLP A;  2C0G A;  3M0F A;  1F37 A;  1N8J A;  1RQM A;  5ECP B;  4L0W A;  2H1B A;  3TKS E;  1M99 A;  3WT1 A;  2HSM B;  1U87 A;  1YJ6 A;  2CZ2 A;  4K1F A;  3HDC A;  2OAC A;  2O87 A;  3F6F A;  5J5N A;  3KGK A;  4GLT A;  1ZMA A;  1LBK A;  4HQZ A;  4F2I A;  1OVN A;  4G0I A;  4D73 B;  4KSM A;  5D9X A;  3QOU A;  3D6I A;  1GSS A;  4ISD A;  4MZC A;  5A4V A;  4O92 A;  3L4N A;  2OE3 A;  2MMO A;  5JCG A;  3IK9 A;  1Z6N A;  3RPN A;  3C1S A;  4K7O A;  1NHY A;  4RQX A;  1TKD B;  1GNW A;  1U3I A;  2DJ2 A;  1GUH A;  2FGX A;  3A2V A;  4EUY A;  5DDL A;  1F3A A;  2V41 A;  4LMV A;  4AJ7 A;  2L5L A;  3F0I A;  4TN8 A;  1XWC A;  2YCD A;  4CHS A;  1URM A;  3EMX A;  4PX1 A;  5IO2 A;  5AIS A;  2GQK A;  2IFQ A;  2H6Y A;  4HOJ A;  5C04 A;  1M2B A;  4BVX B;  2IMF A;  3VI5 A;  1UA5 A;  1MD3 A;  3VK9 A;  2LNS A;  4YAV A;  2LNT A;  1VF4 A;  2LJR A;  4ZXG A;  5L71 A;  2LRN A;  2O85 A;  2R4V A;  1YZX A;  3GX8 A;  1XVW A;  5D9T A;  3D21 A;  2C80 A;  3QMX A;  4ZIL A;  1BAY A;  2OBI A;  3TUE A;  2CZ3 A;  12GS A;  2GDR A;  3DXB A;  2YP6 A;  5JCU A;  2H73 A;  2CX4 A;  3UMA A;  3ERW A;  5DJM A;  1XZO A;  1B9Y C;  5IMC A;  3C73 A;  1ILO A;  2RII A;  1GUL A;  5FWG A;  3KIJ A;  1SK2 A;  1K0C A;  3FR3 A;  1AQW A;  1S3A A;  1A0R P;  3IC4 A;  1X0R A;  5EPF A;  1XIY A;  1Q4J A;  14GS A;  4G0K A;  11GS A;  1UC7 A;  2KHP A;  4XHM A;  5GAN D;  1T8E B;  2QGV A;  4I97 A;  2OAD A;  1Z5Y E;  4KSO A;  4ZBB A;  3I43 A;  4WR5 A;  1IYH A;  2X8H A;  4XS4 B;  1S3C A;  2F8A A;  1G6Y A;  1Y6E A;  1SU9 A;  2GQL A;  1EEM A;  3KJY A;  1PA3 A;  3KCM A;  2KP1 A;  2H0G A;  3KTL A;  5HR2 A;  5D9W A;  1XCC A;  3EC3 A;  4O32 A;  4YQV A;  1M2D A;  1T1V A;  3GTU A;  5DVB A;  2QC7 A;  4HUA A;  3APO A;  1EGO A;  3EIN A;  2YAN A;  1XVQ A;  1ZGN A;  3IHQ A;  1HQO A;  5CRW A;  3KMO A;  4K0N A;  4POL A;  4MF6 A;  4OFT A;  3I9V 2;  2L5O A;  3RHB A;  4PUR A;  2V6O A;  3LEF A;  1M0U A;  3ZFB A;  3R2Q A;  4PQI A;  1OE7 A;  2PUK C;  3Q74 A;  1PKZ A;  3UVT A;  2JAD A;  5ABR A;  2NTO A;  1AQX A;  6GSX A;  4Q5Q A;  3TKQ A;  3FEU A;  3CTG A;  3O3T A;  5AN1 A;  2XPD A;  2CT6 A;  1TRW A;  1ZYQ B;  1I9D A;  1Y25 A;  3RBT A;  3TJK A;  2C3Q A;  3FY7 A;  2CQ9 A;  2WUL A;  4FQU A;  2C0F A;  4K7N A;  3EMP A;  5GST A;  2FNO A;  2KP2 A;  4NV5 A;  5HR3 A;  5J9C A;  1NSW A;  2GGT A;  3UBL A;  2ZCT A;  1XWG A;  1GUM A;  1GSQ A;  1TI1 A;  3KTB A;  4MAB A;  5ECO B;  4GTU A;  3TJF A;  3KD0 A;  3HYP A;  4PNF A;  2LKU A;  2DC5 A;  4DVC A;  4PQ1 A;  1SJI A;  1CQH A;  1QMV A;  2OKA A;  2PBJ A;  4ZB6 A;  18GS A;  2HYX A;  5CAX A;  6GST A;  5DAL B;  3QAV A;  1HNC A;  2BTO T;  4HU7 A;  1MDK A;  2WJU A;  2MYG A;  3UIW A;  4G0L A;  22GS A;  2GQM A;  2V6K A;  2ZUP A;  2H71 A;  4JR4 A;  2B5Y A;  5G30 A;  1VGL A;  4ACS A;  2MZC A;  5HR1 A;  4MDC A;  2NDO A;  1KBN A;  4EE0 A;  3P90 A;  3HCZ A;  2JZT A;  2GZZ A;  5G5E A;  5COH A;  4MLY A;  5KN3 A;  1R26 A;  4EVM A;  2M46 A;  1PGT A;  3UVH A;  4OFM A;  1R4W A;  4QL9 A;  1XOA A;  2XHF A;  1SD9 A;  5IMA A;  3EYT A;  2VAF A;  1BJX A;  1ST9 A;  4KB3 A;  2I81 A;  2PWJ A;  4ZIJ A;  3UEM A;  1PX7 A;  3F4R A;  5ELA A;  4V2M A;  2CVD A;  4IEL A;  4TVE A;  4L8E A;  5B7C A;  2RUE A;  5IO0 A;  1TRV A;  1G7O A;  2XC2 A;  2TRC P;  1T4Z A;  4TXO A;  3UAR A;  2VM1 A;  4IJ3 A;  4TR4 A;  4USS A;  5HFI A;  3TJG A;  4TKY A;  3ZMK A;  2C3T A;  5IPH A;  4Q5R A;  1LJR A;  1K0M A;  1ERT A;  3CRU A;  4MK3 A;  4V1A g;  2GSS A;  3ZFL A;  5H5S A;  1BYE A;  4RI6 A;  1EOH A;  2M80 A;  2I3Y A;  1XWK A;  4POK A;  1A2J A;  5A4U A;  3TJJ A;  1X5C A;  1SEN A;  4MJC A;  1HD2 A;  2LUS A;  3P7X A;  2I1U A;  4I6X A;  2KOK A;  1T4Y A;  1XFL A;  3MWH A;  3PGT A;  3QR6 A;  2H66 A;  1AIU A;  2LV3 A;  4L0U A;  1EOG A;  4GST A;  1X9W B;  1V2A A;  2HRF A;  2B7K A;  4DEJ A;  4DSR A;  4MMM A;  3L9S A;  2K9F A;  3VWV A;  3HZ4 A;  1SL0 B;  3IAS 2;  1WP0 A;  4F82 A;  1VF3 A;  5LD0 A;  2JSZ A;  1GTB A;  3E9J B;  4KDU A;  3KXO A;  5KEJ A;  2YN1 A;  1K3O A;  4HDE A;  2TRX A;  2YJ7 A;  3IXR A;  2P5Q A;  4HJM A;  2IIY A;  2V1M A;  3HXS A;  2GSR A;  5ECS A;  1M2A A;  4TR1 A;  3QAG A;  4IBP A;  3HJM A;  2IFQ B;  2D2Z A;  4EL1 A;  2C1Y A;  4AF2 A;  1ERV A;  3ZYW A;  5G5F A;  5DCH A;  2G2Q A;  4IW9 A;  2DJ0 A;  1TI3 A;  3HA9 A;  1SKR B;  2XPE A;  4TXV A;  2YJH A;  3IK7 A;  5KN1 A;  1YDK A;  3OR5 A;  4X0X A;  4G10 A;  2C8U A;  2GLR A;  3TRQ A;  1XBS A;  4N10 A;  3IR4 A;  3VI7 A;  2J23 A;  5F8B A;  2B7J A;  1V58 A;  4IN0 A;  2CA8 A;  1JZO A;  1O6J A;  4G19 A;  2H72 A;  3TKP A;  4GSN A;  3QAW A;  5F0G A;  1J0F A;  3KH7 A;  2YWO A;  3L9V A;  1G6W A;  3CTF A;  1TP9 A;  2FCH A;  4K6X A;  3QD9 A;  3J7Y b;  2AJQ B;  3TGZ A;  2CV4 A;  1GSD A;  2X99 A;  3EU4 A;  3DRN A;  4BWQ A;  5D73 A;  4Q5N A;  2VCZ A;  2DJK A;  1FOV A;  5IOX A;  3ME8 A;  7GSS A;  1KEB A;  4FO5 A;  2M72 A;  4WXT A;  3EU3 A;  2LRC A;  4IQA A;  2VD0 A;  4MF5 A;  2OBK A;  4I8B A;  4TOP A;  2N5F A;  5AIX A;  3UOM A;  3LFL A;  4MH3 A;  5D96 A;  4BA7 A;  3IC8 A;  2WCI A;  2OE0 A;  4N11 A;  2VL2 C;  3A3T A;  