2JLEA

Novel indazole nnrtis created using molecular template hybridization based on crystallographic overlays
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
545
structure length
545
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel Indazole Non-Nucleoside Reverse Transcriptase Inhibitors Using Molecular Hybridization Based on Crystallographic Overlays.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE/RNASEH
total genus 139
structure length 545
sequence length 545
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2jleA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2jleA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2jleA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2jleA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2jleA05
3QNOA 3OYEA 4BE2A 2FLLA 1JLFA 3AVFA 3P5JA 3TWHA 2ZD1A 4NZ0A 1HQEB 1RT1A 3AA4A 4KB0A 2UVVA 5KFEA 3TAQA 4DS5A 5FDLB 1JLGA 4K4ZA 1TQLA 1IKXB 4GVMA 1TAUA 4CJEA 1BIUA 3LWMA 2IDOA 4KB7A 2XCAA 2KFNA 4CF8A 1DTQA 1LWFA 1U45A 1CZ9A 3MEEB 2RF2A 3BQ0A 5D3GB 1RTJB 4W5TA 2DTUA 1DTQB 4DL5A 3CO9A 3KIOA 4WFYA 2QK9A 2ILZA 5KFJA 5L1LA 2G8KA 4OLAA 3OYBA 1WNEA 5HBMA 3AV9A 4KHQA 4ECWA 2OPSA 1KVCA 1IKXA 3HK2A 1ASVA 4Z0UA 4OPJA 4IKAA 3UDLA 2RKIA 5KFYA 3LDSA 4G1QA 1JLFB 1NK0A 3PX0A 3DLGA 1RT7B 2XO7A 2R8IA 4E7JA 3KLHA 2FC0A 4DL6A 4E7HA 3MTKA 4FJGA 5DLGA 2UVRA 5EWGA 3Q8RB 4CGFA 4YR0A 1TK5A 4BE0A 2OPQA 2JEGA 4WE1A 5DMRA 1IKWB 2HNDA 3FDSA 4EBDA 4Z4FA 2OYQA 4IOBA 2IM2A 3TVKA 1VRUB 4R8UA 3WNFA 4WZQA 1TGOA 1RT7A 4IQXA 3CDEA 1I39A 3U3YA 4KKOB 1Z26A 4NLXA 3UIQA 5I42A 4ECQA 3HT3A 3QO9B 4U6PA 4GMJB 3VQ9A 4QAGA 2I5JA 3NFAA 2J6TA 3H2LA 2KW4A 2QKKA 2FJWA 1TKXB 3NGZA 4PA1A 4LH4A 5KG4A 5KFKA 1BHLA 1SKWA 3KJVA 2FVPA 4J9OA 1YTUA 3DLEA 3ULDA 3G0ZA 3V1QA 2VWJA 4N5SA 4OKKA 4AHSA 4Y2CA 1Q8IA 5J2QA 1SL2A 5F8MA 2O5DA 3NF9A 3EPGA 4E3SA 1C1BB 4FJ5A 2AGOA 2RN2A 4MQ3A 3QO9A 4I2PB 5KT5A 2BE2B 3TQ1A 3RB3A 3H4BA 3JSMA 5C24B 4ECSA 4N41A 4OGCA 1C1CB 1TKXA 2XI2A 1EX4A 3PV8A 3AA3A 3OYLA 3TAEA 3IRXA 4ED2A 3RB0A 3PW2A 4KKOA 3V9UA 4DSLA 4CGJA 3D5MA 4BDZA 2W9BB 2B4JA 1CXQA 2HNDB 3CFRA 5J2NB 3ZT3A 1Y97A 2G8VA 1UA0A 4LD0A 4OL8A 5CYQB 2VG6B 4NLRA 4KPYA 2V0NA 1QSYA 4DEZA 3HVWA 3CWJA 4JRQA 4O0IA 1WSIA 3SQ0A 3RB6A 4CERA 2X78A 5JS1A 2HNYA 3I5CA 2IS3A 2YV0X 1LWCA 2ZKUA 3KLFA 5DG8A 1RTIB 5DGBA 3OYKA 4O44B 3VQ8A 1HMVA 4CJRA 3PVXA 3AVJA 4CJ4A 3ICLA 3RAQA 3ISNC 1L3SA 1JLAB 3IS9A 3ZCMA 2PYJA 1LWEB 2HMIA 3LZIA 2J6UA 1RT2A 4DTXA 2V9WA 3DLGB 3BQ2A 3KMQA 1ZYQA 3G6XA 1D0EA 3CDUA 1TL3B 4FK0A 1ZTTA 4EBCA 1J5OB 4IRCA 4I2QA 3M8SA 2FVSA 3OLBA 1S6PB 1S9GA 4XIUA 1U4BA 3OYCA 1XHXA 1TKTB 3C6TA 3L2VA 4M3RA 4RW4B 3RMCA 1L5UA 3M8PB 4KBIA 3HVRA 3P83D 3SPYA 4NYZA 3QGGA 5L1KA 4CIEA 1NJWA 4QWAA 4B9UA 2ASLA 3SUQA 4MFBA 2F8TA 4JV2A 4TY8A 2D3UA 4CECA 3C94A 2Y1JA 4FJJA 2HB5A 2UVWA 1LWCB 4ELTA 4RW7A 4QWEA 1SKSA 4DTOA 2YKNB 4O3SA 4TY9A 4FK2A 2A1RA 3HHKA 1LAWA 2X6NA 1T03A 4CE9A 1RBTA 3IGNA 4K4VA 4KRFA 2X74A 4RW9B 4R0EA 5L9XA 3OJSA 1KSPA 5C5JA 2GIRA 3KK2A 3DDKA 4FJ8A 4R5PA 3KLGB 1RDDA 3AVAA 3VQCA 4CGHA 4K4WA 2BQ3A 3GIJA 1Q9YA 1NJZA 2R2RA 5K14B 4C8NA 2YKNA 1K1SA 3M8PA 3K2PA 2W9AA 4K4SA 3HVTB 2FLPA 5KGWA 4MFBB 3EZUA 1A5WA 3NAHA 4MH8A 1TVRA 4FBTA 4JUZA 4E1NA 1VK0A 2DFFA 5F8GA 5KG5A 2BRLA 4I9LA 1C0MA 2BQRA 4RW6A 4DQQA 4CJ5A 3MFIA 1GX5A 4FJKA 1UOCA 4QWBA 4K4XA 4YMEA 3MEEA 1D1UA 2GC8A 1T94A 1K6YA 3ASMA 1RTHA 1KLNA 4DFKA 4O3RA 3T19A 4B3OA 3KK3B 3K5MA 3H4DA 4J2EA 1S6QA 4KAZA 1XR5A 1A5VA 4B8AB 4NLWA 3DOLA 2HVIA 3KD5E 3GV7B 4CHOA 4TSXA 4Q5VA 3QEWA 4DTPA 3KLFB 3SV4A 4GC7A 2IM0A 1NK4A 3BR9A 3QIPA 1IKYA 3HP6A 4PUOA 4I7FB 4NLTA 4CF2A 1WLJA 2GV9A 5KFCA 4IBNA 1GOCA 1JLAA 1NK8A 4C8LA 4JV0A 2G8HA 4OPKA 2FJXA 4CJFA 4N56A 1SV5B 3QINA 3CFOA 2OZMA 3RR8A 4F50A 4CK1A 4ED0A 3OL9A 4URGA 2O4GA 1ZTWA 3MECB 5DGAA 3DRSA 4CJUA 4ZPAA 3NHGA 2UVUA 3TR8A 2O4IA 4XPCA 5C42A 5KFIA 3HYFA 5HRSA 3JSMB 2XCPA 5EWEA 1SUQB 4KFBB 4ED8A 1L3UA 5J2MA 5DQGA 2BR0A 5JXSA 3KLIB 3RB4A 4RNNA 3HXMA 3U3GA 5J2QB 1BCMA 3OJUA 1HYSA 3V6KA 1TP7A 4MIAA 3FFIB 4OKJA 4U7CA 4CEDA 1NOYA 4RW8B 3SCXA 4B9NA 3TANA 4RNFA 4AILC 2WHOA 5J1EA 4RW4A 3SYZA 1S1UA 3DM2B 1R0AA 4TLRA 4K50A 1RDBA 1HNVA 1EKEA 1LWFB 3IGVA 1T3NA 1VSEA 3GV5B 4FLUA 1RTDA 3NAIA 3K5OA 3KLIA 1JLQA 2F8EX 5J2MB 3K5NA 4ED6A 2WB4A 2OPRA 3G86A 1NKCA 3LP0A 4I2PA 1OS5A 1I3AA 4TQRA 3DLKA 4DL4A 2JLEA 3IG1A 3MEGB 4O5BA 1RA6A 1N56A 3NMAA 5CYMA 4LSLA 4ID5B 4ECUA 1S1UB 3DM2A 5KTQA 4CEFA 1HMVB 2R8JA 1SUQA 1G15A 1NJXA 1NNDA 5KT4A 3HO1A 2VA3A 3KJVB 3UPFA 1ASWA 3L2UA 1VRTA 4KHRA 3KKRA 3HPHA 3QETA 1IG9A 4LSNA 3DLRA 3N6LA 2AGPA 4KTWA 3VQ6A 3DMJA 4JS4A 3LPTA 1RA7A 3RBDA 1ZBHA 4RUAA 4ZVFA 3RWUA 4OVLA 3ZSYA 1RT5B 4IR1A 2OPQB 4AHTA 2WONB 5CYQA 4LSLB 4M3WA 2OH2A 1VSLA 3DI6A 4QWCA 5KG1A 2HHUA 4NCGB 4PUOB 1SH3A 4ZVHA 4NCBA 4RNOA 2HWIA 3I5BA 2E4LA 2JEFA 1S5JA 1FK9A 1VRTB 4B9SA 4CHZA 3Q8PB 5KFZA 3EPIA 1HARA 3V6JA 4Z4HA 4K4UA 4DQPA 5KFGA 4FBUA 4ZVGA 4O55A 4DS4A 2I1RA 4KSEB 4OLBA 1JLCB 5KG0A 3MXIA 3ZSXA 1ZBFA 4QW8A 4IFYA 4QOZB 3AA2A 3V9SA 3QIPB 1VSFA 4CEBA 1LW2A 3PHEA 4M41A 1CSJA 1KLMA 5L1IA 3QGIA 1JLEA 3ZSRA 3HJFA 