2JLEA

Novel indazole nnrtis created using molecular template hybridization based on crystallographic overlays
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
545
structure length
545
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RNASEH
publication title Novel Indazole Non-Nucleoside Reverse Transcriptase Inhibitors Using Molecular Hybridization Based on Crystallographic Overlays.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 139
structure length 545
sequence length 545
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2jleA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2jleA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2jleA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2jleA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2jleA05
3V4IB 1QSSA 4M3UA 1FKOA 4EYHB 2RPIA 3H40A 3LWLA 1NK9A 3SCXA 4G1QA 3BQ1A 2YHBA 2IS3A 1VSJA 2CKWA 1KTQA 2GV9A 4L8RB 1RT6A 4O3NA 2GC8A 4DTMA 2IA6A 1TL1A 2HNDB 2OPPB 3RMBA 3CJ0A 3KIOA 4NLRA 4EZ9A 3G10A 3K57A 1RT2B 5J2NB 1TKZA 1MU2A 1S9GA 1RBTA 3QGIA 5CY4A 4CK3A 4DFPA 3H4DA 4FLYA 5KG3A 1SH2A 1SUQB 4TQSA 4KTZA 4O55A 2ALZA 1RTHA 1DTTB 1A5XA 1S6QA 2BANA 3T19A 1BQMA 3RWUA 4URGA 3OLAA 1NJYA 4MK7A 1RBUA 3H5YA 1Z25A 5I42A 1B9FA 1FK9A 1HQUB 1RILA 1RT4A 4DG1A 5CYQA 2G8VA 1HYVA 4RW6B 3U3GA 3KK1B 1RT1A 3BSCA 4I2PA 4M3YA 3PW4A 4FJ5A 4ID5B 1ZTWA 1HNIA 3ULDA 3G0ZA 4CEFA 4XO0A 1QAJA 3HP9A 4C8OA 3MFHA 3CFPA 2CJQA 4IG0A 4FJLA 4IRCA 3CJ2A 3OYDA 4ED7A 4E1NA 2V0NA 1NNDA 2ASLA 1EXQA 1BHLA 3V9SA 3IGVA 2XI3A 1S1XA 3VQQA 3BSAA 3U3YA 3C6TA 2HHTA 2X6NA 2FVPA 1ZBLA 1SKRA 4AHVA 3I0RB 4Q8EA 4IRKA 3K58A 3NGDA 1JX4A 3TI0A 4PQUB 1RTJA 3T1AA 3KOAA 4TLRA 4HYKA 2HNZB 3DMJA 4NLDA 4H4MA 2XCPA 1LWEA 3L3UA 3ASMA 3G6YA 4ELVA 4NRTA 2YNFB 3ICLA 1JLAB 2KZMA 2OPRA 1XI1A 5KT6A 3DRPA 3LPTA 4FZXC 3B6PA 3ZT0A 3EYZA 1YTAA 3SUNA 1WNSA 4HUFA 4LSNA 2E4LA 4CIFA 5HRRA 4JRPA 3SZ2A 2D3ZA 1RAJA 4W5OA 3MR5A 3GV7B 2KW4A 1VSLA 3O4QA 1T8EA 4DLEA 3EY1A 2VG7A 4M3WA 1KHVA 3EZ5A 4CERA 1L3VA 5I3UA 4DS5A 2IM3A 3OYNA 4KHUA 3TR8A 1J5OB 4ZP6A 2O4IA 4KB0A 1S1UA 2Y1JA 1HMVA 4IG3A 3V81B 4IBNA 1CXQA 3DI6A 4DL7A 2I5JA 1QSYA 2OZMA 1OS5A 3QLHB 4QWCA 5KFZA 3DLKB 3V4IA 4KHNA 3WNFA 4DEZA 1BIUA 4CFCA 4AHUA 4HCCA 3BDPA 2UVUA 1IH7A 2VA2A 3NH2A 1XHZA 2B5JA 3VQ8A 4EBCA 3BQ2A 3AVIA 3QEVA 2IDOA 2E9TA 3L2VA 2OPSB 4RG8A 2FLLA 1JLGB 4B9MA 4NYFA 1XR6A 2OPPA 2HNDA 4WYWA 1IKVB 4IKAA 2IM0A 1ZYQA 1RT2A 5J2NA 3PZPA 5EUHA 4FJXA 3L8BA 2HHVA 4NLVA 1SUQA 2D7SA 4EO6A 1SH3A 2W9BB 1TL3B 3D45A 1VSEA 2P1JA 4BE0A 3UDLA 1S0OA 3SJJA 1S9FA 5FROA 3CO9A 4YQWA 4G3IA 2J6SA 2XC9A 4CGJA 3KKSA 4PWDB 5KG6A 4ICLB 1HQUA 3KJVB 2WOMB 4FJ8A 3PVXA 4RW6A 3KK1A 2W7PA 4NYZA 4K4ZA 4GVMA 2R2TA 4ID5A 2XO7A 3KK2B 1JLFB 1C1BB 3EZUA 4RNFA 1J53A 3ISND 4RU9A 2HWIA 1EETB 1QSLA 4DTRA 5KFNA 3LP1B 4DMNA 4JV0A 4I2QB 1HPZB 3QERA 4JV1A 4LSLB 4R5PB 3P5JA 3BSOA 4K50A 3BSNA 3OYGA 5HROB 