5B6M A;  1X5E A;  2GZY A;  4I2U A;  3IDV A;  2ALB A;  5CRE A;  3GTU B;  2ES7 A;  4JBB A;  3D5J A;  5HQP A;  3ZVJ D;  3DVW A;  4WET A;  2FWG A;  2L59 A;  2CAI A;  4HI7 A;  3GKM A;  1XW5 A;  5DBQ A;  3DGQ A;  1JFU A;  3FZ4 A;  1WOU A;  3FZ9 A;  1JZD A;  4JED A;  3FW2 A;  5ID2 A;  5DJL A;  2OA7 A;  3ZTL A;  1AW9 A;  4JR6 A;  10GS A;  3MSZ A;  4I5Q A;  4DSQ A;  3BBY A;  3ZZX A;  2H6Z A;  5IMD A;  3HJO A;  1B4P A;  3U6V A;  3LXT A;  2IWT A;  2IL3 A;  1HNB A;  4GWR A;  2LJA A;  3VPT A;  1AAZ A;  3RAZ A;  2DMM A;  1SKS B;  1OYJ A;  3BCK A;  4MF7 A;  1TK5 B;  2MBS A;  1A24 A;  2FD3 A;  5E4W A;  3CSI A;  2DJ3 A;  3QDN A;  1VF2 A;  4NAX A;  5IMV A;  3GFK A;  5IQY A;  5IPG A;  1ZZY A;  3GL3 A;  2HRN A;  1BG5 A;  2VCQ A;  3KP8 A;  3FKF A;  5G1L A;  3VWW A;  3N9J A;  3H79 A;  1V98 A;  5J3R A;  3I69 A;  1EV9 A;  1YF1 A;  3HZ8 A;  1W4V A;  3ERF A;  2LQQ A;  3PPU A;  5ECR B;  2NVL A;  3E0U A;  2AAW A;  3LGC A;  2H0I A;  2R2J A;  2PMT A;  4XS6 A;  2C0E A;  3GL5 A;  3GKN A;  4GQC A;  2PU9 C;  2HRK A;  1ZYE A;  2H30 A;  3F63 A;  4K8M A;  4IVF A;  1O8X A;  1Z7P A;  4WF4 A;  5AGY A;  1WWJ A;  5ENU A;  2ON7 A;  2WGR A;  1ERW A;  4NMU A;  1OKT A;  1GLQ A;  6GSY A;  2B5X A;  3ERG A;  4NXI A;  3F8U A;  2GS3 A;  2E2M A;  3FRC A;  3DIE A;  1H4O A;  4WR4 A;  1QK8 A;  4KDX A;  4ZL9 A;  2VM2 A;  4K9Z A;  3Q6O A;  2B1L A;  4KDY A;  4MPF A;  1EP8 A;  2C4J A;  3ZRE A;  2KLX A;  2O89 A;  1Z6M A;  5JWO B;  5D9V A;  5CRG A;  5F07 A;  4EO3 A;  2L4C A;  3GA4 A;  1M7T A;  3GUS A;  5FHI A;  3UL3 A;  1O7U A;  4I2T A;  4TXO B;  1SD8 A;  4WBJ A;  2B1K A;  3L9U A;  3FYG A;  2VCV A;  3EUR A;  2R5G A;  4IHU A;  2HZE A;  2LS5 A;  4L5L A;  2H8L A;  4ID0 A;  1GL8 A;  4ZB8 A;  4K0G A;  1JLV A;  4ZL7 A;  3L0H A;  4KX4 A;  6GSU A;  1OKD A;  2IN3 A;  4MH2 A;  1TRS A;  2F51 A;  3Q18 A;  4JU5 A;  3P2A A;  5B8A A;  1TK8 B;  3HHV A;  2PVQ A;  4MP4 A;  2HZF A;  3DML A;  1GSE A;  3GHA A;  1VRS D;  5JCW A;  3HVS A;  3GRX A;  2X8G A;  3H4K A;  2DJ1 A;  3AY8 A;  4WEY A;  5IM9 A;  2MMZ A;  2HSN B;  1DE2 A;  4JZQ A;  1K0B A;  2PGT A;  3LWA A;  1PD2 1;  2RM6 A;  3LOR A;  2HLS A;  4OFN A;  5CP1 A;  4HU9 A;  3IV4 A;  2AV4 A;  3CRT A;  4TR1 B;  2ZNM A;  3UBK A;  4XTS A;  1EV4 A;  3DD3 A;  2DJJ A;  4DSS A;  3H93 A;  4ZBA A;  3RDW A;  1G7E A;  2UZ8 A;  1XW6 A;  1XWA A;  4E8E A;  3V1W A;  4PTS A;  3TRX A;  1PKW A;  1OC3 A;  5EY6 A;  4YH2 A;  3ZIJ A;  3UJ1 A;  5G2Z A;  1RW1 A;  2FA4 A;  1TK0 B;  1T00 A;  2L6D A;  1YY7 A;  4XRA A;  3IRA A;  4G2E A;  4LL4 B;  2VIM A;  1ON4 A;  1GWC A;  4KF9 A;  4KW6 A;  5DCG A;  1BX9 A;  1AXD A;  2JAC A;  2WZ9 A;  2IME A;  3FR6 A;  3F6D A;  1FVJ A;  3E3E A;  1YKC A;  4OWY A;  4BL7 A;  2LEG A;  3GUR A;  2HQT A;  4V1A p;  1OC8 A;  1TJD A;  3F9U A;  1NW2 A;  5CRH A;  1A23 A;  1U88 A;  3GYK A;  4IGJ A;  4N0V A;  4KH7 A;  5CO3 A;  4X43 A;  3NIV A;  1MDJ A;  5D8I A;  2REM A;  5DQY A;  3ZML A;  3A2W A;  1JLW A;  1DE1 A;  2HI7 A;  4IJI A;  4FIW A;  3TKS A;  4WBR D;  3C1R A;  3CBU A;  1QFN A;  2PPT A;  1FW1 A;  1CQG A;  5LCZ A;  4CDO A;  4EXJ A;  3ISO A;  1GSY A;  1SJZ A;  3QCP A;  3ZLP A;  2A2S A;  1EZK A;  1TU7 A;  5AIV A;  4IP6 A;  3TRP A;  3MDK A;  2CVB A;  5KN0 A;  3LQ7 A;  2O8V B;  2XBI A;  5DQS A;  2F8F A;  3TKR A;  4BWS A;  5A5K A;  2MMN A;  1PQN A;  3WGD A;  3CSJ A;  2GT6 A;  2C3N A;  4GSS A;  3G7I A;  3IOS A;  4MJA A;  2HRA A;  3FK8 A;  4EDY A;  1SYX A;  1W89 A;  3FR9 A;  2YV9 A;  5ECI B;  2I4A A;  5HFG A;  4EC0 A;  4FYC A;  2I9H A;  3QFB C;  2YWN A;  3F4S A;  5B8B A;  2H76 A;  4ML1 A;  3DVX A;  2LTK A;  5ID2 B;  2C0D A;  1YQ1 A;  2X64 A;  2YWM A;  2JU5 A;  5F05 A;  1PRX A;  4KND A;  2K6V A;  4YAP A;  4OD7 A;  1VF1 A;  1TTZ A;  3GN3 A;  2IMI A;  2CX3 A;  2RLI A;  2GVP A;  1XOB A;  3RPP A;  3C7M A;  3C8E A;  4OO5 A;  4V2N A;  4WKW A;  1X9M B;  5FT3 A;  2FWF A;  2P0G A;  1HYU A;  3G9B A;  1SKW B;  3TCO A;  3CSH A;  2VOC A;  1R5P A;  2VUP A;  1FG4 A;  3EWL A;  3PIN A;  3ED3 A;  2XBQ A;  5ECK B;  3M3M A;  3KM6 A;  2H70 A;  3IAM 2;  4IKH A;  3APS A;  2R37 A;  4KCA A;  2GSQ A;  3D0Z A;  3WD6 A;  3KMN A;  2DLX A;  2NBS A;  3HJP A;  5KN2 A;  2G0F A;  5ECH B;  4YQM A;  1DUG A;  4OCF A;  2WFC A;  1Z3E A;  3GH6 A;  1YEX A;  2DIY A;  5ECN B;  2R6K A;  4NWY A;  4IQ1 A;  2V2G A;  4O7H A;  5H5Q A;  2B6M A;  1XW9 A;  2OJL A;  1ZOF A;  3TOU A;  4V2L A;  1IYI A;  2R3X A; 
#chains in the Genus database with same CATH topology