3PW4A 3OYJA 5HBMB 3TAFA 4WFZA 1IKVA 3E01A 4Q8FA 4M42A 1JXEA 3KLEA 2ZE2A 2P5GA 1RTDB 2RPIA 2VWKA 1VSJA 3I0RB 3CFPA 1KTQA 1FKPB 4YR2A 3QEXA 4F2RA 3VQQA 4DSIA 5FROA 3TAMA 1S1VA 4RW9A 1EP4A 4CFDA 3ZSVA 1XI1A 5HP1A 1C2PA 1RBUA 1XWLA 4M94A 1RT4B 3NKYA 1J9AA 3LZJA 2YNHB 2YNIA 3HVAA 3VQEA 2BRKA 2P1JA 3KHGA 1HYSB 1T05A 1WSJA 2XHBA 1RDRA 2ILYA 3NBPA 3BQ1A 3CJ5A 3NF7A 4FJLA 3I0SA 3QZ7A 3V4IB 1QE1B 4H4OA 4Z4IA 2IC3B 4IDKB 4R8UB 3OL7A 3FSIA 4PQUB 4W5OA 1XR7A 3A2FA 4FS1A 4FM1A 4CHNA 4AH9A 3P1GA 4ZHRA 5C25A 5KT6A 4WE1B 4KHSA 3ZSWA 1S48A 4URQU 3PX6A 2FLNA 3CJ0A 3GQCA 4DSFA 5KFRA 4LY7A 1QTMA 2HWHA 1S0NA 2G8IA 1N4LA 1X9SA 1RT2B 5KGXA 1LAVA 2AGQA 3VQ7A 3BSNA 4FLZA 2PY5A 4HVJA 3PW0A 5CZ2A 5HRRA 4HTUA 4ZVEA 4KO0A 1SH2A 3EZ5A 3C6UB 3FQKA 2AX0A 3IS9B 4MIBA 2P51A 5KFAA 4TN2A 3ZSQA 5JS2A 2W9CA 4IDKA 1HPZB 2VG5B 4PWDB 3VQAA 1J5OA 1HQUA 1HQEA 1RT1B 4KHNA 4FJIA 4M3YA 4L8RB 2C2EA 1S1TA 1S0OA 3WNEA 3OYNA 3I5AA 2DPJA 3BGRA 3QESA 2EC0A 1JIHA 4CEEA 4CIGA 1SL1A 1NHVA 2YHAA 1ASUA 2ASDA 3KK1A 2IC3A 3HVTA 5HP1B 1QE1A 3CJ2A 1SL0A 3IRXB 3N6NA 5DQIA 3HL8A 5HLFB 3LPUA 2V4QA 4RUCA 4Q8EA 1S1XA 1TKDA 3LANA 3NBPB 4DL2A 4M45A 3RMBA 2WRMA 3S3NA 5C24A 1QHTA 2HNZB 1TK0A 4CFAA 4CF0A 4ECZA 1S9EB 1N6QB 2XGQA 3AVBA 1TV6B 1D5AA 3DYAB 1WAJA 3K57A 3G6VA 1S10A 1MU2B 4J2BA 1FKPA 2IBKA 2Z1IA 3ZT4A 3V9ZA 4ZTJA 1TL3A 2GIQA 2W7PA 2YNHA 1T8EA 3THVA 1KCFA 4CJ3A 1IKVB 3LAMA 1C1BA 5KT7A 4M3ZA 3K5LA 1S9GB 1S6PA 3PO5A 1REVA 4WYWA 1B9DA 1D9DA 4BACA 4E7IA 3DLEB 1LW2B 2E9RX 3OS1A 3H5XA 3G6YA 3DLBA 3CM5A 1C0UA 3RTVA 3AVMA 5HROB 4BE1A 3Q8QB 4E89A 4I2QB 1DTTA 1QQCA 5I3UA 3T5JA 5KFNA 4KI4A 1YVUA 3ISND 4EP4A 1VSIA 1QSSA 5SWMA 1KHWA 1SH0A 2B6AB 3M8QA 4NLOA 3H40A 1F21A 3T3FA 4NCGA 3PW5A 2R2TA 4DTJA 4IG0B 2ATLA 2IAJA 4DU1A 3NGYA 5KRTA 5FRNA 2VG7A 3ITHA 3KKSA 3KD1E 2R8HA 2CKWA 2FVCA 5KFBA 5F8LA 1HQUB 1RT5A 4F2SA 5KT2A 4Q0BB 3MF5A 2E6LA 1WSGA 3OLAA 2IGIA 1C1CA 3DLKB 1HNIB 3E51A 5T14A 2D0AA 5KFPA 3OL8A 3DI6B 4FLTA 3HP9A 3C6UA 4HHTA 1KRPA 1RYRA 1C0TB 1WSHA 2OPPA 2XGPA 1RTHB 3B6OA 1RTJA 3NE6A 1WN7A 1HPZA 4WFXA 1D8YA 2HHXA 1DTTB 3V1OA 2QXFA 1S6QB 2YNGB 4H4MB 2W9BA 4F4YA 4NLDA 3CG7A 4IH7A 5KRSA 1EXQA 2XY7A 2JEJA 4KO0B 3N6MA 2BE2A 2V4RA 4DSJA 3OL6A 2RF2B 3NL0A 4B8CA 4FS2A 1JLBA 3EYZA 3O3FA 1Q9XA 1FKOA 3L2WA 1TAQA 4DL7A 2EHGA 1RILA 3D45A 4CEQA 3BJYA 2IM3A 3MR2A 3VA0A 4IFVB 1JLGB 1NJYA 4B08A 2GBZA 3KOAA 1ZBUA 3BSCA 1RT3B 4DTNA 4ED3A 1JKHA 1S9EA 1N6QA 1TV6A 4OJRA 4IRDA 3VA3A 2IJFA 4FJNA 4F4ZA 4X2BA 4KI6A 1S97A 1S4FA 1QAIA 1KVBA 4H54A 1BQNA 1NKEA 3UR0A 3QIOA 4F8RA 2W42A 4RW7B 4FZZA 4Q0BA 2DY4A 1IKWA 2WCXA 4CK3A 2D7SA 3PX4A 3T5LA 2D0BA 1NK7A 4O0JA 2BANB 4KTZA 4CF1A 3TABA 2B6AA 2R2SA 3PO4A 4EO8A 2HAIA 3RR7A 3ZT2A 3NGIA 3DLHA 1KLMB 2XI3A 2NUBA 2XRIA 1D9FA 3PJXA 4DFJA 2Z1GA 3RMAA 2KFZA 2HHSA 1BIZA 4ECVA 3KLEB 4CGGA 2FJVA 2Q3SA 4IFYB 2XY6A 4CF9A 1HYZA 2HMIB 2FBVA 1FKOB 1BI4B 1NK9A 3VQ5A 2ALZA 4O3NA 3V6HA 4CESA 1S0MA 3H59A 1UA1A 2XC9A 2DPIA 4M95A 2YNGA 1DLOB 2JC1A 2UUWA 1LW0B 3SUPA 2QE5A 2WOMB 3UQSA 1NHUA 4TYAA 4B9LA 3PW7A 1NKBA 4R5PB 5KI6A 1QAJA 3B6PA 1U09A 1C0TA 3QEPA 4HUEA 2F96A 4RU9A 5JUMA 1GOAA 3D28A 4TXSA 4DWIA 3DMJB 4ECXA 3LP2B 3TI0A 3AVGA 2ITGA 2HHVA 3OYHA 3RRHA 4KTQA 3KNAA 1KFDA 3BREA 4Q45A 2BQUA 3H5SA 3HKWA 2XY5A 2E6MA 3V4IA 3QGHA 3F9KA 3V9XA 5KG7A 4J2DA 3OSPA 2FVQA 3S3MA 1UWBA 4DSKA 2HNYB 4LSNB 4NYFA 1S9FA 3SUOA 2JEIA 4BWMA 4MK8A 3O4QA 3BGRB 4XPEA 2LSNA 1MMLA 4NLUA 3I0SB 4C8OA 1NK5A 3GIMA 3I0RA 2B5JB 1WNSA 2E9ZA 4CJLA 4FXDA 4N47A 2KTQA 4CIFA 3WNHA 3NF8A 1RDAA 4OGEA 1C1AA 4LH5A 3K58A 3NGDA 3QLHA 3AO2A 4H4MA 4WXWA 2Z1HA 3V9WA 5KG6A 2OA8A 3KLVA 4KV8A 3CJ4A 5DK5A 4DF8A 3MEDB 1RNHA 4FM0A 3M9MB 1BISA 2ZE2B 3SZ2A 3JYTA 4J2AA 1TKZB 4AHUA 2R8GA 2R2UA 1S49A 3RBEA 1LV5A 4CFBA 4J9LA 3OHAA 1QUVA 5KT3A 3EY1A 1JL2A 3FQLA 1IH7A 1J53A 4YNQA 3SNNA 1RTIA 4KB1A 2HNZA 1GOBA 4Y34A 5J2PB 3F73A 3MXJA 1HNIA 2BANA 3OS0A 4HCCA 5DG9A 4F3OA 4CGDA 3AVKA 4MK9A 4DG1A 1ZETA 1ZBIA 3T5KA 3OS2A 5I42B 3BSOA 1CZBA 1FXXA 3CM6A 3PY8A 4H8KA 3LP3A 4W5NA 1TL1A 3MEGA 4ECYA 4CJKA 1VSKA 2IA6A 4CFCA 4FJXA 5CY4A 4AHRA 4F4XA 3OYMA 4IRKA 2W7OA 3NCIA 1WAFA 4B9TA 1S1VB 4PWDA 1U49A 1X1PA 4NLQA 4E19A 1W25A 5EWFA 1SKRA 2QV6A 4Y3CA 1HNVB 3SQ2A 4EBEA 1XR6A 3AVNA 3QZ8A 2B43A 3VQDA 3QLHB 5F9NA 2JC0A 4ZTFA 4CHQA 3LP0B 3VN5A 2YKMA 4EP5A 3KHHA 3HPOA 2G8WA 3L2QA 4Z4GA 4FLWA 4DLGA 1REVB 5F9LA 1EETB 1S1WA 3M9OB 2ATQA 1QSLA 4KHWA 3CDWA 4YFUA 4ZP9A 4FJ9A 3QEVA 1WSFA 3PJWA 2AX1A 2W8KA 4K8ZA 5KG2A 2X6SA 4FJHA 3DRPB 2YNFB 4J9NA 4HYKA 2XY8A 1BGXT 4EYIB 5DQHA 3D0PA 1JLQB 4YP3A 3LALA 3AO5A 3U6FA 3DRSB 1JX4A 5KFTA 5KFMA 3MECA 4FVMA 3ZT0A 2I5JB 2YKMB 4FZXC 3CJ3A 2D3ZA 4RW8A 1JL1A 4M3XA 1T03B 2AWZA 3SFGA 3QYYA 2ETJA 4F3TA 3SI6A 4IG3B 4IR9A 5EUHA 4CK2A 4DL3A 1BQMA 4UQGA 4GC6A 1RCHA 4ECTA 1SV5A 5KFFA 1U04A 2IOCA 1A5XA 2EX3A 4TY8B 4F4KA 1T05B 3SUNA 4Q43A 3OHBA 2JGUA 4Z4EA 3V6DB 5KFHA 1DLOA 5KFOA 5J2PA 3DOKB 3V81A 3KHLA 3TAMB 4ECRA 1JKHB 4IKFA 2UUTA 4E1MA 3TAPA 3NH2A 3VQPA 1N48A 3M8RA 3Q8SB 4KE5A 3ZSOA 2G8UA 1TK8A 3DOLB 2GUIA 1L3VA 4IH5A 4CHYA 3E01B 3LP2A 2C22A 4QCLA 3VQBA 5DG7A 1IKYB 1CXUA 1TKZA 4JV1A 