4KRFA 3I0RA 3RB6A 1U04A 5KG7A 3V6HA 3MF5A 2QXFA 4PQUA 4F50A 1JL1A 3JYTB 3PY8A 2BDPA 1RTDB 3QEWA 3HJFA 2IGIA 4KI4A 2HNZA 4CJSA 3CQ8A 1VRTB 4XPEA 2BQ3A 1S1TB 3KHGA 3NF8A 3RRGA 1KLMB 5KFQA 3L2QA 3HP6A 3AVNA 4CF9A 4K8ZA 3PX0A 5DMRA 1JLAA 2AGQA 1BI4B 3L3VA 4FK0A 3KK3A 3THVA 3HK2A 1JXEA 4CJ5A 4FJKA 5D3GA 5DQHA 4IKFA 1JLEB 3BJYA 4CHNA 4KHQA 2JC1A 4RZRA 5KFXA 4E1MA 4DTXA 1NK4A 4FLZA 3MAQA 1J5OA 1GX6A 3KLGB 2WRMA 2IM1A 2FBVA 3CM5A 5DG9A 3QIOA 1LAWA 3AVAA 1IKWB 3RR7A 3V81A 2AWZA 3RMCA 4FLTA 3FRZA 1KVAA 3HVTA 4CJFA 2YNIB 4IDKB 3QLHA 3BR9A 5EWEA 3VQ4A 4TY9A 3DLKA 1KLNA 2C2RA 4FW1A 3LZIA 4EEYA 3NF7A 1MU2B 2FVQA 2JEGA 5L1IA 4J9PA 1NK8A 2XY5A 2ZD1B 3OYFA 1RDBA 3HVRA 4IR1A 3ZSZA 3NE6A 4FJGA 2OPSA 1JLGA 3E01B 4F4XA 2BRKA 3AVMA 1IKVA 1YVUA 3KNAA 1HYZA 3V6DB 4E7HA 3NFAA 1CXUA 1RA7A 4NLSA 4NLXA 5KFFA 2DFEA 4FZYA 5KFPA 2W9BA 4M45A 1JLQB 1TL3A 4B3OB 2EC0A 1SKWA 3TAFA 3OS1A 4PWDA 4E7IA 3Q8SB 4ICLA 4YP3A 3KJVA 4MK8A 2WOMA 2J6UA 5F8LA 1BGXT 4F8RA 3AA2A 3SV3A 4M94A 1RBSA 3I0SB 1K1SA 4BDZA 1TKXB 4IRDA 3V1RA 4NCBA 3KK2A 4KHSA 3VQCA 3TAQA 1JLFA 3ALYA 4AHTA 3RB4A 2FJVA 2DPJA 1EETA 4LY7A 4F3OA 2XY6A 3LP1A 3I8DA 4YR3A 4I2QA 1RDAA 1HPZA 2KFNA 2C2DA 4N47A 4IH5A 2E6MA 1IG9A 1HARA 1NJWA 4OLAA 4LSLA 4R5PA 3Q8PB 5FDLB 5HROA 5EU7A 4CJPA 1JLCB 5F8GA 4ZHRB 2D41A 5C24B 3P1GA 4FS1A 2JEJA 1C6VA 4CF1A 4IFYB 3V9WA 4WZQA 4F4WA 1RTDA 2XGPA 5KFJA 4M3XA 4KHMA 2Z1IA 3GIJA 3FSIA 3NKYA 1VRTA 5DLGA 4CECA 3RBDA 4DFMA 2X74A 4IH7A 4MIBA 1Y97A 1KLMA 1KFSA 4I9QA 1RDRA 4N76A 4HUEA 4CGGA 4Q0BB 5I3UB 3OSPA 5EDWA 1BI4A 1VSHA 3ZT2A 4M41A 2R8KA 4CJ3A 4K4WA 1S1UB 3N6MA 4TSXA 4I9LA 4DSIA 1JLEA 4DL3A 4NLQA 3DDKA 4DQQA 1KFDA 4C8LA 4QWEA 3LP0B 4IQXA 4GC6A 1UOCA 3H4BA 4RNHA 3CYMA 2GUIA 4Y34A 4IH6A 3H5UA 3KD1E 2B5JB 1ASVA 1R0AB 3OS0A 3HT3A 1D9FA 2YNHB 3KLGA 4KTWA 3AVCA 4WYLA 1IKWA 5KI6A 3KHHA 4DQPA 3H5XA 4BDPA 2YNIA 4IDKA 4TYBA 3GIIA 4NLTA 3TAMB 4Y3CA 3OYCA 3N6LA 3CVKA 2ZD1A 4KAIA 1NKCA 3V9UA 1WAJA 4B8AB 2FVRA 3E51A 4CK1A 1S0MA 4U7CA 3OVNA 3E01A 3KKRA 4MFBB 3TWHA 3P83D 4J9NA 4MKBA 2HMIA 1IM4A 3V6DA 4O3SA 1D9DA 4ECYA 2X78A 2HB5A 1BQNB 3PR4A 4Q5VA 2W9CB 2HWHA 4WFYA 3TAGA 4LQ3A 1QE1B 3AA4A 5DGAA 1JLQA 4FLUA 5KT2A 1GOCA 2R2SA 4B3OA 1ZBIA 4NYNA 1T03B 1I39A 4ED1A 1TGOA 3TVKA 4ZPDA 3UQSA 2D0AA 4NLGA 4H54A 1WN7A 1N56A 3PW5A 5JUMA 4Q45A 3H98A 3I0SA 3NDKA 1U45A 1TKXA 1HJRA 3SPYA 4KAZA 4W5NA 2A1RA 1RA6A 2KQ2A 3GILA 1N6QB 5KFOA 2FBXA 5KFHA 2I1RA 3DLRA 3NAEA 1VSKA 1TV6B 4O3RA 3HL8A 4EBEA 1TKTB 1S9EB 3QZ8A 4QWDA 3N6NA 3CG7A 4CFBA 5DG8A 4FBTA 2G8FA 3TAPA 3VQDA 4DSEA 3AVFA 2ILZA 3SFGA 3T5JA 5FDLA 1ZETA 3JSMA 2XGQA 3C95A 1JLCA 4KE5A 4ZHRA 1RT3B 4NLYA 5C24A 3B6OA 4QCLA 3VQPA 3OYJA 1NKEA 4B9SA 3WNHA 3KK3B 1WSGA 4F4KA 4J2AA 3ZT1A 2BRLA 4ECZA 4IFYA 3IN5A 5D3GB 4KHRA 4WFZA 3CJ5A 3VQEA 1WSJA 3HPOA 5J2PA 1S10A 2FLPA 4Z4EA 4BWJA 1XR5A 2V4RA 1JLBB 1TK0A 3ZSQA 4CGDA 4Q43A 5KRTA 2XY7A 4OGCA 3LP2A 2D3UA 