 1MD4 A;  4QQ7 A;  4MJB A;  3KEB A;  4L5O A;  4N0Z A;  1OAZ A;  5INY A;  1WIK A;  3BJ5 A;  2JL4 A;  4FYB A;  4MPG A;  1FO5 A;  3US3 A;  2K8S A;  2Z9S A;  20GS A;  2HRK B;  2GTU A;  3MNG A;  4TW5 A;  4HEA 2;  2PN8 A;  5JWQ B;  3RHC A;  3PR8 A;  4RI7 A;  3D22 A;  4ZBD A;  1OE8 A;  1T3B A;  3H8Q A;  4JE1 A;  5DAK A;  4ULX A;  4BVY A;  1USB A;  3VUR A;  1UVZ A;  5IMF A;  4HS1 A;  1SL1 B;  4AJ6 A;  4TR3 A;  1Z9H A;  2E0Q A;  4KAE A;  2JZR A;  1V40 A;  1FVK A;  2RUF A;  4K2X A;  1WE0 A;  2N5B A;  1J9B A;  3M8N A;  4MCU A;  4OMV A;  2QA2 A;  1SJ6 A;  1B8X A;  1UN2 A;  1PX6 A;  1XXU A;  1O85 A;  2HZE B;  4MZW A;  4J2F A;  2FWH A;  2ON5 A;  2H1G A;  1YKA A;  1O81 A;  1YF0 A;  4LMW A;  3HVN A;  1WRY A;  3F3R A;  5ECQ B;  3LSZ A;  1SYR A;  3Q19 A;  4NHZ A;  3H1N A;  1F9M A;  3R3E A;  5CYY A;  1BED A;  3ME7 A;  5D93 A;  1AC1 A;  2YPM A;  1GTI A;  4PI0 C;  2YOI A;  1ZL9 A;  1N2A A;  3DWV A;  1GUK A;  2H1A A;  2LST A;  3BCI A;  3LYK A;  3N5O A;  2H75 A;  2RM5 A;  2HSY A;  1GSF A;  3TOT A;  4HJ2 A;  2QKE A;  4NV2 A;  4NPB A;  3ZL5 A;  2CVK A;  4ECJ A;  2FA8 A;  3WT2 A;  5BRT A;  4ECI A;  2FUG 2;  4AGS A;  4TR0 A;  4EF0 A;  3TDG A;  2H74 A;  2AYT A;  2QSI A;  2EIQ A;  4J57 E;  1GSU A;  1KNG A;  2YV7 A;  2EIO A;  1A2L A;  4K2D A;  4DSS B;  1ML6 A;  2FWE A;  2VL9 A;  3CXG A;  1K3L A;  1YEP A;  4YKF A;  3G7J A;  4OO4 A;  3DYR A;  4KE3 A;  5H5R A;  3SBC A;  2X8C A;  4G01 A;  1Q98 A;  2IJY A;  3F3Q A;  1PL2 A;  4N30 A;  4F0C A;  2IPA A;  4PNG A;  4POB A;  2WRT A;  2E2G A;  1THX A;  4ICY A;  2OT3 A;  1RK4 A;  2WB9 A;  3W8J A;  4BPY A;  2YWI A;  1EP7 A;  2VLV A;  3M9J A;  1TRU A;  2A2R A;  1I5G A;  1NHO A;  1A8L A;  1T7P B;  5IOW A;  5BMU A;  3HVV A;  1G0T A;  3GSS A;  5C00 A;  1OC9 B;  16GS A;  2J9H A;  5B6N A;  1M9B A;  4YKG A;  4HQS A;  1BQ7 A;  2BMX A;  5GZZ B;  5ELG A;  4BL7 B;  1K0O A;  1X5D A;  4XCS A;  3GV1 A;  2HSH A;  2HE3 A;  1QGV A;  3WGE A;  2HSM A;  3LG6 A;  1U6T A;  3HY2 A;  1EEJ A;  3GX0 A;  1JZW A;  3VFI A;  2VL3 A;  3BOA A;  1GNE A;  1DSB A;  1SK0 A;  1V57 A;  1DBY A;  2V32 A;  2OE1 A;  3UAP A;  2FY6 A;  2YZU A;  4EKZ A;  4D73 A;  2MMA A;  2F3M A;  2DIZ A;  4XS1 A;  3CMI A;  2GZP A;  4GDF A;  3I6A A;  3A5W A;  1B4Q A;  1HNA A;  4KGI A;  1E2Y A;  3U5R E;  3GKK A;  3VLN A;  1PSQ A;  13GS A;  1MEK A;  1PMT A;  2AHE A;  5EVO A;  2F9S A;  1WJK A;  19GS A;  4XIH A;  3L78 A;  2DBC A;  2A4V A;  3ZIV A;  1PL1 A;  5GAP D;  3WGX A;  2P5R A;  4FH8 A;  3KZQ A;  4ECC A;  1C72 A;  1O8W A;  2CAQ A;  5A4W A;  3JCM L;  3ZIT A;  1F6M C;  4BVX A;  3ZRD A;  2H19 A;  4MNN A;  3LJR A;  3TB2 A;  1B48 A;  1WPI A;  1BF5 A;  5CNW A;  2WVX B;  1SL2 B;  1FHE A;  4PI2 C;  1SK1 A;  1JZR A;  3IE3 A;  4ECB A;  4F03 A;  4ILF A;  1E6B A;  3HVX A;  1S3D A;  1R5A A;  5LNK e;  1GH2 A;  4HZ2 A;  1J08 A;  1WMJ A;  5ECM B;  3LYP A;  4JRR A;  2IMD A;  3EVI A;  3FHK A;  1XPV A;  3BD2 A;  1QUW A;  5IMZ A;  1ERU A;  3VPQ A;  6GSW A;  5G1K A;  2WS2 A;  3MAK A;  2H0H A;  2VLT A;  1GTA A;  4LL1 B;  2IMK A;  3EPT A;  3EE2 A;  3W6G A;  2DSA A;  4GXZ A;  1H75 A;  3SWL A;  1TXX A;  2K8V A;  1KTE A;  1R7H A;  3GST A;  3GKX A;  1THO A;  4GCI A;  4AJ8 A;  4A5P A;  5GSS A;  4LLR A;  1OC9 A;  3F4T A;  4PGT A;  5CRD A;  2WVY A;  1FAA A;  1GRX A;  4GRF A;  3QFA C;  5IIZ A;  3NOF A;  1K0A A;  1ACV A;  3PH9 A;  1GTU A;  3LXZ A;  4O5R A;  6GSS A;  3APQ A;  3IA1 A;  5A34 A;  4ZL8 A;  3MIX A;  4XS4 A;  4TRX A;  1K0N A;  3S9F A;  1Z7R A;  2L6C A;  4IP1 A;  3M1G A;  2PVO C;  8GSS A;  4RUV A;  3HMJ G;  5E59 A;  3VWX A;  6GSV A;  4H86 A;  2VCT A;  4F9Z A;  5EL8 A;  2E7P A;  5J4V A;  3VWU A;  5HFK A;  4RQR A;  2MBT A;  4YQU A;  4OCE A;  2FHE A;  2KUC A;  1BG1 A;  2VO4 A;  5DAK B;  2EIR A;  1TXU A;  1MDI A;  4BVY B;  3GH9 A;  3ZVJ A;  2EFH A;  3D4M A;  2FLS A;  1F3B A;  3DKS A;  2HNL A;  4ML6 A;  1M3J A;  1K0D A;  2HXK A;  4XRD A;  1TDI A;  2LRT A;  1EGR A;  5J4U A;  4PUA A;  3KH9 A;  4MA9 A;  2B5E A;  3HD5 A;  2DKH A;  2VLU A;  3FZ5 A;  2VCX A;  4PQH A;  2L4Q A;  4NHW A;  3IPZ A;  1QQ2 A;  4FYU A;  3NZN A;  1ZCP A;  1F2E A;  2YNX A;  1TW9 A;  1SVM A;  3W8S A;  1AUC A;  1FB0 A;  4W66 A;  1NM3 A;  3KP9 A;  1TOF A;  1TU8 A;  2VCW A;  1EWX A;  1GP1 A;  4HZ4 A;  17GS A;  5J41 A;  3TKS C;  4GQF A;  1B9X C;  1QXH A;  3GIX A;  2HT9 A;  2BJX A;  2JZS A;  4PXO A;  2H01 A;  1JHB A;  3IBH A;  4CW9 A;  4EDZ A;  1A2M A;  3A2X A;  4MJE A;  2WW0 A;  3J7Y k;  1LU4 A;  4ZB9 A;  3GMF A;  3QPM A;  2AB6 A;  4KCE A;  1PN9 A;  5F06 A;  4J56 E;  2EFE A;  5HR0 A;  1U3A A;  4LA1 A;  1XWB A;  3GNJ A;  1X9S B;  2WDU A;  2PER A;  2YZH A;  4FXY P;  4POM A;  1FB6 A;  4KUN A;  5DAL A;  1K3Y A;  2K18 A;  2P31 A;  9GSS A;  3M9K A;  4P3Y B;  3FMW A;  1O73 A;  4X1U A;  3WYW A;  2AUV A;  2GT5 A;  2H6X A;  1A0F A;  3C71 A;  1A8Y A;  1ABA A;  4Z7X A;  2LJK A;  4MZB A;  1M9A A;  3K8N A;  3P8W A;  4E8H A;  2NPB A;  3FZA A;  4WF5 A;  3CYN A;  3D4T A;  2VD1 A;  2B3S A;  2EC4 A;  1MTC A;  5JWR B;  4F0B A;  3HKR A;  4G9H A;  2L57 A;  4K7I A;  2LQO A;  4IS0 A;  4GF0 A;  3O6T A;  4KA0 A;  5ECL B;  3TJB A;  2VL2 A;  2N5A A;  1ZYN A;  5G31 A;  3G7Y A;  2H1D A;  2HFD A;  4Q5F A;  2JSY A;  2GST A;  4QL7 A;  1AQV A;  2O7K A;  4PUF C;  5J9B A;  3O76 A;  2DML A;  2TIR A;  3DEX A;  1V9W A;  1GLP A;  2C0G A;  3M0F A;  5BMU B;  1F37 A;  1N8J A;  1RQM A;  5ECP B;  4L0W A;  2H1B A;  3TKS E;  1M99 A;  2WW1 A;  3WT1 A;  2HSM B;  1U87 A;  1YJ6 A;  2CZ2 A;  4K1F A;  3HDC A;  2OAC A;  2O87 A;  3F6F A;  5J5N A;  3KGK A;  4GLT A;  1ZMA A;  1LBK A;  4HQZ A;  4F2I A;  1OVN A;  4G0I A;  4D73 B;  4KSM A;  5D9X A;  3QOU A;  3D6I A;  