3VQ4A 2C2DA 3AA5X 1Z4UA 2DFEA 1ITGA 4JLHA 1JLBB 4E7LA 5D3GA 2D41A 2R8KA 3I8DA 3CVKA 4DF4A 3BSAA 3OYDA 3NH0A 3HPGA 4W5QA 1CLQA 4EYHB 4ZHRB 4K4YA 1RYSA 3L8BA 3WNGA 4CGIA 4TQSA 2BGGA 2A1SA 4ZMMA 2FVRA 5KFUA 3KMSA 2Y1IA 2C28A 4AHCA 3S3OA 2IMWP 3SV3A 4MK7A 1YT3A 5FRMA 3V1RA 3H5UA 1FK9B 5KFQA 4ID1A 4NLPA 4Y1DA 4HCBA 4LQ9A 1BQNB 4ED7A 5KFXA 4NCAA 1VSMA 1O1WA 2D0CA 3KTQA 2R7YA 4DTSA 2CJQA 3GIKA 4J9SA 4I9QA 3OVNA 2D5RA 4TYBA 4DFPA 4DSEA 3V81B 2VA2A 2AJQA 3OYGA 1RBSA 3AO3A 3M9NB 4FLYA 4ED1A 5KG3A 2HVHA 1UWBB 1XC9A 4JRPA 1RT4A 4CJWA 2HW3A 1S1TB 5I3UB 3AVLA 3QEIA 3QERA 1RT3A 2RDIA 1ZBLA 3S9HA 1BL3A 3GV8B 3PUFA 4B9VA 4DFMA 2BDPA 2XWYA 4CEOA 4E0DA 1KFSA 2KZMA 4FW1A 4J9MA 4HUGA 4K4TA 2W9CB 1T7PA 2PZSA 1U47A 1TKTA 3C6TB 3OY9A 1RDCA 1U48A 3OSNA 3KK3A 3K59A 3LAKA 1EP4B 1LWEA 2KZZA 3OYIA 4ZP7A 3KHRA 4DTMA 3L2RA 4IFVA 3SFUA 5DLFA 3LP1B 4GW6A 1KVAA 3GILA 2YHBA 3SQ4A 4WYLA 3VQSA 3FRZA 4AHVA 1RBRA 1HRHA 4CJSA 1JLCA 4CJQA 4E7KA 2IM1A 3SI8A 4CJTA 3OYFA 4O3OA 3TAGA 3LWLA 4EZ9A 2HHQA 2OPPB 4FLXA 1BI4A 2FBYA 4KFBA 4J9QA 1Z25A 4ICLA 1X9WA 1BQMB 4Y2AA 1RBVA 4ZP8A 3CYMA 4FLVA 3PR5B 2KQ2A 4HKQA 4O3QA 4ZP6A 3GIIA 5KFLA 1UAXA 2F8SA 3SPZA 4DQSA 4KAIA 2VG6A 2RDJA 4NLYA 4DG1B 2QKBA 3KK1B 4ID5A 3CQ8A 4K8XA 4LQ3A 4FW2A 3ZSZA 5HROA 5F8JA 3KLHB 4O3PA 2G8FA 1TL1B 5F8HA 3CIZA 4YQWA 4O4GB 2YNFA 4RNMA 1N5YA 1GX6A 4Q44A 2YNIB 2WONA 2W8LA 4JS5A 3RAXA 5KFVA 4DU4A 4CCHA 4EZ6A 3ZT1A 5CYMB 5J2NA 1EETA 4BDYA 3GYNA 5EDWA 2C2RA 4FJ7A 1R0AB 4QWDA 3H08A 3M8QB 1RT6B 5CZ1A 4B3OB 1YTAA 4ZPCA 1WSEA 3AVIA 3NAEA 4RG8A 1JXLA 1XHZA 3DRPA 4CJPA 1RT6A 4ICLB 1K1QA 4HUFA 3FFIA 2OPRB 1JLEB 4DQRA 1IM4A 3PR4A 4FK4A 5EU7A 3HM9A 4RW6B 1S1WB 3T1AA 5J1EB 3IG1B 3C95A 3AO1A 4FM2A 3HSTB 3MR6A 4O4RA 4NLSA 2HHWA 3JYTB 3H5YA 3MXMA 4N76A 5C42B 1C6VA 4OKEA 1VRUA 1QS4A 2ZD1B 1KHVA 4QPXA 4RNHA 5E41A 5HLFA 2E9TA 3AVHA 1HYVA 2Z1JA 4DU3A 3H98A 4MKAA 3O4NA 4KHMA 5C25B 4EEYA 5F8NA 4O44A 4J9KA 3DRRA 3T5HA 4CEAA 4RZRA 4CHPA 4FYDA 1IO2A 2HHTA 2J6SA 4M3UA 2P5OA 4ELUA 4FCYA 5KFSA 5F8IA 5HRPA 2B5JA 4DLEA 3SQ1A 4KHYA 3DYAA 4PY5A 4G1QB 2WK4A 4FJMA 3L3UA 4CEZA 1NOZA 1N5YB 2VG7B 3ITHB 4O4GA 2IAJB 3ALYA 2OPSB 3NF6A 4W5RA 3NDKA 5HRNA 3MR3A 1W9HA 4IH6A 1YVFA 3IAYA 3O3GA 3NH1A 4I7FA 2RKIB 2ASJA 4MKBA 2AQ4A 4DTRA 1X9MA 2OZSA 4IG0A 3O3HA 3BDPA 2FBTA 4NRTA 4YR3A 1HJRA 2VG5A 2FBXA 1RAJA 4Z4CA 2WTFA 4URSA 3QIDA 4ELVA 1VSDA 1VSHA 4NLVA 2PYLA 4M3TA 2AU0A 3LP1A 4KREA 4EO6A 3G10A 4B9MA 1L3TA 5KFWA 1B9FA 3AVCA 1JXBA 3MEDA 4F4WA 4BDPA 2IJNA 5SZTA 1C0UB 1NK6A 2DFHA 3QNNA 1TVRB 4NRUA 3DOKA 4NLGA 4G3IA 1BCOA 3TARA 4DTUA 5T7BA 3L3VA 1J54A 4J9PA 3PZPA 4J9RA 5FDLA 4KV8B 5KFDA 3MFHA 2ZQBA 4ZPDA 3IN5A 4C8MA 3MR5A 4Y1CA 4DQIA 4C8KA 3V6DA 4QW9A 1W0HA 4IG3A 1B92A 4BWJA 4CJVA 4PQUA 1MU2A 4KHUA 4FZYA 1S1XB 4WZMA 3OYAA 3DRRB 3SJJA 3KLGA 3KK2B 1I6JA 3AO4A 4WXOA 4ZPBA 3RMDA 5K14A 4DMNA 2WOMA 4XO0A 3MAQA 1LW0A 4NYNA 3RRGA 5L1JA 4H4OB
chains in the Genus database with same CATH superfamily
4JI6K 4WCEL 1SC1B 2MQ8A 2ZGZA 3KUGA 3AVFA 1FWPA 3TWHA 2ZD1A 4NZ0A 5B8HA 1RT1A 3AA4A 1JJ2R 1YLXA 4OYIA 4LF1A 1IBMK 3VEOA 2XMAA 1GXUA 5A8WA 4CJEA 4DV4K 3LWMA 1GLLO 1Q0NA 2B3TB 2XCAA 4DR7F 3OT9A 2DXDA 2KFNA 1LWFA 1CZ9A 3MEEB 2RF2A 2HKEA 1T9WA 2FDNA 1SC3B 3KIOA 4R79A 2ILZA 4IOAQ 2G8KA 4M7XA 5TKWA 2XMWA 3HFKA 4KHQA 1Q16B 2EVZA 1WF1A 1V3SA 5DJBA 3CJ9A 3W9IA 4OPJA 1BD6A 1NG9A 2KRBA 3UDLA 2R4FA 3Q8UA 1M1HA 3R1XA 3TA1A 1VC6A 1YJRA 5MAOA 4MDAA 5LMNJ 4OI3A 3T1YF 5DLGA 4BC4A 3Q8RB 1HJOA 1ZZFA 3KK7A 4WE1A 5TKYA 2QWOA 1SS6A 2IM2A 3PJ9A 4ED5A 3TVKA 3WNFA 4RCHA 1TGOA 2C3MA 4X64K 3JQJA 2QFJA 4KKOB 3HT3A 1FRXA 3UVJB 3TRGA 4C7QA 2ZBCA 4A8OA 5LOQA 2I5JA 2CJKA 3H2LA 2FJWA 4LH4A 2K7JA 5KFKA 3FMWA 1VQYA 2FVPA 4ZPVR 1YTUA 2XTJP 4JI2F 2YQ3A 4P72A 1YQHA 3R6LB 5DETA 3ULDA 2VWJA 4XH5A 4AHSA 4Y2CA 2A42A 2XLKA 1AA1B 3NF9A 4FJ5A 2AGOA 1V5VA 3ZX3A 2DGUA 1AYEA 5KT5A 3VF2A 1U2VB 1RAGB 2LXUA 4ECSA 3UO0A 2FHJA 4DN9A 3PV8A 3VF0B 3NEKA 4ZCLA 3NGRA 3OYLA 4H0YB 3LGNA 1GMWA 4ED2A 4B3SK 4FN5A 3RB0A 3PW2A 1MWZA 3CJ8A 4CGJA 4ANDA 2ZNZA 5EHHA 1FJGK 3MCAB 2LXFA 1WOPA 1CXQA 2BMBA 2EFQA 2ZZTA 3MN6A 1BXNA 3AB2B 2CNNB 4IXCA 1QSYA 2OTJS 3HVWA 4CZJA 1U1OA 4OV1A 2UUBJ 2RIJA 1DQ8A 2H5EA 1DBDA 3RB6A 3MURP 5JS1A 2MZRA 3CJKB 2ZKUA 3MM8A 1RKJA 1WI6A 5IM0A 1E4GT 2B4PA 4WBFA 4F67A 4I67A 4NXMK 3PVXA 3ICLA 5JMNA 4LF4J 5D4PA 2ERRA 3M2VB 3T6JA 2BJ1A 2DNHA 1L3SA 4YS2A 3R5AA 1JLAB 3ZCMA 1DJ0A 1LWEB 3TA2A 3DRYA 4WFAL 1RT2A 3DLGB 4YEAA 1ZYQA 1Q86O 3HZEA 1TL3B 4X4UA 4FK0A 4EBCA 4N8NA 1YWXA 4I2QA 2CZ9A 1S6PB 4XIUA 2M5YA 3OYCA 3L2VA 4RW4B 3A8JA 1DKGD 2EW9A 3BN4A 3UR3C 4NYZA 4YDUC 4CIEA 2DH7A 1S79A 3SUQA 2GZOA 3HF5A 4XDCA 4KGVB 1P1LA 2C1EB 2LQ5A 4IO9Q 2D3UA 2MSSA 3FEXB 4P2MA 2UXCF 2FJEB 1HW8A 3MM8B 2KHCA 3DLJA 3CJBA 1LWCB 3A13A 2N3OA 2JWKA 1VQNN 2YKNB 4O3SA 4FK2A 1LAWA 2X6NA 1T03A 3MUVP 4CE9A 4NL5A 1RBTA 1UW9A 2I0XA 2Q2RA 4R0EA 5C5JA 2GIRA 3KK2A 3KLGB 3BKUA 3AVAA 2FC8A 4K4WA 4JP8A 3VAHA 3T69A 3VGMA 2UV8A 2R2RA 2POKA 3BBCA 2X1FA 1HWKA 3WBZA 1SJFA 4IOCL 3M8PA 1U02A 3L09A 3K2PA 5JVHQ 3HVTB 5KGWA 2YPYA 3CC4N 2YWGA 3E3XA 5CZXA 4LUBA 4MFBB 3C6AA 4MH8A 1TVRA 4FBTA 