3I5AA 4B08A 3NF6A 4Q0BA 1B92A 1MMLA 5JS2A 4K4VA 5KG5A 1TVRB 3DLBA 3PX6A 3SPZA 3K5LA 4NLOA 3LP0A 3HVTB 2O4GA 1YVFA 2JEIA 4FCYA 4WXWA 4HHTA 2YKNB 1SV5B 5KT4A 5KFWA 5F8HA 2BQUA 1QHTA 4FJJA 4FJHA 3FDSA 1UAXA 1J9AA 1NHUA 3QO9B 5KFCA 2Z1HA 3V1OA 4ED0A 1R0AA 3RR8A 2YNHA 2W8KA 1W0HA 4DWIA 4DU4A 4CJKA 3UR0A 4DLGA 3PUFA 1G15A 4K4UA 4J9QA 3SQ4A 4J2DA 3QEPA 4CEEA 4EP4A 3NGIA 3TAMA 3PW2A 4DQSA 3VQ6A 4MK9A 5KFYA 4J9LA 2WTFA 4Y2AA 4TY8B 2FLNA 4O4RA 3D0PA 3TQ1A 1KSPA 2F8SA 3SUOA 2J6TA 3VN5A 4CEAA 1CZBA 3VA3A 2ZQBA 1L3TA 3ISNC 3NAHA 3CJ4A 2ASJA 1N48A 2G8KA 5CYMB 4F4YA 5F8JA 1SKSA 2HVHA 1NJXA 4MFBA 3KLEB 4YMEA 4CIGA 2WB4A 1UA0A 4J9RA 2D0CA 3RAXA 3RB0A 2GBZA 2IJFA 3ITHB 4FLXA 2JLEA 1BQNA 1W25A 3OYLA 2W9CA 4QWAA 2AJQA 3GIMA 1QE1A 3MR2A 4CHPA 4E7JA 3DOKB 2Y1IA 4E7LA 2IM2A 5KFBA 1D0EA 2XY8A 4EP5A 1NK6A 4DQIA 1T03A 4ECQA 1O1WA 1L3SA 3M8SA 4QOZB 3OYKA 3AVGA 5KFTA 4RUAA 5DG7A 3H08A 3AO3A 1QS4A 2ITGA 2ILYA 4NCGB 2D0BA 1IKYB 5K14B 1N6QA 3PV8A 4O3QA 3AVKA 1U47A 2RKIB 1TV6A 4AH9A 1NOYA 1TKTA 2IC3B 1S9EA 1J54A 5JXSA 3H59A 1SL0A 3T5KA 1HQEB 4H4OB 1Q9YA 3SUQA 3DYAB 4OKEA 3KLIB 2JGUA 3GYNA 1C0UB 4F3TA 4ZTJA 2YNGB 5KG4A 4ZPCA 3K59A 3EPIA 4JS4A 3IAYA 3Q8QB 4LD0A 1RT3A 3OHBA 3MTKA 4KFBB 3OJUA 4F2SA 4HCBA 4DSKA 4M3TA 4RUCA 4JRQA 4ED8A 4FK2A 5KFEA 3TARA 1JLBA 1KVCA 2F8TA 1CZ9A 3VA0A 1HNVB 3CJ3A 3PJXA 1S4FA 1EP4A 3DRRB 2HHWA 4EYIB 1RTIB 4DF8A 4CHYA 3PR5B 1XC9A 5DGBA 3G6XA 5KTQA 3NGZA 1TVRA 5DLFA 4AHRA 4ZP8A 2FBTA 1KCFA 2ZKUA 2YV0X 3UIQA 2YKNA 3OL7A 1SV5A 2IOCA 4AILC 4YNQA 3VQ9A 3KHRA 4DU1A 2HNYB 4O0IA 5KT5A 3SQ1A 3QO9A 4CEBA 2R8GA 3QGGA 3SI8A 5F8NA 3S9HA 3HPGA 3M9OB 3LANA 2C28A 3KMSA 4KI6A 2IMWP 4B9TA 1WSEA 1RBRA 1JIHA 5KGXA 1FXXA 4ID1A 3NCIA 4Z4GA 4JUZA 3LALA 1A5VA 3KLHB 4DFJA 4KV8B 2HMIB 3TABA 5KG2A 4N56A 2KFZA 2RDIA 1FKPB 3NBPB 2AGPA 2KZZA 4TY8A 1RT7B 4CHZA 1XWLA 1IKXB 3VQBA 4J9OA 5CZ2A 3QEXA 1S5JA 2P5OA 2ETJA 3ZCMA 3PW0A 4URSA 4CCHA 2BGGA 2HHQA 5FRNA 5CYMA 3KLEA 4ZPAA 3IG1B 3O3FA 3QEIA 3VQ7A 4J9KA 2D5RA 2QV6A 4AHCA 3LAMA 1VSFA 3OL6A 1GOAA 4DS4A 4DTSA 4N5SA 3ITHA 1LW0B 4ED3A 1BISA 3TANA 3LP3A 4MQ3A 4DL5A 4FJ7A 3ZSWA 4CEOA 3MR6A 1XHXA 3DOKA 4C8NA 4Z4CA 3OY9A 4EO8A 1IO2A 2W42A 5L1JA 4E7KA 3MECB 4IFVB 1T05B 1Z26A 4DTNA 3D5MA 2ZE2A 3G6VA 4ED6A 3FQKA 3OYHA 5KFKA 4O44B 3EPGA 1CLQA 3KTQA 5KT3A 2R7YA 2UUTA 1NK0A 3JSMB 4NCGA 5L1KA 3OJSA 1IKYA 1C1AA 3LWMA 5K14A 2OZSA 4R0EA 4FW2A 2RKIA 5KFUA 4QPXA 4ECVA 4CF2A 3K5MA 1Q8IA 3MXJA 2IC3A 1Z4UA 2B43A 5HBMB 2BQRA 4WE1B 1ZTTA 1VRUB 1HQEA 5J2PB 4H4OA 1WSIA 4DL6A 4PUOB 3DYAA 2F8EX 4DL4A 3KLIA 5CZ1A 1C0UA 4M95A 2Q3SA 4DTJA 2YNGA 1N5YB 4ECUA 3LP2B 4KSEB 3LPUA 3CFOA 3L2WA 1LWFB 4RW7B 5KG0A 2OH2A 1DTQA 1GX5A 3MEDB 1QAIA 1X9MA 4KFBA 1WSHA 2VWJA 3NF9A 1NKBA 1RT5B 2UVRA 3AO4A 1KHWA 1L3UA 5DK5A 3ZT3A 4W5RA 1WLJA 3DLEB 4CGIA 1U4BA 4CJVA 4ZPBA 1HNVA 3M8PA 4QWBA 3FFIB 5SZTA 1U49A 5F8MA 3DRRA 3RAQA 4MH8A 1RTIA 4WXOA 3HSTB 3CDEA 