1GSS A;  4ISD A;  4MZC A;  5A4V A;  4O92 A;  3L4N A;  2OE3 A;  2MMO A;  5JCG A;  3IK9 A;  1Z6N A;  3RPN A;  3C1S A;  4K7O A;  1NHY A;  4RQX A;  1TKD B;  1GNW A;  1U3I A;  2DJ2 A;  1GUH A;  2FGX A;  3A2V A;  4EUY A;  1SVO A;  5DDL A;  1F3A A;  2V41 A;  4LMV A;  4AJ7 A;  2L5L A;  3F0I A;  4TN8 A;  1XWC A;  2WW3 A;  2YCD A;  2O3E A;  4CHS A;  1URM A;  3EMX A;  4PX1 A;  5IO2 A;  5AIS A;  2GQK A;  2IFQ A;  2H6Y A;  4HOJ A;  5C04 A;  1M2B A;  4BVX B;  2IMF A;  3VI5 A;  1UA5 A;  1MD3 A;  3VK9 A;  2LNS A;  4YAV A;  2LNT A;  1VF4 A;  2LJR A;  4ZXG A;  5L71 A;  2LRN A;  2O85 A;  2R4V A;  1YZX A;  3GX8 A;  1XVW A;  5D9T A;  3D21 A;  2C80 A;  3QMX A;  4ZIL A;  1BAY A;  2OBI A;  3TUE A;  2CZ3 A;  12GS A;  2GDR A;  3DXB A;  2YP6 A;  5JCU A;  2H73 A;  2CX4 A;  3UMA A;  5KOX A;  3ERW A;  5DJM A;  1XZO A;  1B9Y C;  5IMC A;  3C73 A;  1ILO A;  3CWG A;  2RII A;  1GUL A;  5FWG A;  3KIJ A;  1SK2 A;  1K0C A;  3FR3 A;  1AQW A;  1S3A A;  1A0R P;  3IC4 A;  1N25 A;  1X0R A;  5EPF A;  1XIY A;  1Q4J A;  14GS A;  4G0K A;  11GS A;  1UC7 A;  2KHP A;  4XHM A;  5GAN D;  1T8E B;  2QGV A;  5A5H A;  4I97 A;  2OAD A;  1Z5Y E;  4KSO A;  4ZBB A;  3I43 A;  4WR5 A;  5A34 B;  1IYH A;  2X8H A;  4XS4 B;  1S3C A;  2F8A A;  1G6Y A;  1Y6E A;  1SU9 A;  2GQL A;  1EEM A;  3KJY A;  1PA3 A;  3KCM A;  2KP1 A;  2H0G A;  3KTL A;  5HR2 A;  5D9W A;  1XCC A;  3EC3 A;  4O32 A;  4YQV A;  1M2D A;  1T1V A;  3GTU A;  5DVB A;  2QC7 A;  4HUA A;  3APO A;  1EGO A;  3EIN A;  2YAN A;  1XVQ A;  1ZGN A;  1Y1U A;  3IHQ A;  1HQO A;  5CRW A;  3KMO A;  4K0N A;  4POL A;  4MF6 A;  4OFT A;  3I9V 2;  2L5O A;  3RHB A;  4PUR A;  2V6O A;  4N3Z A;  3LEF A;  1M0U A;  3ZFB A;  3R2Q A;  4PQI A;  4EIP A;  1OE7 A;  2PUK C;  3Q74 A;  1PKZ A;  3UVT A;  2JAD A;  5ABR A;  2NTO A;  1AQX A;  6GSX A;  4Q5Q A;  3TKQ A;  3FEU A;  4AKX B;  3CTG A;  3O3T A;  5AN1 A;  4PHZ C;  2XPD A;  2CT6 A;  1TRW A;  3MYD A;  1ZYQ B;  1I9D A;  1Y25 A;  3RBT A;  3TJK A;  2C3Q A;  3FY7 A;  2CQ9 A;  2WUL A;  4FQU A;  2C0F A;  4K7N A;  3EMP A;  5GST A;  2FNO A;  2KP2 A;  4NV5 A;  5HR3 A;  5J9C A;  1NSW A;  2GGT A;  3UBL A;  2ZCT A;  1XWG A;  1GUM A;  1GSQ A;  2O36 A;  1TI1 A;  3KTB A;  4MAB A;  5ECO B;  4GTU A;  3TJF A;  3KD0 A;  3HYP A;  4PNF A;  2LKU A;  2DC5 A;  4DVC A;  4PQ1 A;  1SJI A;  1CQH A;  1PFO A;  1QMV A;  2OKA A;  2PBJ A;  4ZB6 A;  18GS A;  2HYX A;  5CAX A;  6GST A;  4AKH A;  5DAL B;  3QAV A;  1HNC A;  2BTO T;  4HU7 A;  1MDK A;  2WJU A;  2MYG A;  3UIW A;  4G0L A;  22GS A;  2GQM A;  4Z2U A;  2V6K A;  2ZUP A;  2H71 A;  4JR4 A;  2B5Y A;  5G30 A;  1VGL A;  4ACS A;  2MZC A;  5HR1 A;  4MDC A;  2NDO A;  3A5I A;  1KBN A;  4EE0 A;  1XG8 A;  3P90 A;  4AKI A;  3HCZ A;  2JZT A;  2GZZ A;  5G5E A;  5COH A;  4MLY A;  5KN3 A;  1R26 A;  4EVM A;  2M46 A;  1PGT A;  3UVH A;  2R0P A;  4OFM A;  1R4W A;  4QL9 A;  1XOA A;  5A1N A;  2XHF A;  1SD9 A;  5IMA A;  3EYT A;  2VAF A;  1BJX A;  1ST9 A;  4KB3 A;  2I81 A;  2PWJ A;  4ZIJ A;  3UEM A;  2UV8 G;  1PX7 A;  3F4R A;  5ELA A;  4V2M A;  2CVD A;  4IEL A;  2WW2 A;  4TVE A;  4L8E A;  5B7C A;  2RUE A;  5IO0 A;  1TRV A;  1G7O A;  2XC2 A;  2TRC P;  1T4Z A;  4TXO A;  3UAR A;  2VM1 A;  4IJ3 A;  4TR4 A;  4USS A;  5HFI A;  3TJG A;  4TKY A;  3ZMK A;  2C3T A;  5IPH A;  4Z2R A;  4Q5R A;  1LJR A;  1K0M A;  1ERT A;  3CRU A;  4MK3 A;  4V1A g;  2GSS A;  3ZFL A;  5H5S A;  4Z2T A;  1BYE A;  4RI6 A;  1EOH A;  2M80 A;  3TU3 B;  3CHX C;  2I3Y A;  1XWK A;  4POK A;  1A2J A;  5A4U A;  3IHG A;  3TJJ A;  1X5C A;  1SEN A;  4MJC A;  1HD2 A;  2LUS A;  2VKZ G;  3P7X A;  2I1U A;  4I6X A;  2KOK A;  1T4Y A;  1XFL A;  3MWH A;  3PGT A;  3QR6 A;  2H66 A;  1AIU A;  2LV3 A;  4L0U A;  1EOG A;  4GST A;  1X9W B;  1V2A A;  2HRF A;  2B7K A;  4DEJ A;  4DSR A;  4MMM A;  3L9S A;  2K9F A;  2HSN A;  3VWV A;  3HZ4 A;  1SL0 B;  3IAS 2;  1WP0 A;  4F82 A;  1VF3 A;  5LD0 A;  2JSZ A;  1GTB A;  3E9J B;  4KDU A;  1ZYP A;  3KXO A;  5KEJ A;  2YN1 A;  4E68 A;  1K3O A;  4HDE A;  2TRX A;  2YJ7 A;  3IXR A;  3LW9 A;  2P5Q A;  4HJM A;  2IIY A;  2V1M A;  3HXS A;  2GSR A;  5ECS A;  1M2A A;  4TR1 A;  3QAG A;  4IBP A;  3HJM A;  2IFQ B;  2D2Z A;  4EL1 A;  2C1Y A;  4AF2 A;  1ERV A;  3ZYW A;  1SVL A;  5G5F A;  5DCH A;  1FOH A;  2G2Q A;  4IW9 A;  2DJ0 A;  1TI3 A;  3HA9 A;  1SKR B;  2XPE A;  4TXV A;  2YJH A;  3IK7 A;  5KN1 A;  1YDK A;  3OR5 A;  4X0X A;  4G10 A;  2C8U A;  2GLR A;  3TRQ A;  1XBS A;  4N10 A;  3IR4 A;  3VI7 A;  2J23 A;  5F8B A;  2B7J A;  1V58 A;  4IN0 A;  2CA8 A;  1JZO A;  1O6J A;  4G19 A;  2H72 A;  3TKP A;  4GSN A;  3QAW A;  5F0G A;  1J0F A;  3KH7 A;  2YWO A;  3L9V A;  1G6W A;  3CTF A;  1TP9 A;  2FCH A;  1S4B P;  4K6X A;  3QD9 A;  3J7Y b;  4O5Q A;  2AJQ B;  2R0G A;  3CQF A;  3TGZ A;  2CV4 A;  1GSD A;  2X99 A;  3EU4 A;  3DRN A;  4BWQ A;  5D73 A;  4Q5N A;  2VCZ A;  2DJK A;  1FOV A;  5IOX A;  3ME8 A;  7GSS A;  1KEB A;  4FO5 A;  2M72 A;  4WXT A;  3EU3 A;  2LRC A;  5A5H B;  4IQA A;  2VD0 A;  4MF5 A;  2X49 A;  2OBK A;  4I8B A;  4TOP A;  2N5F A;  5AIX A;  3UOM A;  3RGB C;  3LFL A;  