4X4PA 1QM9A 1R0CB 4E1NA 4NE9C 5HMWA 3M30B 2E1YA 5E5NA 5KG5A 4KBOA 3OV7A 2BQRA 4DQQA 1TYQA 4OI1A 5LJ5Y 1JJ2M 4K4XA 3TSQA 2GC8A 4DUYJ 1IR2A 3T19A 2ZH8A 1MN9A 3WX4A 1V9OA 2BACA 5EVZA 3NMUA 3KD5E 4TSXA 4UTGA 4A48A 1ATSA 3B82A 3QEWA 3LDLA 3KLFB 1ROFA 4BRAA 2DNNA 1QQOA 3HP6A 4PUOA 3TVZA 4NLTA 4ED4A 4CF2A 1UPPA 2HFVA 4LF8K 3IO1A 3E2EA 1NSAA 2CGJA 3CFOA 3R6GB 2PAVA 4FP9A 5AXLA 1VHIA 3MECB 4YOWA 4CJUA 4ENOA 3BB5A 3ZZUA 1TL7A 5C42A 3JSMB 2DNZA 2YKQA 1H1VA 1FJCA 1SUQB 4YY3J 4IUFA 1IBCB 1L3UA 3QFWA 5AFUH 2M88A 3HM8A 2MPUA 3D6TB 2BUPA 3FE1A 3ET6B 3T1HK 3HXMA 3GBTA 2P6SA 3PLAA 1HYSA 2WC9A 1H73A 1EKRA 3BPSP 4BR0A 3TANA 4RNFA 4DV1J 1WHWA 3GL1A 4LF5K 4TLRA 4O8KA 2AYMA 2RSQA 1JLQA 1PSDA 5K8NA 4ED6A 2OPRA 3G86A 3U27A 4JN4A 3W2WA 4I2PA 2KFYA 2DIVA 4DL4A 2E1ZA 2HMPA 2Z2YB 1HNXF 3CCQN 4H0XB 4ID5B 2A1BA 4UY8O 4ECUA 5KTQA 3WQPA 1HMVB 3PRVA 1JJHA 2OFGX 4MYTA 3HO1A 1KC8O 1ASWA 3KKRA 3O4WA 4LSNA 1W26A 3DMJA 5IWAK 3LPTA 4LMZA 5GADU 2QO3A 4RUAA 1RT5B 1WB9A 1KDNA 2OMLA 4IR1A 4AHTA 1OH7A 3B78A 2G2YA 2WONB 4PWUA 2BJDA 4RUBA 2V68A 4QWCA 3ILJA 5LL6d 1WOQA 1IBLF 5BYRA 3OR2A 3G8TA 4ZVHA 4B3TF 4RNOA 5K8PA 1S5JA 4LFCK 4XK8C 2RNEA 1ELOA 3W63A 3Q8PB 4IJAA 1HARA 3MI7X 4K4UA 2NPIA 2VB6A 5KFGA 4ZVGA 3G6ES 4LR8A 4OLBA 2ZNYA 2CJAA 5KG0A 3CUNA 3WXJA 1WOOA 4QOZB 3NNCA 3AA2A 5LJWA 3QIPB 1DAXA 4DV2F 1P9QC 3S8SA 3GCWP 4Q2MA 2XLIA 1D3WA 1GXLA 1CSJA 2V2ZA 4NEYA 3QGIA 1JLEA 3PW4A 3OYJA 4WFZA 1IKVA 3E01A 2V6AA 1JXEA 3KLEA 1EQYA 1X4AA 2X1BA 1Z2LA 2IBOA 5KAKA 2VWKA 3I0RB 3CFPA 1KTQA 2VFSA 4F2RA 3TAMA 1VK8A 1S1VA 2MHNA 4CFDA 1OVYA 4UF4A 1C2PA 1XERA 4M94A 1RT4B 3MCSA 3LZJA 3QJPA 4KRWA 1NSKL 3EO3A 3N9UC 2XHBA 3BQ1A 2FYXA 4R25A 3U1LA 3G4SN 4FJLA 3I0SA 3WC0A 2M9KA 3MPDA 2PFDA 4JYAJ 1QE1B 5H1SV 2X51A 4IDKB 1IWGA 4W5OA 3RRKA 4FS1A 4LF4K 2VKZG 3F56A 3P1GA 4ZHRA 2DNGA 1C0GA 5KT6A 3PFOA 4CLPA 1EQ0A 5AZJB 3PX6A 4P7VA 4DSFA 2VQFF 2ZC3A 4CBWA 2K1RB 4LY7A 4KYZA 2HWHA 4ES2A 1RT2B 3VQ7A 2GVDB 3BSNA 1NO8A 1N34F 3LGHA 2YPZA 4DR4J 1KWMA 3PW0A 4M63C 4BRLA 1RBAA 1HIYA 2HEKA 3PXGa 2BXJA 1FE0A 2AX0A 2G0IA 2GA7A 5CZVA 1CC8A 3FBFA 3AJDA 2RJZA 1GEHA 2CQCA 3V2UC 3VTIA 3MOZA 4PKDB 3FLCO 1HQEA 1M1GA 1HNXJ 1OMSA 3Q2TC 1Q78A 4L8RB 2VBZA 2C2EA 1S1TA 1S0OA 2ALYB 2M3DA 2V94A 2DPJA 3QESA 4YB7A 1K8AT 4CEEA 5IOLA 1SL1A 2YHAA 3VZIA 3J81U 3GG1A 1XNRF 4RR5A 5HP1B 2ITMA 2QX0A 1CEZA 5DQIA 3HL8A 3LPUA 4RUCA 2OO4A 3ZLJA 3UNYA 3VAKA 3S3NA 2E66A 2HNZB 1TK0A 1RUSA 2HLTA 1BG3A 1N6QB 1AB8A 1XNQF 3SCKE 2MZ1A 2QTDA 2Z1IA 4XH1A 2IRUA 3VMFB 1TL3A 2YNHA 4UUWA 3O6WA 3PG9A 1TMJA 4O8UA 1C1BA 1F1BB 2QYCA 4DUYK 1XJWB 4M3ZA 5THWA 2C3UA 2UUAK 1REVA 3IWNC 1B9DA 3HHNB 4F9OA 2JZ5A 4K0KF 1VI7A 1YRTA 3UDCA 5F1XA 2G13A 4I2QB 1R8CA 3SBTA 4DUTA 4LFAK 4FF1A 5D0RA 2OLWA 3ISND 1YVUA 3E8OA 5SWMA 2QC3A 1SH0A 3A5MC 3KWGA 3PYFA 3MN5A 4JI0J 2R2TA 1U26A 3OTEA 4DU1A 3NGYA 2Q6CA 2F9DA 3KKSA 2DGOA 2P6TA 5GAEI 1HQUB 3W3DA 5KT2A 3MF5A 2E6LA 2AEFA 2P9CA 2IGIA 2NR0A 3DLKB 5T14A 3EXYA 5KFPA 4B3RF 4ILLA 3EKUA 1KRPA 1RYRA 4ISGA 1WSHA 2HHPA 4PL7A 1HR0J 1HPZA 3VGLA 3CPWM 1DTTB 1MG7A 4H4MB 2HFZA 3N4QA 2FY1A 1EWRA 3F0NA 5A2QU 2ZJRQ 2P9KA 4KO0B 4Y00A 3N6MA 1BQXA 2V4RA 4CQ1A 2DR8A 2R7SA 1JLBA 3O3FA 2V51B 4OZ1A 1RP5A 2CJXB 4I6AA 1YTYA 4P75A 2QW9A 3SDEB 4EMDA 3L2WA 2HFOA 1TAQA 1WDTA 3BJYA 5BRHA 1Q95G 3W8PA 1JLGB 1LXNA 1NJYA 3MMVA 4ZJOA 1DFDA 2HS3A 3O6QA 4ZVTB 4DTNA 1JKHA 1G99A 4OX9K 1N0VC 5L46A 1X4EA 4L6V3 5B0FA 3L6QA 4F4ZA 2CFXA 3AJ2A 2NQPA 1S97A 4H54A 2WBMA 2HBQB 4EIAA 4IOCQ 5ADXH 3IC1A 1AFJA 4RW7B 3HSDA 2WCXA 2HS0A 1RU1A 2D7SA 2F7TA 1KD1O 3G2XA 5EXWA 2MJNA 4O0JA 4FWNA 2LFVA 2HLUA 2ATCB 2FSNA 1HBUB 3MMCB 4UW2A 3CCUS 3NGIA 3SK3A 2XRIA 1D9FA 4M5LA 2HSEB 2Z1GA 3MMAA 2HHSA 2NCKL 3JTPA 1NDPA 3W9JA 3A1YG 3UD3P 1YIJS 3N4WA 2I38A 1HYZA 2R42A 1FKOB 4JKBA 1BI4B 1RDWX 9ATCB 1S99A 2ALZA 1SCJB 4N8OA 3WXLA 1WOSA 1S0MA 9RUBA 3CJ1A 2ASYA 1KQKA 2VH7A 4M95A 3CXCM 2YNGA 3CCES 3UQSA 2V5HG 4DR2F 1Q5YA 1NKBA 1YJWS 1C0TA 1K8AO 2ABYA 4DX7A 1QHAA 4FPRA 3D28A 2YJEA 1URRA 4DWIA 3MAAB 1A7GE 3TI0A 1HHSA 2O8FA 1PCAA 1F9FA 2ITGA 2X7IA 2HHVA 3KNAA 1HI0P 3H5SA 3HKWA 1NH7A 2E6MA 2DBBA 4JI3J 3AQOA 3V9XA 3HD2A 4J2DA 1N36J 2FVQA 2QRRA 3CCVN 1MA9B 4K7QA 2RQ4A 1GMWD 4U8YA 4GNIA 2VQFK 2LSNA 1MMNA 3O9TA 3I0SB 5M1PA 3THYB 3I0RA 4KY3A 2E9ZA 1NMDA 3RBXA 3WDOA 4OIXA 4DU7A 3WNHA 1Y10A 2UU9K 4QYZK 1C1AA 3TEGA 3TZZA 2CPHA 1CVJA 4U8VA 3FRYA 1GMUA 2E1MC 1G3OA 3CJ4A 3MPVA 5DK5A 3I96A 3MEDB 4GVLA 3A5OC 2VONA 2ZUGA 3OFHA 3L4BC 3JYTA 2MKYA 4YHHJ 1H6KX 2QWMA 3LDPA 2LP4A 2R2UA 1S49A 4ER8A 4OI0A 4RX6A 4X4SA 2BKPA 3FQLA 1KD1T 1RLCL 1J53A 2E29A 2QFIA 1R31A 4L3NA 3CCEN 3QRQA 4JI6F 3I87A 2A5XA 3CT9A 3T9NA 3ZZ0A 3GMGA 3MDQA 2KM8C 1X7VA 2M52A 4HCCA 3I55N 4ILMA 4MK9A 4DG1A 2CUYA 1F0XA 4FKYA 2JFDA 1LOTB 1F2HA 1KQFB 1WF2A 2DYAA 3ILLA 4JI6J 3J7ZT 2QMXA 3MEGA 4CJKA 3R1HA 3SAFA 2HBMA 4CFCA 4MTPA 4AHRA 4F4XA 3R3TA 4B3MK 2QL5B 4QU6A 1NPPA 3SEOA 1W25A 4PKIA 3SQ2A 2HFUA 3ZXWA 3TX8A 2VPZB 3AVNA 3QLHB 2L41A 1PBUA 2GWKA 1T9UA 4YOEA 1ZM9A 2E5LJ 2DR9A 4LSZB 4FLWA 5F9LA 2GEMA 1S1WA 1QSLA 4QS9A 4KHWA 4HT5A 3P3DA 3HOTA 1VJWA 2AYEA 3DRPB 2P9IA 3HDSA 4P9SA 1BGXT 5DQHA 