2WHOA 1DLOB 4O4GB 4KHYA 4RW8B 5KFAA 3PX4A 3OHAA 2ATLA 4OKJA 2QKKA 3C94A 2BE2B 3AVHA 3HKWA 4KTQA 1C0TB 3NAIA 3L2RA 1L5UA 4E19A 2AX1A 4H8KA 2HNYA 5KRSA 1S1VB 3WNGA 2WK4A 5J2MB 3C6UA 3AA5X 2P5GA 4KB1A 4K4XA 1WSFA 4C8MA 3ZSXA 2RDJA 3HXMA 2VG5B 4KKOB 4W5QA 3DLGB 1XR7A 3H2LA 3CM6A 3M9MB 3SI6A 3KLHA 4K4SA 3PO5A 4KV8A 5EWGA 1U48A 4F4ZA 1YT3A 3UPFA 1FKPA 4OGEA 3NBPA 3OLBA 1RT7A 1IKXA 2OPQB 2NUBA 3M8RA 1BCMA 4NLUA 4DSJA 3GV8B 1F21A 1WNEA 2IBKA 1YTUA 1Q9XA 2EHGA 5KFDA 4DL2A 4HKQA 4R8UB 1TK8A 2HVIA 3IG1A 1I3AA 1UWBB 4B9NA 5KFLA 3KMQA 4KPYA 5DQIA 3OYMA 3AVLA 1X9SA 1LW0A 1T94A 2IAJB 4ELUA 4CF8A 3HM9A 1BIZA 3DOLB 3MEEB 2E9RX 2HW3A 4KB7A 5F9NA 4U6PA 2AX0A 2FJWA 4ECXA 3T3FA 4RW9B 5HRSA 3KHLA 3S3NA 1LAVA 4WZMA 3MECA 4IFVA 1T05A 3OL8A 1C1CB 4CK2A 4JS5A 2B4JA 3SYZA 4HTUA 1D5AA 1REVA 4CEDA 3MEGB 3RMAA 5F9LA 5KFSA 4O44A 4MKAA 4CJQA 3DM2B 4C8KA 1NOZA 3MR3A 2R8JA 4OJRA 1ASUA 5J1EB 4FM2A 1ZBFA 2HHSA 4NZ0A 1HRHA 3AVBA 4LQ9A 4OPKA 3QNNA 3TAEA 3SV4A 1RDDA 1C0MA 2PYLA 2QK9A 3S3MA 5HBMA 1S1WB 4WE1A 4FLVA 1VRUA 4EBDA 4PUOA 1A5WA 4ZVHA 1WAFA 4CFAA 2WONB 2E9ZA 4M42A 3LZJA 3OYEA 3IS9A 3LAKA 5SWMA 1N5YA 1EP4B 3AV9A 4M3ZA 2C22A 2R8IA 4TQRA 3SNNA 1LWFA 4RW7A 1TQLA 3RRHA 4ECTA 4CJ4A 3I5CA 3MEDA 2DPIA 1VSMA 4URQU 1T3NA 1RCHA 1RT5A 1KVBA 1B9DA 2JC0A 1TAUA 1VSIA 5HRPA 2EX3A 1RBVA 3NL0A 1SH0A 4E0DA 4QW9A 3ZSYA 3DLEA 2B6AB 5DQGA 3FFIA 4NRUA 3BREA 4CJTA 4MIAA 3VQSA 3DLHA 4ELTA 3K2PA 3MFIA 4KBIA 2G8HA 4J2EA 5EWFA 2DY4A 1X9WA 1DLOA 4O4GA 2R2UA 4BDYA 4RW8A 4CGFA 5J2QB 3GIKA 1D8YA 3MXMA 5FRMA 1LWCB 3MXIA 4TN2A 2BE2A 3M9NB 4FS2A 1C0TA 4FVMA 4FXDA 1NJZA 1NK5A 3SFUA 4FJNA 3Q8RB 3AA3A 3ZSOA 5L9XA 4CHOA 1S1VA 3OL9A 5C25B 3O4NA 4LH4A 5J2MA 3V1QA 2R8HA 4B9LA 2LSNA 2RF2B 3O3HA 5E41A 2AQ4A 3K5OA 2VG5A 4KKOA 3DLGA 1TP7A 3WNEA 3IRXB 3CDWA 3LDSA 1ASWA 4K4YA 4OKKA 3HVWA 2A1SA 4Z0UA 5HLFB 2VG6B 4KO0B 1LW2B 5HP1B 4FJIA 3DRSB 5C5JA 3NH1A 1DTTA 3QYYA 4DSFA 2WCXA 2YKMB 3QETA 2OPQA 4GMJB 3HPHA 3RMDA 4O5BA 2UVWA 3NHGA 2G8IA 2IJNA 4R8UA 4QW8A 1RYSA 2HAIA 1UWBA 4CESA 2XRIA 3T5LA 2ZE2B 3M8QB 4PA1A 1EKEA 4Q8FA 2ATQA 1N4LA 4FM0A 1JKHB 2IAJA 4ECSA 3DOLA 3MEEA 3QNOA 3QZ7A 2FJXA 4DSLA 3V6KA 1QQCA 1TAQA 4HUGA 4FYDA 4RW9A 3K5NA 4CGHA 1W9HA 3V6JA 2FBYA 2RN2A 2KTQA 2FC0A 4Y1DA 2FVCA 4O3OA 3D28A 4CJUA 1C1CA 2XWYA 2AGOA 3H5SA 2DFHA 3BGRB 3HHKA 3MEGA 2VA3A 4CJEA 2C2EA 4FK4A 3KLFB 4CF0A 3L2UA 3DM2A 2V9WA 4NCAA 3AVJA 5J1EA 3QESA 4CEZA 4FZZA 3IGNA 1DTQB 2BR0A 1HYSB 4I7FB 4AHSA 2O5DA 5T7BA 1S6PB 1S1WA 3OYAA 4CJRA 2ASDA 2YNFA 2XI2A 2WONA 3QIPB 4ECRA 1GOBA 3SQ2A 3VQAA 3GQCA 4ZTFA 1S49A 3M8PB 2XHBA 2W9AA 4DTPA 4RNOA 2JEFA 3HYFA 4K8XA 4DTOA 4DU3A 4JLHA 1JXBA 4K4TA 2PZSA 4Z4FA 3OS2A 3CFRA 2G8UA 4O0JA 3RBEA 4O3PA 4J9SA 4RW4B 5L1LA 5C42B 4IR9A 1TK5A 1NHVA 2PY5A 1QUVA 4Z4IA 4RNMA 3T5HA 4BE1A 3QGHA 1FKOB 2B6AA 2OA8A 3CDUA 3S3OA 4XPCA 3NGYA 1ZBHA 3V9XA 4NLWA 4G1QB 3QIDA 2V4QA 5KT7A 1JXLA 4B8CA 2HHXA 1RT6B 