2O5V A;  4MH3 A;  5D96 A;  4BA7 A;  3IC8 A;  2WCI A;  2OE0 A;  4N11 A;  2VL2 C;  3A3T A;  5B6M A;  1X5E A;  2GZY A;  4I2U A;  3IDV A;  2ALB A;  5CRE A;  3GTU B;  2R0C A;  2ES7 A;  4JBB A;  3D5J A;  5HQP A;  3ZVJ D;  3DVW A;  4WET A;  2FWG A;  2L59 A;  2CAI A;  4HI7 A;  3GKM A;  1XW5 A;  5DBQ A;  3DGQ A;  1PN0 A;  1JFU A;  3FZ4 A;  1WOU A;  3FZ9 A;  1JZD A;  4BIK A;  2H1L A;  4JED A;  3FW2 A;  5ID2 A;  5DJL A;  2OA7 A;  3ZTL A;  1AW9 A;  4JR6 A;  10GS A;  3MSZ A;  4I5Q A;  4DSQ A;  3BBY A;  3ZZX A;  2H6Z A;  5IMD A;  4X4J A;  3HJO A;  1B4P A;  3U6V A;  3LXT A;  2IWT A;  2IL3 A;  1HNB A;  4GWR A;  2LJA A;  3VPT A;  1AAZ A;  3RAZ A;  2DMM A;  1SKS B;  1OYJ A;  3BCK A;  4MF7 A;  1TK5 B;  2MBS A;  1A24 A;  2FD3 A;  5E4W A;  3CSI A;  2DJ3 A;  3QDN A;  1VF2 A;  4NAX A;  5IMV A;  3GFK A;  5J40 A;  5IQY A;  5IPG A;  4ZB7 A;  1ZZY A;  3GL3 A;  2HRN A;  1BG5 A;  2VCQ A;  3KP8 A;  3FKF A;  5G1L A;  3RFR C;  3VWW A;  3N9J A;  3H79 A;  1V98 A;  5J3R A;  3I69 A;  1EV9 A;  1YF1 A;  3HZ8 A;  5J47 A;  1W4V A;  3ERF A;  2LQQ A;  3PPU A;  5ECR B;  5J4Y A;  2NVL A;  3E0U A;  2AAW A;  3LGC A;  2H0I A;  2R2J A;  2PMT A;  4XS6 A;  2C0E A;  3GL5 A;  3GKN A;  4GQC A;  2PU9 C;  2HRK A;  1ZYE A;  2H30 A;  3F63 A;  4K8M A;  4IVF A;  1O8X A;  1Z7P A;  4WF4 A;  5AGY A;  1WWJ A;  5ENU A;  2EFD A;  2ON7 A;  2WGR A;  1ERW A;  4NMU A;  5A1N B;  1OKT A;  1GLQ A;  6GSY A;  2B5X A;  3ERG A;  4NXI A;  3F8U A;  2GS3 A;  2E2M A;  3FRC A;  3DIE A;  1H4O A;  4WR4 A;  1QK8 A;  4KDX A;  4ZL9 A;  2VM2 A;  4K9Z A;  3Q6O A;  2B1L A;  4KDY A;  4MPF A;  1EP8 A;  2WZS A;  2C4J A;  3ZRE A;  2KLX A;  2O89 A;  2A4H A;  2EFC A;  1Z6M A;  5JWO B;  5D9V A;  5CRG A;  5F07 A;  4EO3 A;  2L4C A;  3GA4 A;  1M7T A;  3GUS A;  5FHI A;  4CY8 A;  3UL3 A;  1O7U A;  4I2T A;  4TXO B;  1SD8 A;  4WBJ A;  2B1K A;  2DKI A;  3FYG A;  3L9U A;  2VCV A;  3EUR A;  1M3I A;  2R5G A;  4IHU A;  2HZE A;  2LS5 A;  4AKG A;  4L5L A;  2H8L A;  4ID0 A;  1GL8 A;  4ZB8 A;  4K0G A;  1JLV A;  4ZL7 A;  3L0H A;  4KX4 A;  6GSU A;  1OKD A;  2IN3 A;  4MH2 A;  1TRS A;  2F51 A;  3Q18 A;  4JU5 A;  3P2A A;  5B8A A;  1TK8 B;  3HHV A;  2PVQ A;  4MP4 A;  2HZF A;  4EIQ A;  3DML A;  1GSE A;  3GHA A;  1VRS D;  5JCW A;  3HVS A;  3GRX A;  2X8G A;  3H4K A;  2DJ1 A;  3AY8 A;  4WEY A;  5IM9 A;  2MMZ A;  2HSN B;  1DE2 A;  4JZQ A;  1K0B A;  2PGT A;  3LWA A;  1PD2 1;  2RM6 A;  3LOR A;  2HLS A;  4OFN A;  5CP1 A;  4HU9 A;  3IV4 A;  2AV4 A;  3CRT A;  4TR1 B;  2ZNM A;  3UBK A;  4XTS A;  1EV4 A;  3DD3 A;  2DJJ A;  4DSS A;  3H93 A;  4ZBA A;  3RDW A;  1G7E A;  2UZ8 A;  1YEW C;  1XW6 A;  1XWA A;  4E8E A;  3V1W A;  4PTS A;  3TRX A;  1PKW A;  1YVL A;  1OC3 A;  5EY6 A;  4YH2 A;  3ZIJ A;  3UJ1 A;  5G2Z A;  1RW1 A;  2FA4 A;  4QMK A;  1TK0 B;  1T00 A;  2L6D A;  1YY7 A;  4XRA A;  3IRA A;  4G2E A;  5KOW A;  4LL4 B;  2VIM A;  1ON4 A;  1GWC A;  4KF9 A;  4KW6 A;  5DCG A;  1BX9 A;  1AXD A;  2JAC A;  2WZ9 A;  2IME A;  3FR6 A;  3F6D A;  1FVJ A;  3E3E A;  2WVZ A;  1I1I P;  1YKC A;  4OWY A;  4BL7 A;  2LEG A;  3GUR A;  2HQT A;  4V1A p;  1OC8 A;  1TJD A;  3F9U A;  1NW2 A;  5CRH A;  1A23 A;  1U88 A;  4HSC X;  3GYK A;  4IGJ A;  4N0V A;  4KH7 A;  5CO3 A;  4X43 A;  3NIV A;  1MDJ A;  5D8I A;  2REM A;  5DQY A;  3ZML A;  3A2W A;  1JLW A;  1DE1 A;  2HI7 A;  4IJI A;  4FIW A;  3TKS A;  4WBR D;  3C1R A;  3CBU A;  1QFN A;  2PPT A;  1FW1 A;  1CQG A;  5LCZ A;  1S3R A;  4CDO A;  4EXJ A;  3ISO A;  1GSY A;  1SJZ A;  3QCP A;  3ZLP A;  2A2S A;  1EZK A;  1TU7 A;  5AIV A;  4IP6 A;  3TRP A;  3MDK A;  2CVB A;  5KN0 A;  3LQ7 A;  2O8V B;  2XBI A;  5DQS A;  2F8F A;  3TKR A;  4BWS A;  5A5K A;  2MMN A;  1PQN A;  3WGD A;  3CSJ A;  2GT6 A;  2C3N A;  4GSS A;  3G7I A;  2QA1 A;  3IOS A;  4MJA A;  2HRA A;  3FK8 A;  4EDY A;  1SYX A;  1W89 A;  3FR9 A;  2YV9 A;  5ECI B;  2I4A A;  5HFG A;  4EC0 A;  4FYC A;  2I9H A;  3QFB C;  2YWN A;  3F4S A;  5B8B A;  2H76 A;  4ML1 A;  3DVX A;  2LTK A;  5ID2 B;  2C0D A;  1YQ1 A;  2X64 A;  2YWM A;  2JU5 A;  2WVX A;  2A2P A;  5F05 A;  1PRX A;  4KND A;  2K6V A;  4CY6 A;  4YAP A;  4OD7 A;  4O5U A;  1VF1 A;  1TTZ A;  3GN3 A;  2IMI A;  2CX3 A;  2RLI A;  2GVP A;  1XOB A;  2X4A A;  3RPP A;  3C7M A;  3C8E A;  4OO5 A;  4V2N A;  4WKW A;  1X9M B;  5FT3 A;  2FWF A;  2P0G A;  1HYU A;  3G9B A;  1SKW B;  3TCO A;  3CSH A;  2VOC A;  1R5P A;  2VUP A;  1FG4 A;  3EWL A;  3PIN A;  3ED3 A;  2XBQ A;  5ECK B;  3M3M A;  3KM6 A;  2H70 A;  3IAM 2;  4IKH A;  3APS A;  2R37 A;  4K5R A;  2GSQ A;  3D0Z A;  4KCA A;  3WD6 A;  3KMN A;  2DLX A;  2NBS A;  3HJP A;  4AI6 A;  5KN2 A;  2G0F A;  5ECH B;  4YQM A;  1DUG A;  4OCF A;  2WFC A;  1Z3E A;  3GH6 A;  1YEX A;  2DIY A;  5ECN B;  2R6K A;  4NWY A;  4IQ1 A;  2V2G A;  4O7H A;  5H5Q A;  2B6M A;  1XW9 A;  2OJL A;  1ZOF A;  3TOU A;  4V2L A;  4K5S A;  1IYI A;  2R3X A; 
#chains in the Genus database with same CATH homology