4UOCA 1VR6A 4EWTA 3MECA 2DR7A 3QGPA 4PG7A 2BBEA 5F41A 4FZXC 3FCHA 3CJ3A 2D3ZA 5IC4B 4M3XA 1T03B 3QYYA 2ETJA 4F3TA 2DRAA 2F5GA 4E8UA 5LM7E 1IQTA 4LFCF 3ZZRA 3WZ0A 4CK2A 3A3PB 1BQMA 4UQGA 4KT0C 2RAQA 3RU0A 1RCHA 3R9LA 4ECTA 5KFFA 1U04A 2Z58B 3SAHA 2EX3A 5D78A 4Z4EA 4B1UB 5DZ6A 1NNEA 2QG9B 1DLOA 3DC2A 3MCMA 3SCIE 3KHLA 3TAMB 4DMZA 1VBXA 4E1MA 2HF4A 1J2VA 1N48A 3VWSA 1WF0A 4F3QA 2G8UA 1TK8A 1N33J 2GUIA 3VEWA 1L3VA 4IJNA 3LP2A 2C22A 3CD0A 3BS9A 5FD1A 3A8YA 2QN6B 3HMJG 3VQ4A 3PEHA 1GNKA 1Z4UA 3L95X 3FCVA 2DNPA 1CS4B 3CVKA 4U95A 4DF4A 3BSAA 3NH0A 3HPGA 1F5AA 2OGUA 5IV4A 5AJ3J 3CJKA 3WNGA 4CGIA 2Y0BB 3TTCA 3PSFA 3KMSA 5GAHI 4AHCA 3SJHA 3S3OA 5DO2A 4KH4A 4OYPA 4MK7A 1FJGJ 1X31C 3RSEA 2ZH3A 1FK9B 2OJ3A 1FRMA 3TZYA 1VQMN 2RMLA 3FZHA 5T41A 2CPYA 4ED7A 4BG8A 1WEYA 5KFXA 1U1RA 2KG0A 3KTQA 1O1WA 5E84A 2VBWA 2CJQA 4QR2A 1NGCA 3GIKA 4J9SA 2GGPA 4HI1A 2D5RA 3UE2A 4OJHA 5EGYA 2VA2A 2AJQA 2JHEA 3I6PA 4NXNF 4QU7A 3AXKA 3FBBA 2IVPA 1TUYA 1EARA 1JJ4A 1XC9A 3J7ZO 3P4UB 2DIUA 5I3UB 3AVLA 3FBCA 4BVOA 2C2OB 2RE1A 5E3AA 2RDIA 3ENOA 3PUFA 5I4MA 3ZZTA 4E0DA 2BKOA 3NNHA 2KZMA 4FW1A 3GZ7A 2KKZA 1J5EK 4Y0FA 2UUBF 4DZ6A 1U48A 3KK3A 3K59A 3LAKA 1EP4B 3MMBB 1Q82T 2V8PA 1YDLA 3MM5A 2CQ0A 1UAWA 2ADCA 2OEKA 3CULA 3OYIA 3PYDA 4RWTA 2VPXB 3KHRA 1RQ0A 4O0NA 3L2RA 1X5TA 3H20A 2YHBA 4WJBA 2NXJA 1RBRA 4EHUA 2ZJQL 1CS4A 4CJQA 2RUSA 4V19X 5AQRA 1HWIA 1X4HA 4FLXA 1VQKS 4IFEA 1UEUA 3F44A 1X9WA 4ICLA 4DR7J 1BQMB 4A5BA 2DHHA 1NHKL 3M6VA 5GVQA 4FLVA 4YDDB 2KQ2A 1HBNA 3MR7A 4ZP6A 2ZJPQ 5JVHL 2QA4N 5CD4A 3Q86A 3RW6A 2RDJA 3DLLL 2AF6A 2QKBA 1YJ9N 4CLSA 2DCLA 3NGKA 2Q97A 3ZSZA 4ZVQB 3IWLA 5M1QA 4JI1F 4O3PA 4LRAA 4UT4A 3QB0A 2YNFA 1RTZA 2UUBK 3NVKA 2QLBB 5JMVA 3J81j 4AL6A 3OVSA 1VQ8N 1Q8KA 2EBEA 3NXZA 2Y0SD 4ZN1A 3E9OA 2IIHA 5EDWA 4MJKA 2F4VJ 1RWKB 2YX4A 4B3OB 4I64A 2DNLA 3M32A 1YTAA 3VENA 3NAEA 2RHSB 3DRPA 3Q89A 1K1QA 4HUFA 3FFIA 2HHHJ 5KQDA 3BBBA 1JLEB 1NLVA 4CH7A 1IM4A 4FK4A 5A6WA 1XQIA 1JQGA 1WC6A 3K8WA 5J1EB 3C95A 2ZBQA 4A57A 3AO1A 4BRNA 4IDHA 5HI7A 1N52B 4WF9Q 1T9TA 4A47A 1BA0A 5JJBA 1P27B 1RXOB 1I94F 4BR7A 1C6VA 4OKEA 1NRKA 2HS4A 4DCJB 5HSPA 3CCLS 1V6HA 2JFKA 3AVHA 1HYVA 3O4NA 2YHXA 4O44A 5EX0A 1XMBA 3QMQA 3B8HA 2DRDA 4CEAA 2VGNA 1IJEB 2HHTA 3PRBA 2J6SA 2VHGA 2GX8A 1GLCG 1VC5A 4F3MA 1REGX 2K06A 5BPLA 3D66A 3TUZC 4G1QB 2WK4A 3D1QA 3JS6A 1DQAA 3MM9B 1F9EB 1QUPA 2O8DA 1N5YB 2VG7B 3QSIA 4BHQA 1AUDA 2V69A 2CIMA 3NDKA 3NF6A 2W2QP 3MR3A 4IH6A 2QLXA 2DXFA 3O3GA 4BC3A 2P9GA 4I7FA 1IG8A 4LJMA 1DARA 4DTRA 1X9MA 2U1AA 2KXFA 2OEJA 2VG5A 1HJRA 2OD6A 2WTFA 2PYLA 2L08A 2AU0A 1HHTP 4P2XA 2VPYB 2LECA 5KFWA 2G2ZA 4HACB 1JXBA 3MEDA 2RS2A 2IJNA 2V8DA 5SZTA 3HI9A 3MAHA 5F0XA 3HHEA 2QWNA 4NLGA 1P8ZA 2IPOB 4DTUA 1WD6A 3L3VA 1B0VA 4M5GA 1F5BA 1PILA 1R6YA 2F40A 4W4MA 1EIYB 1Q53A 3MFHA 1YGYA 4WCEQ 4ZPDA 1KVKA 4TU7A 4DV6K 2VV5A 1TUGB 4JK7A 1APSA 3WIVA 2XYPB 3NS7B 3VETA 1TL5A 2BUNA 4IEEA 2UYTA 1W0HA 2JSXA 2KT2A 4BWJA 2OELA 2IVMA 3ZX0A 1FA0A 3DRRB 5L39A 4LF9F 4ZVSB 3KLGA 3KK2B 2BYCA 1NM2A 2QMUB 2DITA 2F4FA 3AO4A 2GO8A 4WXOA 5K14A 4WTYA 4JK8A 1HNZJ 4KHPK 2W4PA 4QOTA 1WHXA 4HWIA 3OYEA 2DHAA 1NWKA 3KNGA 3RBZA 2FLLA 2XHCA 3S1TA 3G25A 4WF9L 1SQKA 1LCUA 3UI3A 2PEHA 2DB1A 2LA4A 3IP0A 2VGMA 2UVVA 5KFEA 3TAQA 4U96A 3JB9k 2N7YA 4BC9A 1Q82O 3K2YA 1W2IA 3H25A 4WU2A 1UEVA 2OP5A 2VUGA 2IDOA 4AYBD 2NRRA 2YQ0A 1M5HA 2FF3B 4NASA 1DTQA 2XSFA 4FYYB 5ETOA 2J8AA 5D3GB 1UZHA 1RTJB 2DTUA 2E5LK 3CO9A 5C2DA 2OTLS 3J7A1 1I5OB 3POTA 4WTOB 1VQ5N 3AV9A 2HHHF 2NUHA 5HO4A 4ECWA 3CHWA 5AFUA 2GQ2A 5A0YA 1ASVA 4NB4A 4Z0UA 4ALZA 2E20A 7AT1B 4IKAA 1FEHA 5KOXA 2RKIA 1YJNS 4G1QA 1JLFB 1NK0A 4LBHA 4LR7A 1RT7B 2WVDA 2CDQA 4DL6A 3MTKA 2VFRA 4FJGA 2QLFB 4O5FA 4G6VB 4FYVB 3FC9A 5CCMA 3OTOJ 5DMRA 5AQWA 2HNDA 1VK3A 4R8UA 4WZQA 1RT7A 4IQXA 2BM0A 3CDEA 2WAQD 3U3YA 3PM9A 2XYGB 4C8YA 3H3OB 4ECQA 3QO9B 4GMJB 1HBMB 2J6TA 3BO4A 5M1FA 2MZJA 1U6BA 3MD1A 3NGZA 1SKWA 4ETZA 4J9OA 3DLEA 1WKJA 4NX9A 1FE4A 2R7UA 4OKKA 3UN3A 1KR4A 1J5EJ 1Q8IA 1SL2A 4P73A 3VGTA 2BJ7A 3EPGA 2AJ0A 2RN2A 4KH0B 2VQEJ 3WIUA 4I2PB 4D3HA 2Z30B 4UY85 3JSMA 2MLZA 3FEYB 3NGUA 3UKUA 5C24B 3ZTPA 4N41A 2HQDA 2WUSA 3FJ2A 2FJAB 4EHTA 1FJGF 5JICA 5H1SQ 3V9UA 4KKOA 4X64F 1OPIA 2V9KA 3GOIA 4OZLA 4HLBA 1MWQA 4OZ2A 1DEJA 3KWIA 2E5LF 2HNDB 1K8KA 3B4MA 3ZT3A 1RDUA 2VG6B 4USJC 4KPYA 1K0VA 4C4WA 4JI1J 2NSBA 5G0RA 2VASA 3CJTA 4C1NK 4O0IA 1EWQA 1FXRA 5M1OA 1VLYA 3BGFA 3KLFA 3G9CA 3SSSA 5DG8A 3TJ9A 3OYKA 3VQ8A 1Y0HA 2F1FA 5A2QY 4CJ4A 1WSRA 3IS9A 3NMRA 5ETKA 3MMBA 2J6UA 1BMQB 2HPUA 3C14B 4CLKA 4DTXA 3BQ2A 1F9HA 1PAUB 2Z2LA 4JBCA 4HHJA 4BQZA 1VLOA 4WPAA 2DNYA 2H9ZA 1W2BR 2Y8YA 1UL3A 1XHXA 2KH9A 1TKTB 3C6TA 2EBGA 1L5UA 4M3RA 3HVRA 4JI7F 3P83D 1SIWB 1ZZNA 1HKBA 1UFKA 3QGGA 1RCXB 1LK7A 3J7Z5 5L1KA 3MM6A 1U2FA 1P9YA 2NZ4A 1MROA 3DXMA 2BTFA 4LBPA 2YVSA 1U25A 3C94A 3I56N 3W1YC 2ROEA 3UVJA 3J7YU 1UVIA 4A46A 4ILHA 2P9NA 4DTOA 2PMWA 3CCVS 3HHKA 1JCGA 2OUGA 1X4DA 3IGNA 4K4VA 1SBRA 3NP5A 3FVYA 2AKWB 2Z57B 4C98A 3MMCA 3OJSA 1KSPA 1GTHA 4R5PA 1RDDA 4GO5X 2RILA 4QS8A 4CGHA 3A8KA 5AXNA 1X4CA 3GIJA 1E6YA 4G1PA 3KUEA 3OHRA 1NJZA 3SAGA 3Q0AA 