3C6UB 3G86A 1TL1B 3CWJA 1JL2A 1BCOA 4HVJA 5J2QA 3BQ0A 4J9MA 1D1UA 1BL3A 3F73A 3SUPA 3O3GA 4ZP9A 3HO1A 2HHUA 4XIUA 1LWCA 1TKZB 3PO4A 1S9GB 3ZT4A 1S0NA 1ZBUA 1LV5A 1I6JA 3NH0A 1VSDA 5JS1A 3PJWA 5KFIA 4CHQA 4JV2A 4Z4HA 1RTHB 4IOBA 1S6QB 2BANB 2QKBA 1BQMB 5C25A 1ITGA 5KFMA 4DFKA 4BWMA 4CEQA 4ZMMA 4ZVFA 2F96A 2AU0A 5I42B 4CE9A 1UA1A 4OL8A 1FK9B 2RF2A 2UVVA 3KLVA 1QTMA 1KRPA 2YHAA 2DTUA 2Z1JA 1X1PA 1T7PA 3IRXA 1RT4B 4DG1B 5CYQB 4FLWA 3RTVA 2W7OA 1RT1B 5HLFA 5KG1A 4DTUA 5KGWA 2VG6A 3GV5B 4KO0A 4I2PB 1LW2A 5HP1A 1HNIB 3DRSA 1SL2A 1K6YA 3CIZA 4M3RA 4W5TA 2YKMA 4CFDA 3QINA 3V9ZA 4IG0B 4PY5A 3KD5E 4LH5A 4RNNA 2PYJA 4WFXA 3OSNA 5KFVA 1CSJA 2QE5A 1K1QA 4TXSA 3AO1A 3ZSVA 3F9KA 4TYAA 1S1XB 2X6SA 4KHWA 3C6TB 4GW6A 3M8QA 3OYIA 1REVB 4DF4A 2XCAA 4N41A 3NMAA 1C1BA 1JKHA 4YR0A 3U6FA 1RNHA 2P51A 4F2RA 1RTJB 1S97A 2W8LA 3HVAA 4Y1CA 5KFGA 4ZP7A 3DMJB 4H4MB 2Z1GA 4B9UA 4BACA 4DQRA 1LWEB 4CIEA 1RDCA 4ZVEA 2G8WA 3I5BA 3BGRA 5T14A 2UUWA 4QAGA 4YR2A 4FBUA 3KLFA 3IS9B 2OPRB 2E6LA 4B9VA 3DRPB 1U09A 4OVLA 4FJ9A 4BE2A 3JYTA 3AO2A 3ZSRA 2VWKA 4CJLA 3OYBA 4LSNB 1HYSA 3FQLA 4I7FA 3SQ0A 1RYRA 2OYQA 3RB3A 4CJWA 2DFFA 1S6PA 1S1TA 2R2RA 4KREA 2VG7B 4YFUA 2GIRA 1SL1A 3QIPA 3PHEA 3PW7A 4E3SA 4FM1A 4NLPA 1TKDA 4ECWA 4X2BA 4Y2CA 3A2FA 5KFRA 4ZVGA 4E89A 4FJMA 5HRNA 4UQGA 1HMVB 4IG3B 2FVSA 1EX4A 2GIQA 3VQ5A 3AO5A 4ED2A 4OPJA 4EZ6A 4OLBA 3DI6B 4RW4A 5F8IA 1NK7A 4J2BA 4Q44A 1VK0A 2I5JB 1C2PA 1S48A 5C42A 4GC7A
chains in the Genus database with same CATH superfamily
4M3UA 1VFJA 4FWRA 1FTCA 3CCQN 3SQGB 3K89A 1GMUA 3BYPA 4IO1A 2CKWA 2V94A 3E1YA 1RT6A 2VBZA 2AJFE 2CQCA 2GC8A 2UXCJ 1DFDA 2OPPB 3RMBA 1DZ5A 1BD6A 4OZ5A 3CJ0A 1N34K 4PG7A 3K57A 3BGFA 3QT6A 5HJXA 5J2NB 1TKZA 1MU2A 1BA1A 5HO4A 3G6ES 3QGIA 3VEXA 4DFPA 1WTFA 2GGPB 3GSIA 4DPOA 3GMGA 3FVYA 4ATNA 3P5BP 4URGA 1Z25A 1B9FA 1R7IA 1YJ9N 1E6YB 3RU0A 5CYQA 4X64F 2ZVIA 4YB7A 1UKUA 3FSXA 3HSDA 3GG1A 2VQFK 3PW4A 4ID5B 1ZPWX 3ULDA 5I3PA 1V4TA 4XO0A 1QAJA 2XYGB 3EXYA 2JLFA 1NM1A 3OYDA 5ETLA 1EQ0A 4FWMA 2ASLA 4Y2IA 1G2EA 2P9LA 4Y0WA 1FX4A 3C6TA 2CQDA 2X6NA 2KG1A 2FVPA 3JSYA 1SKRA 3MPDA 3J8AA 3I9ZA 4AHVA 1YX2A 4RO0A 3N5BA 3K58A 3NGDA 1LCUA 3OVAA 1NJIO 1RTJA 2M0GB 1KQGB 1XIQA 4HYKA 5BYRA 2HNZB 3DMJA 4NLDA 2XCPA 3U1MA 2FJEB 1S6OA 1F6TA 2NPIA 4O8UA 1Q82O 1JLAB 1O13A 2X7IA 5KT6A 3P96A 3LPTA 1WKJA 5BR8F 3SUNA 2GVDA 5HRRA 3SZ2A 4B1ZA 1KD1T 1CJUB 3GV7B 1VSLA 1S76D 1L3VA 1R8PA 1W2BR 5D0GA 4QQBA 5GAEU 5B7WA 2P8IA 3VEVA 4C11A 1WOOA 2HHPA 1HBOB 4DL7A 4PL7A 4I4BA 3MCOA 3JTNA 2V68A 1LK5A 3V4IA 3WNFA 4L75A 4AHUA 4OYIA 4AL7A 1IH7A 5AZIA 3R5JB 3KNGA 1XHZA 3IAM9 5IM0A 3NMRA 4ZVTB 3VQ8A 2QSWA 2ROEA 4F0MA 3L2VA 5HMWA 1HUXA 3U02A 5L9NA 1XQIA 5BPMA 2C3PA 1K73T 3VETA 2V5HG 2F7TA 4RTFD 3BM7A 2QWPA 2E5HA 3A0IX 2VV5A 3PZPA 4KH5A 3P3DA 5BRFA 4JI1J 2G1HA 1SUQA 4EMDA 2BMBA 2RIJA 2P1JA 5GMDA 3FBEA 5FROA 3CO9A 4YQWA 2J6SA 1Q81O 3KKSA 4PWDB 2OTJS 2J0QD 