 1MD4 A;  4QQ7 A;  4MJB A;  3KEB A;  4L5O A;  4N0Z A;  1OAZ A;  5INY A;  1WIK A;  3BJ5 A;  2JL4 A;  4FYB A;  4MPG A;  1FO5 A;  3US3 A;  2K8S A;  2Z9S A;  20GS A;  2HRK B;  2GTU A;  3MNG A;  4TW5 A;  4HEA 2;  2PN8 A;  5JWQ B;  3RHC A;  3PR8 A;  4RI7 A;  3D22 A;  4ZBD A;  1OE8 A;  1T3B A;  3H8Q A;  4JE1 A;  5DAK A;  4ULX A;  4BVY A;  1USB A;  3VUR A;  1UVZ A;  5IMF A;  4HS1 A;  1SL1 B;  4AJ6 A;  4TR3 A;  1Z9H A;  2E0Q A;  4KAE A;  2JZR A;  1V40 A;  1FVK A;  2RUF A;  4K2X A;  1WE0 A;  2N5B A;  1J9B A;  3M8N A;  4MCU A;  4OMV A;  2QA2 A;  1SJ6 A;  1B8X A;  1UN2 A;  1PX6 A;  1XXU A;  1O85 A;  2HZE B;  4MZW A;  4J2F A;  2FWH A;  2ON5 A;  2H1G A;  1YKA A;  1O81 A;  1YF0 A;  4LMW A;  1WRY A;  3F3R A;  5ECQ B;  3LSZ A;  1SYR A;  3Q19 A;  4NHZ A;  3H1N A;  1F9M A;  3R3E A;  5CYY A;  1BED A;  3ME7 A;  5D93 A;  1AC1 A;  2YPM A;  1GTI A;  2YOI A;  1ZL9 A;  1N2A A;  3DWV A;  1GUK A;  2H1A A;  2LST A;  3BCI A;  3LYK A;  3N5O A;  2H75 A;  2RM5 A;  2HSY A;  1GSF A;  3TOT A;  4HJ2 A;  2QKE A;  4NV2 A;  4NPB A;  3ZL5 A;  2CVK A;  4ECJ A;  2FA8 A;  3WT2 A;  5BRT A;  4ECI A;  2FUG 2;  4AGS A;  4TR0 A;  4EF0 A;  3TDG A;  2H74 A;  2AYT A;  2QSI A;  2EIQ A;  4J57 E;  1GSU A;  1KNG A;  2YV7 A;  2EIO A;  1A2L A;  4K2D A;  4DSS B;  1ML6 A;  2FWE A;  2VL9 A;  3CXG A;  1K3L A;  1YEP A;  4YKF A;  3G7J A;  4OO4 A;  3DYR A;  4KE3 A;  5H5R A;  3SBC A;  2X8C A;  4G01 A;  1Q98 A;  2IJY A;  3F3Q A;  1PL2 A;  4N30 A;  4F0C A;  2IPA A;  4PNG A;  4POB A;  2WRT A;  2E2G A;  1THX A;  4ICY A;  2OT3 A;  1RK4 A;  2WB9 A;  3W8J A;  4BPY A;  2YWI A;  1EP7 A;  2VLV A;  3M9J A;  1TRU A;  2A2R A;  1I5G A;  1NHO A;  1A8L A;  1T7P B;  5IOW A;  5BMU A;  3HVV A;  1G0T A;  3GSS A;  5C00 A;  1OC9 B;  16GS A;  2J9H A;  5B6N A;  1M9B A;  4YKG A;  4HQS A;  1BQ7 A;  2BMX A;  5GZZ B;  5ELG A;  4BL7 B;  1K0O A;  1X5D A;  4XCS A;  3GV1 A;  2HSH A;  2HE3 A;  1QGV A;  3WGE A;  2HSM A;  3LG6 A;  1U6T A;  3HY2 A;  1EEJ A;  3GX0 A;  1JZW A;  3VFI A;  2VL3 A;  3BOA A;  1GNE A;  1DSB A;  1SK0 A;  1V57 A;  1DBY A;  2V32 A;  2OE1 A;  3UAP A;  2FY6 A;  2YZU A;  4EKZ A;  4D73 A;  2MMA A;  2F3M A;  2DIZ A;  4XS1 A;  2GZP A;  4GDF A;  3CMI A;  3I6A A;  3A5W A;  1B4Q A;  1HNA A;  4KGI A;  1E2Y A;  3U5R E;  3GKK A;  3VLN A;  1PSQ A;  13GS A;  1MEK A;  1PMT A;  2AHE A;  5EVO A;  2F9S A;  1WJK A;  19GS A;  4XIH A;  3L78 A;  2DBC A;  2A4V A;  3ZIV A;  1PL1 A;  5GAP D;  3WGX A;  2P5R A;  4FH8 A;  3KZQ A;  4ECC A;  1C72 A;  1O8W A;  2CAQ A;  5A4W A;  3JCM L;  3ZIT A;  1F6M C;  4BVX A;  3ZRD A;  2H19 A;  4MNN A;  3LJR A;  3TB2 A;  1B48 A;  1WPI A;  1BF5 A;  5CNW A;  1SL2 B;  1FHE A;  1SK1 A;  1JZR A;  3IE3 A;  4ECB A;  4F03 A;  4ILF A;  1E6B A;  3HVX A;  1S3D A;  1R5A A;  5LNK e;  1GH2 A;  4HZ2 A;  1J08 A;  1WMJ A;  5ECM B;  3LYP A;  4JRR A;  2IMD A;  3EVI A;  3FHK A;  1XPV A;  3BD2 A;  1QUW A;  5IMZ A;  1ERU A;  3VPQ A;  6GSW A;  5G1K A;  2WS2 A;  3MAK A;  2H0H A;  2VLT A;  1GTA A;  4LL1 B;  2IMK A;  3EPT A;  3EE2 A;  3W6G A;  2DSA A;  4GXZ A;  1H75 A;  3SWL A;  1TXX A;  2K8V A;  1KTE A;  1R7H A;  3GST A;  3GKX A;  1THO A;  4GCI A;  4AJ8 A;  4A5P A;  5GSS A;  4LLR A;  1OC9 A;  3F4T A;  4PGT A;  5CRD A;  1FAA A;  1GRX A;  4GRF A;  3QFA C;  5IIZ A;  3NOF A;  1K0A A;  1ACV A;  3PH9 A;  1GTU A;  3LXZ A;  4O5R A;  6GSS A;  3APQ A;  3IA1 A;  5A34 A;  4ZL8 A;  3MIX A;  4XS4 A;  4TRX A;  1K0N A;  3S9F A;  1Z7R A;  2L6C A;  4IP1 A;  3M1G A;  2PVO C;  8GSS A;  4RUV A;  3HMJ G;  5E59 A;  3VWX A;  6GSV A;  4H86 A;  2VCT A;  4F9Z A;  5EL8 A;  2E7P A;  5J4V A;  3VWU A;  5HFK A;  4RQR A;  2MBT A;  4YQU A;  4OCE A;  2FHE A;  2KUC A;  1BG1 A;  2VO4 A;  5DAK B;  2EIR A;  1TXU A;  1MDI A;  4BVY B;  3GH9 A;  3ZVJ A;  2EFH A;  3D4M A;  2FLS A;  1F3B A;  3DKS A;  2HNL A;  4ML6 A;  1K0D A;  2HXK A;  4XRD A;  1TDI A;  2LRT A;  1EGR A;  5J4U A;  4PUA A;  3KH9 A;  4MA9 A;  2B5E A;  3HD5 A;  2DKH A;  2VLU A;  3FZ5 A;  2VCX A;  4PQH A;  2L4Q A;  4NHW A;  3IPZ A;  1QQ2 A;  4FYU A;  3NZN A;  1ZCP A;  1F2E A;  2YNX A;  1TW9 A;  1SVM A;  3W8S A;  1AUC A;  1FB0 A;  4W66 A;  1NM3 A;  3KP9 A;  1TOF A;  1TU8 A;  2VCW A;  1EWX A;  1GP1 A;  4HZ4 A;  17GS A;  5J41 A;  3TKS C;  4GQF A;  1B9X C;  1QXH A;  3GIX A;  2HT9 A;  2BJX A;  2JZS A;  4PXO A;  2H01 A;  1JHB A;  3IBH A;  4CW9 A;  4EDZ A;  1A2M A;  3A2X A;  4MJE A;  3J7Y k;  1LU4 A;  4ZB9 A;  3GMF A;  3QPM A;  2AB6 A;  4KCE A;  1PN9 A;  5F06 A;  4J56 E;  2EFE A;  5HR0 A;  1U3A A;  4LA1 A;  1XWB A;  3GNJ A;  1X9S B;  2WDU A;  2PER A;  2YZH A;  4POM A;  1FB6 A;  4KUN A;  5DAL A;  1K3Y A;  2K18 A;  2P31 A;  9GSS A;  3M9K A;  4P3Y B;  3FMW A;  1O73 A;  4X1U A;  3WYW A;  2AUV A;  2GT5 A;  2H6X A;  1A0F A;  3C71 A;  1A8Y A;  1ABA A;  4Z7X A;  2LJK A;  4MZB A;  1M9A A;  3K8N A;  3P8W A;  4E8H A;  2NPB A;  3FZA A;  4WF5 A;  3CYN A;  3D4T A;  2VD1 A;  2B3S A;  2EC4 A;  1MTC A;  5JWR B;  4F0B A;  3HKR A;  4G9H A;  2L57 A;  4K7I A;  2LQO A;  4IS0 A;  4GF0 A;  3O6T A;  4KA0 A;  5ECL B;  3TJB A;  2VL2 A;  2N5A A;  1ZYN A;  5G31 A;  3G7Y A;  2H1D A;  2HFD A;  4Q5F A;  2JSY A;  2GST A;  4QL7 A;  1AQV A;  2O7K A;  4PUF C;  5J9B A;  3O76 A;  2DML A;  2TIR A;  