1F2GA 1VQ7S 1M1KO 2FLOA 1PKUA 2W9AA 4H5RA 1FRIA 3I82A 4Y2IA 3N01A 2FLPA 3H45C 3TU5A 2I7NA 1RADB 5H9FK 3EZUA 3NAHA 3HJVA 5F8GA 3DLLQ 3LGMA 2BRLA 2XQCA 3MFIA 1FWKA 3VHQA 4FJKA 1UOCA 2ASMA 3MEEA 2E5JA 2CDRB 1RTHA 2KDOA 2KB2A 4O3RA 3PDNA 2A6OA 3GTYX 1NZ8A 2OIHA 3D1OA 4B3OA 4YDXA 3DGVA 4MMOA 3K5MA 2D3OR 3LDOA 4J2EA 1NJIT 3DXKA 5AQKA 1E6VA 4CHOA 4X4OA 4Q5VA 3ZZZA 1NK4A 2CNOB 5HANA 4K42A 1IKYA 3NS6A 1CJUA 2WSCC 1JLAA 3SQGB 1NK8A 5BYSA 5DM6L 4OPKA 2FJXA 4CJFA 1WELA 4N56A 3E9LA 2OZMA 2ZWOA 3RR8A 1S6UA 2ZVSA 1QVFM 4AL7A 4X65J 1B4SA 4ZPAA 4HVZA 3NHGA 2O4IA 1HFEL 3QDKA 5EWEA 3DDIA 3H3NO 3H7HB 3DN9A 1G2EA 2HBRB 5J2MA 3JAMY 5JXSA 3THXA 3KLIB 1GLAG 1WUAA 2J9DA 4A59A 3U3GA 1BCMA 2EC2A 3OJUA 4PG8A 2DNKA 3V6KA 2GUPA 1TP7A 1U1KA 4OKJA 4AF1A 1KKHA 1IM6A 2EKNA 1Y3KA 1NOYA 3SCXA 4JI4K 4AILC 1VYAA 2WHOA 3J81Y 3SYZA 1S1UA 3DM2B 2X1GA 4K50A 2E7WA 1UFWA 4DL0C 2V2VA 2IMOA 1FNMA 3DXSX 3UDVA 4FLUA 1RTDA 2F65A 1ZS6A 5J1NA 5CHCB 3K5NA 2WB4A 1NKCA 2Q1NA 3I8BA 4ZN3A 1Z05A 1OS5A 1I3AA 3WQTA 4A8FA 1MDUB 3IG1A 3MEGB 4O5BA 3CNQP 1N56A 3NMAA 1DY3A 1UVKA 3MWPA 1ATNA 4JI5J 3TEHB 4WFBQ 3LA0A 3QETA 4PRFA 3P31A 3TA0A 4JS4A 3GJQB 1RA7A 4TU8A 2HYIB 4OVLA 4I6MB 2ZEJA 2UU9F 4UY8T 3D3BJ 5CYQA 3WHIA 3X1LB 1FFWB 2E4LA 3TZWA 2JEFA 2V7ZA 1FK9A 4CHZA 3QT7A 3EPIA 3LUYA 3NG8A 2F4VK 4Z4HA 2ZKTA 1ZAWA 2RQCA 4A62A 1VS3A 5DZ7A 1AFIA 1YVNA 4CLUA 2DKOB 3ZSXA 1ZBFA 3FBEA 4WP8A 3CJCA 4JI8K 3KUHA 4DV5J 2JWNA 1LW2A 3K8VA 4M41A 4E1JA 5GADI 3PKYA 1RAEB 1WC5A 5L1IA 4LF5J 2J0WA 3ZSRA 4OI6A 2R7QA 4Q8FA 3PYGA 2ZE2A 3D2WA 1SVDA 4DV5F 4ILGB 5HN0A 4DV4F 3EVMA 2Y8WA 1T0TV 2IVOA 4MO4A 1FKPB 1BUPA 3H6EA 5FPMA 2CPZA 4DSIA 2NXCA 2RQKA 4CYUA 1WORA 4RW9A 1U7LA 4MAKA 4OYWA 3S6EA 5LL6Z 1J9AA 3T41A 3KHGA 1HYSB 4F25A 1WSJA 4JI3K 4DV7J 4JYAK 2O8EA 2QZ8A 3DWLA 2GJFA 1GMVA 3V4IB 4ZS6A 3MZIA 2W4DA 3BN7A 1F60B 3I32A 3CJAA 2IC3B 2N4DA 3OL7A 4R8UB 2P9SB 3FSIA 1XR7A 4I1TA 3UE5A 4FM1A 4HTIA 2B9XA 5CYJA 4HHHA 3AD8C 4CO4A 5C2CA 2MB0B 1W7WA 3A3NB 2N7CA 1S5ZA 2HZCA 3CJ0A 1RFQA 1Z6RA 1QTMA 3UWTA 3EICA 2G8IA 1N32K 3DHWC 1GXTA 4RU2A 1ZAXA 5C12A 2EFGA 2ZOMA 2O8BB 5CZ2A 2DH8A 3VALA 4JKFA 4HTUA 4ZVEA 1FJ7A 1SH2A 3M8YA 3ZNJ1 5LMNF 3IS9B 1NU4A 3SSRA 2P51A 5L38A 1X3MA 5JS2A 3AGRA 2P9SA 4Z7YA 5IS2A 1ZOTA 2KN4A 4RWWA 1WC4A 4CZIA 4FJIA 4M3YA 2BJ3A 2VBXA 3CQYA 2NXEA 1JMTA 1HKAA 4DR3J 2KO1A 3OYNA 3IR6B 4Z94A 3J7YI 4E98A 2KHDA 1FO1A 1UVNA 2ZH6A 3HVTA 3D1HA 4IYQA 4CM0A 3ATVA 3CJ2A 1SL0A 2A3ZA 3IRXB 2AIRB 3G4SS 5GMKa 3N6NA 4OPAA 1RWNB 5HLFB 1Q18A 3I9ZA 2NRTA 1B7YB 2CWKA 1TKDA 5A8RB 3LANA 3NBPB 4DL2A 4CLWA 3W2WB 4CFAA 3OUYB 1S9EB 4RJVA 4JHDA 3PSIA 2JVRA 1WJ9A 2YQ1A 3KG4A 3FUYA 1TV6B 3PYEA 1D5AA 3AVBA 3ULEA 4A5AA 3G6VA 7FDRA 3BM7A 2EKYA 2IBKA 3V9ZA 4ZTJA 2VJVA 1MROB 2W7PA 4NXMJ 4OYOA 1KCFA 3CMES 2ACMA 3D54A 4LFBJ 3M7VA 4WYWA 3A4TA 2BM1A 1WTBA 1D9DA 3QAUA 3A8IA 4BACA 4E7IA 3DLEB 3BH7B 2YX1A 1WDDA 1UETA 3G6YA 4QR1A 2GO9A 1FX2A 3RTVA 1XIQA 4BE1A 4DV6J 3Q8QB 2XZTB 4E89A 1Q8LA 1UZDA 2C3OA 4USUA 4EP4A 1Z1ZA 1YRUA 4DR5F 3M1VA 5ETSA 2B6AB 1WC3A 1PJ6A 3H40A 4NCGA 2ATLA 1Q7LB 1ZA1B 3KVGA 3BF4A 2CPFA 4AXJA 4KHPJ 2FVCA 5KFBA 2W25A 2PC6A 1DQ9A 4F2SA 1R8AA 1WSGA 2DGTA 1O6XA 4YOXA 1HD0A 2EFNA 2MKHA 3CMAN 3C6UA 4FOIA 1FNOA 1C0TB 2Z0GA 1CJVA 2OPPA 1RTHB 3B6OA 2FZGB 1P6TA 1WN7A 3OFGA 3LL3A 2AA4A 1H7WA 2LQ8A 4WFNQ 3V1OA 2QXFA 1X4FA 1P1TA 2OEMA 3GWCA 4ERDA 2YNGB 2ZJQQ 2ZOFA 2VOPA 4F4YA 2E8AA 4IH7A 2QEXN 1CJUB 2JEJA 3ILOA 2CYYA 2DGSA 1WI8A 2E1AA 4DSJA 2HGLA 5AQPA 1VQ4N 3U1MA 3EYZA 1YHQN 3H0PA 2XSJA 1FKOA 4L74A 3IBCB 3IXQA 3THXB 4ANEA 1WBBA 2XHWA 1ICEB 1T9XA 2EHGA 1XN9A 1RILA 1OY8A 4CEQA 2IM3A 2APOA 3MR2A 1CQMA 3VA0A 4IFVB 4B08A 3KOAA 4RL1A 1ZBUA 4USMA 3CETA 5FPNA 1R7IA 3EE3A 4NO7A 1G1XA 1TV6A 3ENBA 3C46A 4KQZA 2IJFA 4DV7K 4FJNA 3BZKA 2HBLA 2M8DB 1QAIA 1CLFA 1KVBA 2DO4A 2ZZNA 3HD1A 3QIOA 4F8RA 3B4DA 4Q0BA 4I0WA 2DY4A 5D4OA 2O3DA 4FPAA 3NGTA 1VQPS 4WFAQ 3DJCA 4YOTA 5AXMA 3ZNUA 4CIOA 3SBGA 1N5QA 3G8SA 3TABA 2HAIA 3DLHA 3HHLD 2WVFA 5F0UA 1KLMB 2XI3A 2YHWA 2GQCA 5HQ8A 5B0GA 2WVCA 4A8KA 2KFZA 1BIZA 4ECVA 1OY9A 2QWPA 3EGNA 1IR1A 4CGGA 2FJVA 2RT3A 3PNIA 4AUKA 3R27A 4IFYB 2XY6A 3U9DA 2LCWA 1NK9A 4DB3A 3R9PA 3IBFB 4USTA 3W3SA 2O67A 4CESA 2OD4A 1YITS 2R7VA 2XB2D 1UA1A 2XC9A 4CBXA 2PE8A 1DLOB 4DR4F 1R8PA 1LW0B 1TFWA 4PPDA 3SUPA 4JD2B 3K9JA 2G4BA 4B3RJ 1KC8T 4X4RA 1QAJA 4ZLLA 3B6PA 1U09A 2NRXA 2F96A 4RU9A 3C15A 4RLEA 4TXSA 3R7SB 2ZBIA 4ECXA 3LP2B 1RGVA 2LU1A 5AJ3F 1IVZA 4I6MA 3RRHA 4KTQA 4Q45A 3V4IA 3QGHA 2HF3A 3CGIA 2AMCB 1UWBA 4DSKA 3KG1A 2Q66A 1NSPA 1UVMA 4DV1F 3SUOA 2JEIA 4I6YA 2GCFA 4M5DA 2B9EA 4FWMA 4W92B 2HZVA 2UXCK 3O4QA 3EX7B 1FRJA 3BGRB 3CXCR 1VC0A 1ITPA 1NK5A 3GIMA 2CQ4A 3WXKA 4CJLA 4N47A 4Y2KA 4DX6A 2KTQA 5F2RA 1K9MT 1B64A 3NF8A 5GAEP 1RDAA 2V67A 1GLDG 3CCJS 1R0BG 4FNIA 1CQNA 3K58A 2HQGA 3SDEA 3CD6N 3QLHA 3DKDA 2Z1HA 2FY8A 5T7LA 2ROPA 2DJWA 3W7BA 4BRDA 3C19A 4FNHA 4DF8A 1RAHB 1EAYC 1BISA 5LT5A 1MWYA 3HSGA 5HVHA 3NRBA 3ENWA 2DISA 1N5TA 4J2AA 3IR5B 3IKMA 1F3FA 3CCZA 1LV5A 2FF6A 5DRKA 1H0HB 5E33A 1IH7A 2OHDA 1WKKA 1RTIA 2HNZA 1GOBA 4FWRA 2Z2MA 1K8KB 1HL6A 2W24A 4F4AA 1HNIA 4YY3F 