3KJVB 1D8ZA 2GQQA 3FR0A 2DGTA 3ENVA 2AT1B 4NYZA 4OPHA 4GKKK 1VJWA 4GVMA 2MY8A 2FC9A 4JI6F 2QO3A 3KUGA 4JV5F 3G4SS 2RRBA 4RU9A 4ISEA 2RDDA 3M30A 5C0YA 3IM9A 3G71S 4DTRA 3R8YA 3P49B 3OPKA 4DMNA 1XNRJ 2G0IA 3BN4A 3AB2B 4Y28C 3LGNA 4C3LA 3BSOA 2VFUA 3IRWP 1IBCB 5T7LB 3ULHA 2I0XA 2CQBA 3CULA 1S79A 3I0RA 2ALYB 3V6HA 2EFVA 4PQUA 4F50A 1JL1A 2HQCA 5HOOA 1LK7A 3FZKA 3CJ8A 1RTDB 2HFSA 1Q7YO 3W5YA 2QX0A 3KUEA 3O9TA 1S1TB 5LMNK 1GLBG 3NF8A 5G4DA 3GFYA 4RX6A 2CJAA 3LGMA 4CBXA 4PXEA 3R27A 3HFKA 2E66A 1P6TA 4JI7F 5D3GA 4FJKA 2ATCB 2VFSA 1JLEB 4ZPWR 1GMWA 4KHQA 1X0PA 1CLFA 4LVNP 4BRMA 2NZ4A 1B3TA 1ZZFA 4YY3K 2HFZA 2IVMA 1XTZA 4ID8A 4DV7F 4NI2A 1M0SA 1QJHA 3VTIA 2F4VJ 1X0FA 3FZFA 1J5OA 1LXJA 2HHHF 1I94J 2FBVA 3CM5A 5DG9A 1LAWA 3AXMA 2V2KA 2I7PA 3FRZA 5ADZA 4GV6A 5EWEA 3FZMA 2NRZA 3BBFA 4PG4A 3DLKA 4FW1A 1KS2A 3LZIA 3NF7A 1MU2B 4B1WB 2DXDA 3ZTOA 2GCFA 4KQZA 3OYFA 2IDLA 1GLEG 4U95A 2PBDA 3IBCB 4DV0F 1WJ9A 3ZSZA 2W2NP 3SEOA 2AW0A 2DITA 4F4XA 2BRKA 2V51B 3R6LB 1R8HA 1RTZA 1YVUA 4E7HA 3NFAA 1RA7A 2V8DA 5J1NA 2DGXA 4F26A 4FZYA 1JLQB 4U9RA 2HF3A 3IXQA 3N0VA 1IBLF 1KN6A 3W5ZA 5ETMA 3OA9A 1SKWA 4GKJF 3ZTRA 3TAFA 3M3ZA 3GR1A 3QFUA 2F9JA 3Q8SB 4ICLA 4OFZA 1REGX 4MK8A 3A8JA 4I6YA 1DBDA 4F8RA 2YKQA 4B3TJ 4IEIA 1N8RO 4BDZA 4IRDA 3V1RA 3AJDA 4LF6J 3KK2A 4KHSA 1JLFA 3HT0A 4PWWA 1N32K 1TL7A 1R31A 3LDOA 1JQGA 4KYZA 2FJVA 2Y9HA 4LY7A 4O0NA 3LP1A 3SDEA 1T9UA 2XS7A 2PE8A 4B3RJ 1J2VA 2FHMA 4N47A 5DRKA 4OLAA 3ENHA 4LSLA 1JWWA 4JI3K 1EHWA 1HNZF 5F8GA 2ITMA 2D41A 3MI7X 1UPPA 4FWOA 4EUVA 4FS1A 2JEJA 2M7SA 2VL1A 4FZVA 4CF1A 1RU1A 4WZQA 2XGPA 4DUYF 2YH0A 2NPFA 1LKZA 4DR2J 2Z1IA 4M3XA 1CS4A 3GFXA 3GIJA 1VRTA 4LF2A 3TX8A 4CECA 2MLXA 2ROGA 4DFMA 4C8YA 2VCPA 1R8AA 4BCAA 1KFSA 4I9QA 3O9SA 4LRDA 3M05A 1VSHA 3ZT2A 1NPKA 3CTRA 3CCTA 3HSZA 4OX6A 2DHAA 4DSIA 4XAKA 2P9GA 1YJVA 4QWEA 4E1JA 4FNIA 5FIIA 2IVNA 4IDHA 1WSRA 2WVFA 3ZO7A 4OZ2A 3CUNA 2YPZA 5AZIB 5F2RA 2A1BA 3H5UA 4P2SA 3MMVA 1M5SA 3P4IA 3OS0A 2BKNA 2HBYB 3KLGA 4CWBA 4K41A 4WYLA 1TFYA 4F67A 3AAQA 2O8EA 1IKWA 4KHPK 5KI6A 1EWRA 3NS6A 3KHHA 2KDOA 2YNIA 4A2BA 3R9PA 5DETA 3DXBA 1T3VA 5AQHA 3C14A 2UUAF 3TAMB 4Y3CA 2FD2A 2AZ3A 3CVKA 2V34A 5M2PA 1NU0A 4CH7A 3V9UA 1WAJA 4GVEA 4HI2A 4B8AB 4CK1A 5EGYA 1N5QA 3IDHA 3E01A 3EGNA 3N4PA 4LF7J 2LKZA 4M5DA 4J9NA 3VAIA 4DR4F 4MKBA 1IM4A 1D9DA 1ZC6A 2FYXA 4Q5VA 2W9CB 4J37A 5DGAA 4FLUA 2YQ1A 1GOCA 2R2SA 3BBCA 1I39A 4LR9A 1TGOA 3TVKA 1K8AT 3UQSA 4CLPA 4USJC 2HURA 1Z2ZA 2N82B 4NLGA 4NXNJ 4H54A 2E5GA 3CJCA 4C2MA 3H98A 1TKXA 3FGVA 1KOOA 2JLGA 2Q31A 5KFHA 3DLRA 2EG2A 2EBEA 1VDHA 1VSKA 3CC2S 1YBTA 3HL8A 2ZZTA 3CCLS 2B4PA 3Q8YA 3N6NA 3CG7A 3W61A 3A8YA 2G8FA 2Y0SD 4LC9B 5HVGA 2VWBA 2QN6B 1FDBA 2CQGA 5AQQA 3THTA 5D4PA 1VI7A 1SJFA 1KVKA 1OPZA 3ET6A 4KE5A 4DR7K 1RT3B 1J5EF 3B6OA 3WXJA 2OEJA 1NKEA 2BRLA 4XH5A 2DRAA 1PC4A 3TNVA 5D3GB 1NH7A 4ANDA 3CJ5A 3Q24A 4N77A 5J2PA 2FLPA 4Z4EA 4MKYA 2PI5A 