3DEX A;  1V9W A;  1GLP A;  2C0G A;  3M0F A;  5BMU B;  1F37 A;  1N8J A;  1RQM A;  5ECP B;  4L0W A;  2H1B A;  3TKS E;  1M99 A;  3WT1 A;  2HSM B;  1U87 A;  1YJ6 A;  2CZ2 A;  4K1F A;  3HDC A;  2OAC A;  2O87 A;  3F6F A;  5J5N A;  3KGK A;  4GLT A;  1ZMA A;  1LBK A;  4HQZ A;  4F2I A;  1OVN A;  4G0I A;  4D73 B;  4KSM A;  5D9X A;  3QOU A;  3D6I A;  1GSS A;  4ISD A;  4MZC A;  5A4V A;  4O92 A;  3L4N A;  2OE3 A;  2MMO A;  5JCG A;  3IK9 A;  1Z6N A;  3RPN A;  3C1S A;  4K7O A;  1NHY A;  4RQX A;  1TKD B;  1GNW A;  1U3I A;  2DJ2 A;  1GUH A;  2FGX A;  3A2V A;  4EUY A;  1SVO A;  5DDL A;  1F3A A;  2V41 A;  4LMV A;  4AJ7 A;  2L5L A;  3F0I A;  4TN8 A;  1XWC A;  2YCD A;  4CHS A;  1URM A;  3EMX A;  4PX1 A;  5IO2 A;  5AIS A;  2GQK A;  2IFQ A;  2H6Y A;  4HOJ A;  5C04 A;  1M2B A;  4BVX B;  2IMF A;  3VI5 A;  1UA5 A;  1MD3 A;  3VK9 A;  2LNS A;  4YAV A;  2LNT A;  1VF4 A;  2LJR A;  4ZXG A;  5L71 A;  2LRN A;  2O85 A;  2R4V A;  1YZX A;  3GX8 A;  1XVW A;  5D9T A;  3D21 A;  2C80 A;  3QMX A;  4ZIL A;  1BAY A;  2OBI A;  3TUE A;  2CZ3 A;  12GS A;  2GDR A;  3DXB A;  2YP6 A;  5JCU A;  2H73 A;  2CX4 A;  3UMA A;  5KOX A;  3ERW A;  5DJM A;  1XZO A;  1B9Y C;  5IMC A;  3C73 A;  1ILO A;  3CWG A;  2RII A;  1GUL A;  5FWG A;  3KIJ A;  1SK2 A;  1K0C A;  3FR3 A;  1AQW A;  1S3A A;  1A0R P;  3IC4 A;  1N25 A;  1X0R A;  5EPF A;  1XIY A;  1Q4J A;  14GS A;  4G0K A;  11GS A;  1UC7 A;  2KHP A;  4XHM A;  5GAN D;  1T8E B;  2QGV A;  5A5H A;  4I97 A;  2OAD A;  1Z5Y E;  4KSO A;  4ZBB A;  3I43 A;  4WR5 A;  5A34 B;  1IYH A;  2X8H A;  4XS4 B;  1S3C A;  2F8A A;  1G6Y A;  1Y6E A;  1SU9 A;  2GQL A;  1EEM A;  3KJY A;  1PA3 A;  3KCM A;  2KP1 A;  2H0G A;  3KTL A;  5HR2 A;  5D9W A;  1XCC A;  3EC3 A;  4O32 A;  4YQV A;  1M2D A;  1T1V A;  3GTU A;  5DVB A;  2QC7 A;  4HUA A;  3APO A;  1EGO A;  3EIN A;  2YAN A;  1XVQ A;  1ZGN A;  1Y1U A;  3IHQ A;  1HQO A;  5CRW A;  3KMO A;  4K0N A;  4POL A;  4MF6 A;  4OFT A;  3I9V 2;  2L5O A;  3RHB A;  4PUR A;  2V6O A;  4N3Z A;  3LEF A;  1M0U A;  3ZFB A;  3R2Q A;  4PQI A;  4EIP A;  1OE7 A;  2PUK C;  3Q74 A;  1PKZ A;  3UVT A;  2JAD A;  5ABR A;  2NTO A;  1AQX A;  6GSX A;  4Q5Q A;  3TKQ A;  3FEU A;  4AKX B;  3CTG A;  3O3T A;  5AN1 A;  2XPD A;  2CT6 A;  1TRW A;  3MYD A;  1ZYQ B;  1I9D A;  1Y25 A;  3RBT A;  3TJK A;  2C3Q A;  3FY7 A;  2CQ9 A;  2WUL A;  4FQU A;  2C0F A;  4K7N A;  3EMP A;  5GST A;  2FNO A;  2KP2 A;  4NV5 A;  5HR3 A;  5J9C A;  1NSW A;  2GGT A;  3UBL A;  2ZCT A;  1XWG A;  1GUM A;  1GSQ A;  1TI1 A;  3KTB A;  4MAB A;  5ECO B;  4GTU A;  3TJF A;  3KD0 A;  3HYP A;  4PNF A;  2LKU A;  2DC5 A;  4DVC A;  4PQ1 A;  1SJI A;  1CQH A;  1QMV A;  2OKA A;  2PBJ A;  4ZB6 A;  18GS A;  2HYX A;  5CAX A;  6GST A;  4AKH A;  5DAL B;  3QAV A;  1HNC A;  2BTO T;  4HU7 A;  1MDK A;  2WJU A;  2MYG A;  3UIW A;  4G0L A;  22GS A;  2GQM A;  4Z2U A;  2V6K A;  2ZUP A;  2H71 A;  4JR4 A;  2B5Y A;  5G30 A;  1VGL A;  4ACS A;  2MZC A;  5HR1 A;  4MDC A;  2NDO A;  3A5I A;  1KBN A;  4EE0 A;  3P90 A;  4AKI A;  3HCZ A;  2JZT A;  2GZZ A;  5G5E A;  5COH A;  4MLY A;  5KN3 A;  1R26 A;  4EVM A;  2M46 A;  1PGT A;  3UVH A;  2R0P A;  4OFM A;  1R4W A;  4QL9 A;  1XOA A;  5A1N A;  2XHF A;  1SD9 A;  5IMA A;  3EYT A;  2VAF A;  1BJX A;  1ST9 A;  4KB3 A;  2I81 A;  2PWJ A;  4ZIJ A;  3UEM A;  2UV8 G;  1PX7 A;  3F4R A;  5ELA A;  4V2M A;  2CVD A;  4IEL A;  4TVE A;  4L8E A;  5B7C A;  2RUE A;  5IO0 A;  1TRV A;  1G7O A;  2XC2 A;  2TRC P;  1T4Z A;  4TXO A;  3UAR A;  2VM1 A;  4IJ3 A;  4TR4 A;  4USS A;  5HFI A;  3TJG A;  4TKY A;  3ZMK A;  2C3T A;  5IPH A;  4Z2R A;  4Q5R A;  1LJR A;  1K0M A;  1ERT A;  3CRU A;  4MK3 A;  4V1A g;  2GSS A;  3ZFL A;  5H5S A;  4Z2T A;  1BYE A;  4RI6 A;  1EOH A;  2M80 A;  3TU3 B;  2I3Y A;  1XWK A;  4POK A;  1A2J A;  5A4U A;  3IHG A;  3TJJ A;  1X5C A;  1SEN A;  4MJC A;  1HD2 A;  2LUS A;  2VKZ G;  3P7X A;  2I1U A;  4I6X A;  2KOK A;  1T4Y A;  1XFL A;  3MWH A;  3PGT A;  3QR6 A;  2H66 A;  1AIU A;  2LV3 A;  4L0U A;  1EOG A;  4GST A;  1X9W B;  1V2A A;  2HRF A;  2B7K A;  4DEJ A;  4DSR A;  4MMM A;  3L9S A;  2K9F A;  2HSN A;  3VWV A;  3HZ4 A;  1SL0 B;  3IAS 2;  1WP0 A;  4F82 A;  1VF3 A;  5LD0 A;  2JSZ A;  1GTB A;  3E9J B;  4KDU A;  1ZYP A;  3KXO A;  5KEJ A;  2YN1 A;  4E68 A;  1K3O A;  4HDE A;  2TRX A;  2YJ7 A;  3IXR A;  3LW9 A;  2P5Q A;  4HJM A;  2IIY A;  2V1M A;  3HXS A;  2GSR A;  5ECS A;  1M2A A;  4TR1 A;  3QAG A;  4IBP A;  3HJM A;  2IFQ B;  2D2Z A;  4EL1 A;  2C1Y A;  4AF2 A;  1ERV A;  3ZYW A;  1SVL A;  5G5F A;  5DCH A;  1FOH A;  2G2Q A;  4IW9 A;  2DJ0 A;  1TI3 A;  3HA9 A;  1SKR B;  2XPE A;  4TXV A;  2YJH A;  3IK7 A;  5KN1 A;  1YDK A;  3OR5 A;  4X0X A;  4G10 A;  2C8U A;  2GLR A;  3TRQ A;  1XBS A;  4N10 A;  3IR4 A;  3VI7 A;  2J23 A;  5F8B A;  2B7J A;  1V58 A;  4IN0 A;  2CA8 A;  1JZO A;  1O6J A;  4G19 A;  2H72 A;  3TKP A;  4GSN A;  3QAW A;  5F0G A;  1J0F A;  3KH7 A;  2YWO A;  3L9V A;  1G6W A;  3CTF A;  1TP9 A;  2FCH A;  4K6X A;  3QD9 A;  3J7Y b;  4O5Q A;  2AJQ B;  2R0G A;  3TGZ A;  2CV4 A;  1GSD A;  2X99 A;  3EU4 A;  3DRN A;  