5DG9A 3AVKA 3W5XA 2VJUA 5AXKA 3M2RA 2EK1A 4A2AA 3CMQA 2AD9A 2CPIA 3GIRA 1TL1A 3RW7A 4FJXA 5LXYA 3M2UB 1BU6O 3IRWP 5DDOC 3AODA 4IRKA 4BR2A 3W2VB 1IJJA 3CJQA 4AL5A 4PWDA 1U49A 3PACA 1WG4A 3BV8A 3FK4A 5EWFA 1SKRA 2QV6A 4BVPA 5IFMA 3FZBA 5ETLA 1XR6A 4EBEA 3JAMU 1OPZA 2YHYA 3D6RA 3VQDA 4BY9C 3IAM9 3VN5A 4EP5A 2ACYA 2G8WA 4OHVA 1REVB 2E88A 2ATQA 2K3KA 2LEAA 1F6TA 4WFNL 4FJ9A 3QEVA 2XS5A 1WSFA 3PJWA 4K8ZA 5KG2A 2X6SA 5IWAF 3O9UA 2XY8A 1YJUA 4JI5K 1FDDA 4X62F 3X3UA 1JLQB 4LF2A 1GFWB 4BRPA 2CVIA 4JKEA 3KXDA 4A8QA 4YHHK 1JX4A 3WQUA 1PJ5A 1CJTA 3PRDA 3MDFA 3THWB 4RUHA 3QT5A 1X60A 3SQOP 4YDUA 2J0SD 2QWQA 2QLWA 4Y28C 1JWWA 1XBWA 4IG3B 5EUHA 5G4DA 4AQYK 2ZFHA 5DDQC 2IOCA 1A5XA 2J4RA 2C2ZB 1PYTA 4Q43A 4P2SA 3PKMA 2JGUA 3RVCA 1VQMS 5CQGA 3L7PA 3R7NB 4OX9F 5LXRA 5J2PA 5B7WA 3V81A 3KKFA 4IKFA 4HH0A 3VQPA 3M8RA 1SJRA 1RAIB 3CDAA 3ZSOA 2ZM6K 3GFZA 3E01B 4QCLA 1S3XA 5M1NA 3QATA 4DU8A 3BYRA 4ZPTR 1VISA 1PC5A 1CXUA 4OHYA 4YORA 5DDPC 1TKZA 1XNQK 4C8ZA 1ACMB 2UXBJ 4JLHA 1GK8A 3AOCA 2F63A 2R8KA 4FXWA 4DV1K 1CLQA 1GLBG 1FT8A 1RYSA 5AR0A 4DV7F 2PT0A 2BGGA 2A1SA 2W2MP 1JJCB 2FVRA 3ID8A 5BR8J 2EPIA 2DT9A 2C28A 4B3TJ 3O1WA 2W01A 1CJVB 3SV3A 4DUZK 3V1RA 3J80U 3H5UA 2OSRA 2JJ4D 4ID1A 4Y1DA 4L73A 3D6FB 4H0PA 5AQIA 4OZJA 4H5WA 1SC6A 3TO8A 3ZFVA 1AT1B 2NXUA 2YKAA 2CVEA 2LQ9A 4GVEA 4DFPA 4DSEA 5AQXA 2ZH4A 3V81B 2DD8S 1RBSA 2D0OA 3AO3A 4FLYA 1L3KA 2CPJA 4ED1A 2ZH2A 2H51B 4I68A 2HVHA 2MKSA 5C2GA 1NDCA 1UWBB 2E7VA 3T1YK 3MM9A 2HW3A 1CPZA 3IA0A 2IY5B 1AROP 1S1TB 2HIQA 2XZDB 3O80A 3QEIA 2I9SA 1N32J 1UVJA 3MWTA 4RPFA 1E6VB 4NZ7A 4B9VA 4XEIA 4CEOA 5DM7Q 3IFRA 2OKQA 1KFSA 1N0UA 3EDRB 4J9MA 2VCPA 4NXNK 1U47A 1FD8A 2FSKA 1H3DA 3JTNA 3OSNA 1YJ9S 1HD1A 1LWEA 2ZH7A 2GIFA 4CYUB 1B7FA 3VEYA 1MWKA 1SIZA 4ZP7A 4DTMA 4CNYA 1XMOK 2CAJA 2V63A 2DR6A 2CPDA 4JI8F 2NRZA 1FXDA 3GILA 4WYLA 3BO2A 2XULA 3FRZA 2C2NA 2DPNA 1BHNA 3BKTA 4QZVB 3I4PA 4U7UD 2IM1A 1Q4RA 1KQGB 3OYFA 4CI0B 4EZ9A 2HHQA 2XMKA 2FBYA 4QIWD 4OZNA 5CD4H 1SI9A 4IEIA 2JH3A 4PXEA 1OVQA 3AQPA 3OBYA 3CYMA 5AQUA 1X9JA 3TYTA 1DURA 2MZSA 1YITN 4HKQA 4TKTA 3SPZA 1Y4ZB 4JI4F 4DQSA 3HCXA 1T44A 2H4YB 1UWAA 1Q1KA 2JL9A 4NLYA 4DG1B 3ZEUA 4MIWA 3KK1B 3FSYA 3W8GA 4CWBA 5CXTA 1YZ6A 4C3MA 1BLUA 3R5BA 4B3MJ 2DGWA 2RDDA 1HI1A 3PFEA 1GX6A 2YNIB 4JS5A 3CCSS 5IXUA 2VQEF 4EZ6A 3OW2M 5C2FA 3ZT1A 5HJYA 3BF3A 3MPYA 1K73T 3MMJA 4PR6A 3ZZOA 2C2RA 4FJ7A 2AJ1A 2MJUA 1R0AB 4QWDA 4JV5F 3H08A 1XQSC 4GMKA 3EXCX 1RT6B 5CZ1A 2GQQA 3VVTA 4RG8A 1TUUA 4CJPA 2J76E 1RT6A 4ICLB 5HMZA 1N34K 3PR4A 4WWSA 2UXDF 1S1WB 1N32F 4MO5A 1OSDA 5ITHA 3HSTB 2HSTA 1WC0A 3VZHA 4GKKF 2E5HA 1VRUA 1XMOJ 2P9LA 2BE7D 2YX7A 1VQNS 2QXLA 1GT8A 4JKDA 4C23A 3K0SA 4RNHA 1J27A 3MM5B 2QIFA 1KN6A 2MZQA 1UEKA 5F8NA 4LIRA 4J9KA 3T5HA 1K47A 1UCNA 4FYDA 1IO2A 4M3UA 2HIYA 4K2XA 4AQYJ 4C0BA 2ZGYA 4K41A 2D9OA 2UZAA 1ZH5A 3TPQA 2F8HA 1J6ZA 4FCYA 1FTCA 5F8IA 4DLEA 3CJRA 2AW0A 3SQ1A 3DYAA 4NPOA 4ES3A 2XO6A 5B09A 2W4CA 3EKSA 4AXIA 5G0RB 4FJMA 4GVBB 2BW2A 2DH9A 4DR1F 3ITHB 3GDQA 2L9NA 1RGIA 2IAJB 1T3OA 5HRNA 3GJTB 3IAYA 4EAHD 4W98A 1O51A 3N28A 2OZSA 5M2UA 3BDPA 3AJ1A 3A12A 4NRTA 4YR3A 1X5OA 2FBXA 4Z4CA 4URSA 1HBOB 4NLVA 2IJRA 4DV3J 3LP1A 4HDGA 3OBIA 4B9MA 1N8RO 3AVCA 5IT9Y 1Q81T 1ZM3A 2KHOA 4BDPA 5CA5A 3J80O 5JVGL 3NWRA 4CBUA 2DFHA 3EDQB 1TVRB 4NRUA 3DOKA 2E2PA 5J1PA 5T7BA 4OX9J 4P2FA 4J9PA 4FO0A 3M05A 4B17A 4KV8B 2IHR1 1PJ7A 1EZZB 5D15A 5C15A 4JKGB 1K44A 3IN5A 5A8WB 4DQIA 2VDIA 2RUGA 4Y1CA 1CBKA 2ZJRL 3V6DA 1X0FA 4GKJK 3MX5A 4OYXA 1FDAA 1X0PA 5C0YA 2MZTA 2B8PA 4RO0A 1Y00A 1NEEA 1FCAA 1WG5A 2B4UA 3SJJA 4CO1A 1HNZK 3JXOA 3CMEN 1R3NA 5E3RA 3TUIC 3MAQA 4PG5A 4K0KJ 4NYNA 2D0PA 2JLFA 5L1JA 5E3PA 2Z8QA 4H4OB 3QNOA 4CI6A 4BE2A 2E2NA 5HQMA 4P71A 2E1CA 1JLGA 4DV5K 1IKXB 4ANCA 3T1HJ 3THTA 1TAUA 4GVMA 1K73O 1BIUA 2K8GA 4KB7A 3Q2SC 1QQMA 2GJIA 5GMDA 5I3PA 4BRGA 3I55S 1CULB 1Y5NB 3BGLA 3BQ0A 4DL5A 2QK9A 3MM6B 2AYGA 1HLUA 1G4CA 5B08A 3E1YA 3D0IE 5KFJA 2AYBA 4G9ZA 2GMLA 4C11A 2OPSA 1IKXA 3DHXA 3FZLA 5KFYA 1M90O 6FD1A 1XNRJ 5IT0A 1ZAVA 2B7CB 3CI5A 1QAYA 2XO7A 2R8IA 4YB1P 2FC0A 4E7HA 4BGAA 2G0CA 3OD2A 5EWGA 3N0VA 1IUJA 4CGFA 3CJ7A 4YR0A 1TK5A 3GJRB 4BE0A 2OPQA 1FD2A 5HVGA 2HGMA 1S76D 3FDSA 4EBDA 2OYQA 4YUDA 2L48A 4OZ5A 1A0OB 3UCZP 3IMXA 1QQNA 2VFVA 5ETTA 2P9IB 3B8AX 4BLGA 4NLXA 3UIQA 2NPFA 1G6BA 2AV5A 4F04B 3M5RA 3BR8A 2KT5A 1VOMA 3CTRA 4C0HA 1EO1A 3R2DJ 2QA4G 2QKKA 4QPTA 3WX8A 4PA1A 2RE2A 4DQ8A 3K9KA 1BHLA 2NRHA 3M1VB 3O9RA 2OFHX 4DV0J 1SAZA 5BJRA 4BROA 4JI0F 3G0ZA 4N5SA 3UKRA 4BS2A 1MNEA 2O5DA 3D4JA 2A6MA 4OMFG 4QIVA 3QO9A 5ETRA 4OX6A 1T02A 1VQ6S 2BE2B 3TQ1A 3H4BA 3RB3A 1SJ4P 3O8WA 4P7TA 4A8WA 4J8FA 2HVZA 4OGCA 3SCLE 1C1CB 1TKXA 1EX4A 1VQOS 1N5SA 3TAEA 1RBOB 5HOOA 4DSLA 4ITSA 2V50A 2W9BB 3M4XA 2B4JA 5JVGQ 3EZOA 4J5OA 4C6AA 3CFRA 5J2NB 2JLGA 1Y97A 3VERA 4LD0A 3WC2A 3TTDA 5CYQB 2RU9A 3PEJA 3R5GA 1NGDA 3QRRA 3HTVA 2HRYA 1WSIA 3R3LA 2RHKA 3UCGA 3UN5A 2AEMA 3SQ0A 3US5A 3S7RA 2M8HA 3OTOK 2YJFA 1G7CB 5A8RA 2HNYA 3I5CA 1EX8A 4A8YA 3BUZB 3O08A 1RTIB 4ILJA 2P9PA 2I6WA 4CJRA 5A0YB 2FQQB 3ATUA 3RAQA 4FZVA 2DK2A 1Q86T 2HMIA 3D2EB 2J9DE 3LZIA 3M6UA 