2WTUA 2K06A 3BKTA 3PLAA 4H5VA 3O4WA 3I87A 3MWBA 3ATVA 1N36K 3VCDA 2O8BA 2COLA 4B08A 4HWIA 4Q0BA 4LFAF 2HZCA 5GADP 3FKBA 2KHOA 2PFUA 3DLJA 4OHVA 2P6TA 2OFHX 1PILA 5KG5A 3PX6A 1AW0A 3SPZA 3QRQA 3LP0A 1TMMA 1YK9A 2O4GA 3EL2A 4FCYA 5E3CA 2YKNB 2GMJA 3MAHA 1QTNB 3BEGB 5KFCA 1T9YA 4LFBJ 4ED0A 1R0AA 2W8KA 1GXUA 5IC6B 1N34F 3PKYA 3PNIA 1X4CA 4CLUA 2IDEA 2DTJA 3EUNA 3NWRA 1YZ6A 3QEPA 4EAHD 4EP4A 2CYYA 3NGIA 4J9LA 1VQMS 5H9FK 2WTFA 1RE1B 4Y2AA 2XS2A 4PXCA 2VU5A 5I4MA 3SMSA 4LF5K 2J6TA 2L9NA 4HHJA 2ASJA 1N48A 3L7UA 3VAKA 4CO4A 2HVHA 1NJXA 4YMEA 1JJ2M 2HG4A 1U1KA 4U67L 4KR0B 4FNHA 2D0CA 2GIFA 3RAXA 2HZVA 2VQFF 3RB0A 2IJFA 1FXDA 2W2MP 4OO1J 1BQNA 1W25A 2OANA 4ZCKA 3EGWB 4OHXA 2E1CA 4H0VB 4ECQA 3MHYA 3ZEUB 1L3SA 4JI2J 3M8SA 3AVGA 1EB0A 5DG7A 1TYQA 3W2WB 3JQMA 2E5LK 4NCGB 3NGKA 4WPAA 3IR5B 2PIIA 2X1AA 1N6QA 1YGYA 2MHNA 3HSJA 2EKNA 3GG4A 1MWMA 1F2HA 2DBBA 1S9EA 3CC4S 4X4NA 1J54A 3TZYA 3I55S 1HQEB 5AJ3J 2H5EA 4WFAL 1M1HA 4ES3A 3QT7A 1SC3B 1Y5NB 2D4WA 3THWB 1WELA 4KFBB 4DSKA 3BN7A 3CERA 4CTAB 4M3TA 3C2PA 2FY8A 5KFEA 1JLBA 3SCIE 3VA0A 1FNMA 5L46A 2EFQA 3OTCA 2V8HA 4V1Ak 2HHWA 2XNQA 4YHHJ 4DV6K 3A1YG 3MXHP 1RTIB 1RKJA 2XMWA 2XSJA 5FD1A 3LDQA 3D6TB 3G6XA 1AUSL 4USVA 2RE2A 3NGZA 3FBCA 4J8FA 2ZWOA 4QYZJ 1VQ4S 1Q79A 4KGMA 1T9WA 2CJYB 1MG7A 1NCLA 1CQNA 5G0RB 3HTVA 4DU1A 1FHTA 3QB0A 3SQ1A 4CEBA 3QGGA 3K0SA 1KQSR 3SI8A 1Y10A 2N7YA 4QR2A 3M9OB 1WC5A 2C28A 2QLBB 3KMSA 1WSEA 2MSTA 3PRVA 2DNYA 4M5MA 3VQTA 2UZAA 3QDKA 4ID1A 3NCIA 1WI8A 5ETNA 1A5VA 3GDQA 5BN8A 4KV8B 1YI2S 4N56A 3ZYYX 3HZGA 3NBPB 1N0UA 2AGPA 4A8KA 4YDUA 4CHZA 2OJ3A 1BHNA 3MZIA 1KAZA 2MKKA 2CPJA 1NDCA 2B8PA 3QEXA 2ZKTA 4O8KA 3B82A 4CCHA 2HHQA 4ZLNA 4J9UE 3MAAA 4ZPAA 3O3FA 4NXMJ 1VBZA 3RSEB 3QEIA 4GKKF 2NLXA 3A3NB 3LAMA 1VSFA 1PBUA 4C8ZA 2PEHA 4DS4A 4DTSA 2AYMA 1WOPA 1PC5A 3ITHA 1LW0B 1AROP 4M5HA 4CNYA 3QFWA 2DNOA 3UN2A 1RAHB 5LJ3Y 1Y7PA 5M2UA 3DFEA 1OY6A 3W66A 2JDJA 1Z26A 1FDNA 2XHCA 4XK8C 2XQCA 2XMMA 3OYHA 5BYSA 5AQRA 4O44B 3KTQA 5KT3A 4USUA 5LJWA 4IFEA 2HF4A 5L1KA 4UF4A 2M8HA 3TUIC 4BRKA 3LWMA 4R0EA 2Q0UA 2QGFB 1TU0B 4QPXA 4CF2A 5AXKA 3W60A 2IC3A 1GLAG 1ZTTA 4PEOA 1VRUB 5J2PB 4DL6A 4JK7A 2QLJB 5C2DA 3KLIA 1OH6A 1C0UA 4DTJA 1NSQA 2YNGA 1URRA 2VONA 1AB8A 3LPEA 4DR6J 2OAUA 3L2WA 4RPFA 5KG0A 2OH2A 2JSXA 2UVRA 1APSA 3AO4A 1WDTA 3ZT3A 2CPZA 4YY3F 4FVUA 5C2CA 2ZHBA 4W5RA 2CVEA 2KYXA 2ZOMA 2UP1A 4L76A 2UXDK 2GAHC 3M8PA 4CW7B 3UR3C 4CZGA 1G1XA 1ATRA 5F8MA 3DRRA 4X65J 3OTDA 3HSTB 2WHOA 3FEYB 1DLOB 2EC2A 1NMEB 3CCVS 5GAHP 4LF1A 2ATLA 1YG0A 3D6RA 3HKWA 3TJ8A 2R7RA 4KTQA 2ZBCA 5ETVA 3JAMO 5FLXO 3OXLA 2AX1A 1VLYA 5DZ6A 1QHAA 3QJPA 2IJRA 2WK4A 4M7YA 4ZN1A 2H5JB 4OJHA 4K4XA 3CGIA 4C8MA 3ZSXA 2E1PA 3HXMA 2VG5B 4KKOB 5CABA 3ZTSA 4ZLPA 2JFDA 3BZKA 1U2CA 1XNRK 3UPFA 4C23A 1FKPA 2BJDA 3OLBA 1RT7A 1IKXA 5B0EA 5IV3A 4U67Q 1BCMA 1UWAA 3GV8B 1F21A 3S8SA 4YB6A 4AD6A 3I56S 2MQNA 4R8UB 2HVIA 3IG1A 3BV8A 