4BWQ A;  5D73 A;  4Q5N A;  2VCZ A;  2DJK A;  1FOV A;  5IOX A;  3ME8 A;  7GSS A;  1KEB A;  4FO5 A;  2M72 A;  4WXT A;  3EU3 A;  2LRC A;  5A5H B;  4IQA A;  2VD0 A;  4MF5 A;  2X49 A;  2OBK A;  4I8B A;  4TOP A;  2N5F A;  5AIX A;  3UOM A;  3LFL A;  2O5V A;  4MH3 A;  5D96 A;  4BA7 A;  3IC8 A;  2WCI A;  2OE0 A;  4N11 A;  2VL2 C;  3A3T A;  5B6M A;  1X5E A;  2GZY A;  4I2U A;  3IDV A;  2ALB A;  5CRE A;  3GTU B;  2R0C A;  2ES7 A;  4JBB A;  3D5J A;  5HQP A;  3ZVJ D;  3DVW A;  4WET A;  2FWG A;  2L59 A;  2CAI A;  4HI7 A;  3GKM A;  1XW5 A;  5DBQ A;  3DGQ A;  1PN0 A;  1JFU A;  3FZ4 A;  1WOU A;  3FZ9 A;  1JZD A;  2H1L A;  4JED A;  3FW2 A;  5ID2 A;  5DJL A;  2OA7 A;  3ZTL A;  1AW9 A;  4JR6 A;  10GS A;  3MSZ A;  4I5Q A;  4DSQ A;  3BBY A;  3ZZX A;  2H6Z A;  5IMD A;  4X4J A;  3HJO A;  1B4P A;  3U6V A;  3LXT A;  2IWT A;  2IL3 A;  1HNB A;  4GWR A;  2LJA A;  3VPT A;  1AAZ A;  3RAZ A;  2DMM A;  1SKS B;  1OYJ A;  3BCK A;  4MF7 A;  1TK5 B;  2MBS A;  1A24 A;  2FD3 A;  5E4W A;  3CSI A;  2DJ3 A;  3QDN A;  1VF2 A;  4NAX A;  5IMV A;  3GFK A;  5J40 A;  5IQY A;  5IPG A;  4ZB7 A;  1ZZY A;  3GL3 A;  2HRN A;  1BG5 A;  2VCQ A;  3KP8 A;  3FKF A;  5G1L A;  3VWW A;  3N9J A;  3H79 A;  1V98 A;  5J3R A;  3I69 A;  1EV9 A;  1YF1 A;  3HZ8 A;  5J47 A;  1W4V A;  3ERF A;  2LQQ A;  3PPU A;  5ECR B;  5J4Y A;  2NVL A;  3E0U A;  2AAW A;  3LGC A;  2H0I A;  2R2J A;  2PMT A;  4XS6 A;  2C0E A;  3GL5 A;  3GKN A;  4GQC A;  2PU9 C;  2HRK A;  1ZYE A;  2H30 A;  3F63 A;  4K8M A;  4IVF A;  1O8X A;  1Z7P A;  4WF4 A;  5AGY A;  1WWJ A;  5ENU A;  2EFD A;  2ON7 A;  2WGR A;  1ERW A;  4NMU A;  5A1N B;  1OKT A;  1GLQ A;  6GSY A;  2B5X A;  3ERG A;  4NXI A;  3F8U A;  2GS3 A;  2E2M A;  3FRC A;  3DIE A;  1H4O A;  4WR4 A;  1QK8 A;  4KDX A;  4ZL9 A;  2VM2 A;  4K9Z A;  3Q6O A;  2B1L A;  4KDY A;  4MPF A;  1EP8 A;  2C4J A;  3ZRE A;  2KLX A;  2O89 A;  2A4H A;  2EFC A;  1Z6M A;  5JWO B;  5D9V A;  5CRG A;  5F07 A;  4EO3 A;  2L4C A;  3GA4 A;  1M7T A;  3GUS A;  5FHI A;  4CY8 A;  3UL3 A;  1O7U A;  4I2T A;  4TXO B;  1SD8 A;  4WBJ A;  2B1K A;  2DKI A;  3FYG A;  3L9U A;  2VCV A;  3EUR A;  2R5G A;  4IHU A;  2HZE A;  2LS5 A;  4AKG A;  4L5L A;  2H8L A;  4ID0 A;  1GL8 A;  4ZB8 A;  4K0G A;  1JLV A;  4ZL7 A;  3L0H A;  4KX4 A;  6GSU A;  1OKD A;  2IN3 A;  4MH2 A;  1TRS A;  2F51 A;  3Q18 A;  4JU5 A;  3P2A A;  5B8A A;  1TK8 B;  3HHV A;  2PVQ A;  4MP4 A;  2HZF A;  4EIQ A;  3DML A;  1GSE A;  3GHA A;  1VRS D;  5JCW A;  3HVS A;  3GRX A;  2X8G A;  3H4K A;  2DJ1 A;  3AY8 A;  4WEY A;  5IM9 A;  2MMZ A;  2HSN B;  1DE2 A;  4JZQ A;  1K0B A;  2PGT A;  3LWA A;  1PD2 1;  2RM6 A;  3LOR A;  2HLS A;  4OFN A;  5CP1 A;  4HU9 A;  3IV4 A;  2AV4 A;  3CRT A;  4TR1 B;  2ZNM A;  3UBK A;  4XTS A;  1EV4 A;  3DD3 A;  2DJJ A;  4DSS A;  3H93 A;  4ZBA A;  3RDW A;  1G7E A;  2UZ8 A;  1XW6 A;  1XWA A;  4E8E A;  3V1W A;  4PTS A;  3TRX A;  1PKW A;  1YVL A;  1OC3 A;  5EY6 A;  4YH2 A;  3ZIJ A;  3UJ1 A;  5G2Z A;  1RW1 A;  2FA4 A;  4QMK A;  1TK0 B;  1T00 A;  2L6D A;  1YY7 A;  4XRA A;  3IRA A;  4G2E A;  5KOW A;  4LL4 B;  2VIM A;  1ON4 A;  1GWC A;  4KF9 A;  4KW6 A;  5DCG A;  1BX9 A;  1AXD A;  2JAC A;  2WZ9 A;  2IME A;  3FR6 A;  3F6D A;  1FVJ A;  3E3E A;  1YKC A;  4OWY A;  4BL7 A;  2LEG A;  3GUR A;  2HQT A;  4V1A p;  1OC8 A;  1TJD A;  3F9U A;  1NW2 A;  5CRH A;  1A23 A;  1U88 A;  3GYK A;  4IGJ A;  4N0V A;  4KH7 A;  5CO3 A;  4X43 A;  3NIV A;  1MDJ A;  5D8I A;  2REM A;  5DQY A;  3ZML A;  3A2W A;  1JLW A;  1DE1 A;  2HI7 A;  4IJI A;  4FIW A;  3TKS A;  4WBR D;  3C1R A;  3CBU A;  1QFN A;  2PPT A;  1FW1 A;  1CQG A;  5LCZ A;  4CDO A;  4EXJ A;  3ISO A;  1GSY A;  1SJZ A;  3QCP A;  3ZLP A;  2A2S A;  1EZK A;  1TU7 A;  5AIV A;  4IP6 A;  3TRP A;  3MDK A;  2CVB A;  5KN0 A;  3LQ7 A;  2O8V B;  2XBI A;  5DQS A;  2F8F A;  3TKR A;  4BWS A;  5A5K A;  2MMN A;  1PQN A;  3WGD A;  3CSJ A;  2GT6 A;  2C3N A;  4GSS A;  3G7I A;  2QA1 A;  3IOS A;  4MJA A;  2HRA A;  3FK8 A;  4EDY A;  1SYX A;  1W89 A;  3FR9 A;  2YV9 A;  5ECI B;  2I4A A;  5HFG A;  4EC0 A;  4FYC A;  2I9H A;  3QFB C;  2YWN A;  3F4S A;  5B8B A;  2H76 A;  4ML1 A;  3DVX A;  2LTK A;  5ID2 B;  2C0D A;  1YQ1 A;  2X64 A;  2YWM A;  2JU5 A;  2A2P A;  5F05 A;  1PRX A;  4KND A;  2K6V A;  4CY6 A;  4YAP A;  4OD7 A;  4O5U A;  1VF1 A;  1TTZ A;  3GN3 A;  2IMI A;  2CX3 A;  2RLI A;  2GVP A;  1XOB A;  2X4A A;  3RPP A;  3C7M A;  3C8E A;  4OO5 A;  4V2N A;  4WKW A;  1X9M B;  5FT3 A;  2FWF A;  2P0G A;  1HYU A;  3G9B A;  1SKW B;  3TCO A;  3CSH A;  2VOC A;  1R5P A;  2VUP A;  1FG4 A;  3EWL A;  3PIN A;  3ED3 A;  2XBQ A;  5ECK B;  3M3M A;  3KM6 A;  2H70 A;  3IAM 2;  4IKH A;  3APS A;  2R37 A;  4K5R A;  2GSQ A;  3D0Z A;  4KCA A;  3WD6 A;  3KMN A;  2DLX A;  2NBS A;  3HJP A;  4AI6 A;  5KN2 A;  2G0F A;  5ECH B;  4YQM A;  1DUG A;  4OCF A;  2WFC A;  1Z3E A;  3GH6 A;  1YEX A;  2DIY A;  5ECN B;  2R6K A;  4NWY A;  4IQ1 A;  2V2G A;  4O7H A;  5H5Q A;  2B6M A;  1XW9 A;  2OJL A;  1ZOF A;  3TOU A;  4V2L A;  4K5S A;  1IYI A;  2R3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...