3DXKB 2V9WA 3KMQA 1NGIA 3G6XA 1D0EA 3CDUA 4WP3A 3CDBA 1ZTTA 2KM8B 1HNZF 2L9WA 1J5OB 4B02A 4IRCA 2ZBPA 2FVSA 2MHEA 1U4BA 3M8ZA 1YI2S 3D2FA 3M8PB 1VCTA 2K1RA 8AT1B 1NJWA 4QWAA 1OSCA 2JVOA 2ASLA 2VOOA 4WIIA 2CQBA 1U6ZA 4GRSA 3FZKA 2F8TA 4LF8F 3P38A 2XMTA 4Y6IA 4TY8A 2DR5A 4CECA 4FJJA 2HB5A 2UVWA 1QVFR 4RW7A 4QWEA 1SKSA 4DX5A 1CZAN 1S59A 4FPIA 5CABA 4KRFA 4USVA 4C48A 1O13A 4F0MA 3DDKA 1Y5IB 4FJ8A 2D1CA 3DFEA 4YY3K 2XMMA 5K14B 4C8NA 1I3OB 5K8MA 2YKNA 1K1SA 5HJXA 5AZIB 2P9NB 4FDFA 1DHMA 4CZGA 5B0CA 2CG4A 4JKGA 3QAEA 3RZAA 2A2CA 3BPDA 1NXIA 3FZ2A 3CW2C 3JS9A 1XNQJ 3TSPA 1A5WA 3ID6A 4C97A 4AQYF 2NXNA 4JUZA 1VK0A 1E3MA 2DFFA 2M4MA 3M8WA 2YXLA 4I9LA 4CJ5A 1NBWA 4UZCA 4DCPB 5LJVA 5AJ3K 4Z37A 4QWBA 3RG6A 1C4CA 4YMEA 1D1UA 2PSZA 1T94A 3ASMA 4KH5A 3HFVA 1KLNA 4DFKA 3Q8VA 3SMZA 3M3ZA 3EVOA 3KK3B 1FWLA 3H4DA 1S6QA 4WYBA 4KAZA 5AQNA 1A5VA 1UKUA 2PD1A 2V8GA 3DOLA 1IBKK 2HQCA 2GJ2A 4LF6F 5AQLA 3MCOA 4BREA 4DTPA 4GC7A 2IM0A 2DGVA 4FWPA 3BR9A 4ES1A 3KDOA 3LM9A 1WLJA 2GV9A 3VOVA 4IBNA 1GOCA 2G8HA 3CMAS 2ZUAA 5M2RA 4DR6K 1U8SA 1SV5B 2WW4A 3OW2R 1Y7PA 4ED0A 3OL9A 4HEA9 4URGA 1HBUA 1GQEA 2O4GA 4DJBA 1RSCA 3DRSA 2CZ4A 2UVUA 3JTOA 1BWEA 1BA1A 3HYFA 5HRSA 1VHFA 1VMBA 4PKHA 1LEOA 3UB5A 4KFBB 2C2MB 4K2JA 4M5IA 2M2BA 2BR0A 3WUHA 1VQLN 3QFUA 2CJ9A 5J2QB 4LF4F 1O5JA 2WTUA 2PA3A 2E1RA 4OYBA 3FFIB 4U7CA 2YWHA 4CEDA 1X8DA 2JDJA 2ZHAA 5J1EA 3L3CA 1RDBA 1R0AA 1EKEA 3IGVA 2MLXA 5EN1A 4PHTX 2KXHA 3BDEA 1T3NA 1VSEA 3GV5B 4DV4J 3NAIA 3K5OA 4OLOA 2F8EX 5J2MB 2DEIA 2ZJPL 3O5TB 5BR8K 1QAXA 2DRBA 2UUAJ 1GLFO 1N33F 2WBNA 3I56S 3DLKA 3LOUA 4A8XA 4JNEA 2JLEA 2M0GB 1RA6A 2FZCB 3CF5L 1VDHA 4LSLA 3EM1A 3AT1B 2EWSA 2R8JA 2AJ2A 1SUQA 1VJQA 2LYVA 4DV0F 1NNDA 5KT4A 1NJXA 3UD4P 3ENAA 5ADZA 1HUXA 1YG0A 3HPHA 3MCPA 3J7AP 3TX0A 1IG9A 1OH6A 1MW7A 3DLRA 2JX2A 3N6LA 3C6HA 4KTWA 4PYDA 4WQ4A 3JSRA 3RWUA 1X5PA 4JK9A 2OPQB 2DHGA 2EI5A 4ZCMA 2QJ3A 4LSLB 1NB2A 2OH2A 4QIGA 2NZCA 4DPOA 5KG1A 4FF2A 2R7TA 1TL4A 3EZWA 4J9VA 1ZPWX 2HWIA 3I5BA 3AD9C 2MXYA 4OX8A 4B9SA 4M5JA 1LXJA 1S72N 1FERA 3W9HA 4CZMA 2CQHA 3V6JA 2IVYA 1KVIA 3ZTQA 2CQGA 2HFSA 1RWXB 2QMWA 4IWVA 1NAQA 2YY3A 4B3MF 1LNQA 3BO3A 1JLCB 4CLYA 4QW8A 2XG8A 3V9SA 2HQIA 5CE3A 3JQMA 4CEBA 5IV3A 1IQZA 4NXNJ 3CEDA 1VQPN 1KLMA 1FI4A 2ZH9A 3TAFA 1T9VA 1X4BA 3ULHA 2CQPA 1HNXK 1EB0A 2P5GA 1VSJA 1TMMA 2VFUA 4AFFA 4YR2A 3DDNA 3QEXA 1N36F 2NS1B 5FROA 3ZSVA 1XI1A 5HP1A 3NKYA 3A0IX 2YNHB 4B3RK 3HVAA 1PGZA 1YI2N 2BRKA 4MDBA 3Q7BA 1T05A 2DO0A 4QIEA 1RDRA 1WACA 3CJ5A 4UOFA 1KONA 3QZ7A 4WKYA 2PMZD 2MGZA 1URNA 4Z4IA 2RVJA 1VQ4S 2RB7A 3EUNA 3WEEB 4PZVA 3C15B 3A2FA 4CHNA 4CTAA 2IDLA 1IR0A 4WE1B 2MEWA 3TJAA 2F9TA 3PIPL 2GFFA 1KEKA 4KHSA 3ZSWA 4IZ9A 4URQU 1EHWA 2FLNA 3GQCA 1UJ5A 2K7KA 1AZSA 3AARA 1X9SA 1PO6A 5KGXA 4OHWA 4N77A 2DY9A 3CSKA 2PY5A 2DGQA 1RLDA 4JI7K 4A61A 4JI2K 1OIAA 4QIFA 4KO0A 5GINA 3EZ5A 3C6UB 3FQKA 4CLLA 4U67L 3D2FB 3GONA 1R6VA 5KFAA 3VAGA 4TN2A 3VTHA 2W9CA 5HATA 2VQEK 4IDKA 2CJYB 1VQON 2VG5B 3PIOQ 3VQAA 3CCQS 2IRXA 1J5OA 4DDFA 3GYGA 1TUWA 4ID8A 3BGRA 3NCQA 3MGJA 2EG1A 3KK1A 2MKIA 3D6HB 1JNZB 1WEXA 3M1FA 4JEPA 4I69A 1K9MO 1FRKA 2NSCA 2W1BA 4EFAC 5HVFA 2ZZMA 3RMBA 2WRMA 3MEKA 3OFEA 4QJVA 2CZVC 3FZFA 1N8RT 2DVIA 4ECZA 1MWMA 1FF2A 4XAKA 3QJLA 4FWKA 2XGQA 3H1VX 1WAJA 3EGVA 1IBKF 3MHYA 1S10A 2A18A 2LDYA 1FKPA 1NB7A 3CC7S 3ZT4A 1R8HA 1T8EA 3THVA 4CJ3A 4KJIA 4PABA 2W6KA 5KT7A 1CJKB 3K5LA 1S6PA 1B0TA 3KWMA 1M90T 1PIEA 3G8QA 1N88A 1NCLA 4BC2A 3TJ8A 3W2VA 2GVZA 5BN8A 1LW2B 2E9RX 3TUJC 5C10A 3ZYYX 5E26A 3MUMP 1B3TA 3ELHA 1C0UA 3AVMA 2X3GA 5B0DA 2UXDJ 1YSJA 2MSTA 2D4WA 3OTDA 1DTTA 3Q8YA 5I3UA 4X62J 4B1YB 4KI4A 2NNWA 3UFCX 1DZ5A 4K25A 4AE5A 1F21A 2U2FA 3T3FA 3PW5A 3EEQA 1Y9OA 4IG0B 1LKZA 2Y1RI 3R1LA 3VGVA 2IAJA 5KRTA 2YWWA 2FD2A 3ITHA 2PFFB 1H74A 2CKWA 2QSFA 4FWLA 2ZC4A 2NRVA 4Q0BB 3UCUP 3QT6A 3I4HX 1WWHA 4O23A 3E51A 4LIWA 3KJFB 5D77A 4IOAL 2DNRA 4X65K 4FLTA 1WC1A 4HHTA 2ASOA 3M2RB 5K8OA 3N5FA 3NE6A 1D8YA 4WFXA 2O8BA 2B0GA 3DCAA 3ENHA 2YBVA 3MD3A 1S6QB 3N79A 4NLDA 1LK5A 2N4CA 3LTOA 3W66A 3CG7A 2F8MA 3M30A 1RHMB 2XY7A 3K5PA 2GVZB 2B4VA 3FZMA 4B8CA 4FS2A 2X3DA 4E2FB 2MY7A 3AA8A 5HL7Q 3W5YA 1V3ZA 3J7AN 2F7VA 4H5TA 2H1YA 2CNKB 3IWXA 5E0OA 1TL7B 1TUVA 1FFSB 2EK6A 2OI2A 3Q7CA 2HWTA 1N5VA 2LMIA 1RT3B 3BSCA 4ED3A 1U1MA 3QFHA 3CCLN 5KPTA 2HBZB 1CC7A 1S9EA 4OJRA 4IRDA 1BOTO 3ETMA 1HNWF 3C16B 3FSXA 1FDBA 3FR0A 4X2BA 4KI6A 4B3TK 5M1KA 2Q3PA 1S4FA 5CCLA 4CZEA 2LEPA 3R5JB 1BQNA 1NKEA 3UR0A 2W42A 2HOEA 4FZZA 1IKWA 4CK3A 6FDRA 3PX4A 3C3LA 2D0BA 3AXMA 1NK7A 2BANB 4OYMA 1BE4A 4KTZA 4CF1A 3SQGA 1GAOA 2B6AA 4NMXA 3PO4A 3RR7A 2A0FB 4DFJA 5LSOA 1T6CA 1RAAB 1SQEA 2GNKA 5HMXA 2L3MA 1YJVA 1U6FA 2VC0A 2FBVA 2K3IA 3OBWA 3VQ5A 1NU0A 4O3NA 2CWXA 3ENVA 1JXVA 2VL1A 3MPWA 1SJQA 2D9PA 3H59A 4CTAB 2DPIA 2MKKA 3GSIA 2JC1A 1X3NA 1Z2ZA 3QJJA 2QE5A 2WOMB 1YJ7A 2ASPA 2RRNA 4TYAA 1M5SA 3KJNB 1I1GA 3JQKA 3PW7A 4R5PB 1SZ2A 5KI6A 4HUEA 4YOYA 5CH7B 1YX2A 4F0HA 5D0HA 1D9AA 1XMQJ 1E6YB 3NCRA 8RUCA 3J7YP 3A5LC 3OYHA 3D6MB 3TSUA 5IT4A 2YTCA 1KFDA 3BREA 4L3KA 2BQUA 1U0SA 3F9KA 5KG7A 5FLXU 1IBMF 5IQ6A 3EGWB 1RWVB 4LSNB 4NYFA