1UWBB 4ANCA 1PJ6A 2QWNA 1MWKA 2HZAA 1N32F 3AVLA 2RHKA 3OYMA 4FKYA 4ELUA 2IAJB 4CF8A 1G6BA 5DS7A 3FE1A 3ZZYA 4U6PA 3FRYA 2KFYA 2AX0A 1NGFA 2IMOA 2JJ4D 5IWAK 4HACB 1YIJN 2NRWA 3RG6A 3UDCA 1FA0A 3AOCA 4DR5J 1BWEA 4CK2A 3KG1A 4JI3F 3OBYA 4HTUA 4IOAL 4CEDA 1H2TZ 5AFUA 4MKAA 1HNWJ 1OKJA 2QT7A 1NOZA 2HWTA 1ASUA 1ZBFA 4GVBA 3SMPA 2PEBA 2EW9A 4WFAQ 3NNAA 4KH6A 1RDDA 1C0MA 2PYLA 2F4VK 3MM8A 3S3MA 2YBVA 1I94K 1F60B 1S4EA 4PUOA 5C2FA 3M1VB 2P2CB 4PRFA 3LZJA 2VKRA 1SAZA 4FPBA 3VAGA 3HHLD 4TQRA 4X4PA 3SNNA 1TQLA 4RW7A 4ECTA 1WF1A 3MEDA 3W62A 5CCMA 3BGLA 1T3NA 2A6AA 2JC0A 2VF3A 1VQ6S 5EHHA 1SH0A 2HFOA 4USIA 2O1PA 4QW9A 3ZSYA 2KJWA 3EVMA 4FYYB 1Y3JA 5EX0A 1YRUA 3C6AA 1FRJA 3IWNC 1VJQA 3FFIA 4NRUA 4MIAA 2CZVC 4ELTA 2CDRB 3OV7A 3K2PA 1A9NB 1CULA 2QL9B 4KHPF 3OW2R 4UOCA 2PFDA 4BGAA 3W3DA 3PRDA 3S6EA 2IFXA 1BC6A 4RW8A 3OFGA 3B54A 2YWGA 5FRMA 1LWCB 1KOHA 3ADAC 3DXKB 2P9CA 1C0TA 2ZWPA 7FDRA 2J4RA 4FXDA 3JB9k 1NJZA 4FJNA 4AE5A 3ZSOA 1VHXA 2MJNA 3OL9A 2J9EA 1P90A 4A8XA 4B9LA 2RF2B 3O3HA 1TFWA 2YWHA 4CH0S 1X5PA 3K5OA 1IR2A 1GNKA 4IOXA 4K4YA 5CHIA 2E20A 1U1RA 1O6XA 2HPUA 4OYWA 4B3RK 2PAVA 2ASYA 3CCSS 3QFHA 4USWA 2E1MC 3THXB 1NNEA 3PYGA 3M4XA 2GO9A 3EO3A 1VIOA 2OHDA 3HHLA 5AR0A 4P9SA 3CJAA 3NHGA 4DUZK 4YOTA 2IJNA 1OYEA 3C7NA 4LF9J 1RYSA 4UUXA 2NXJA 2UV8A 4CZLA 2FGOA 1CC8A 1OQ6A 4FM0A 1VQNN 2W1BA 4CZJA 2IVPA 2HVDA 4RWWA 3MEEA 2QLXA 4DSLA 1CEZA 1TAQA 4DCJB 4FYDA 2HVEA 3O9QA 1VQ8N 4MAKA 4FYVB 4WP8A 2BUNA 1W9HA 2AP1A 3C16A 3V6JA 2RN2A 2FC0A 4CJUA 4JKCA 2AGOA 2EFGA 2DJWA 4QIEA 1RLDA 4DR7F 3AVJA 5J1EA 1XMBA 2GHWA 3NMUA 4DX7A 4FZZA 2BR0A 2E5JA 4H0TB 5T7BA 3T1YK 4X66J 3FMWA 1S6PB 1RHMB 2MKJA 3CJ7A 2ASDA 1N36F 3QIPB 1EARA 4OMFG 4F0HA 2F4FA 3M8PB 2XBPA 3MCMA 1B70B 5ADXA 3H45C 2CQHA 3HYFA 4K8XA 4DU3A 3D9BA 4YN3B 5AFUH 4JLHA 4Z4FA 4K4TA 3DXMA 4OJ3A 4O0JA 4O3PA 4J9SA 4CT8A 2XLIA 3HJVA 4N7TA 4DR3J 3KWMA 4WQ5A 2PY5A 4Z4IA 4RNMA 3T5HA 2R7VA 4AM7A 2B6AA 5AQLA 2NXEA 3D2FA 3S3OA 4JI0J 4LF7K 2R7QA 2PT0A 3H1VX 3V9XA 1NPRA 1SJ1A 3AT1B 2DNPA 4G1QB 2QRRA 1SZ2A 1YBAA 5HK4A 5LXRA 2V2ZA 3A3OB 3G86A 3WIUA 3CCRN 3VEWA 4X4RA 1RWNB 3CWJA 1JL2A 4HVJA 4OQJA 5J2QA 1BL3A 1S9GB 1ZBUA 3MPWA 1U1PA 3PJWA 2Y0BB 5LL6d 4LF5F 3O5TB 4JV2A 4Z4HA 4NXNK 1BQMB 2HSTA 1H6KX 4BWMA 4ZVFA 1UA1A 4OL8A 3R1XA 4JI8J 1KRPA 2XG8A 2R7TA 2Z1JA 4QYRA 2LQBA 1T7PA 3IRXA 3HCXA 1RT4B 4DG1B 1WUUA 2ZH8A 4FLWA 4F3MA 1VQKN 1WTBA 5KGWA 3GV5B 2YKOA 4I2PB 4JN4A 3A5LC 1HNIB 1K6YA 3CIZA 2YKMA 3QINA 2HVZA 4DPUA 2F3JA 4DXLA 3IBFB 2WSFC 2E1ZA 5AQJA 4WFXA 5EX3A 1E4GT 4TXSA 3ZSVA 3F9KA 4TYAA 1QZ5A 1S1XB 3AD7C 3WEEB 2DCLA 2BJ3A 5K9FA 4DHYA 2E5LF 4K42A 8RUCA 3MM7B 5A6WA 3NMAA 2CG4A 4G6VB 3EE8A 4IOAQ 4CH1A 5KFGA 1P9QC 4H4MB 3TQEA 1XNQJ 2UU9J 3D0GE 4HT5A 1XC3A 5AZJA 3ILJA 2G8WA 4LT6A 2APOA 4QR1A 3QNWB 2RT3A 1RXOB 3KLFA 3AJ2A 3CI5A 1NG9A 4AL5A 3UCGA 2DNNA 3W1YC 2FHKA 3JYTA 3E9OA 3ZSRA 2VWKA 3DN9A 1SKUB 4QS7A 4I7FA 3CJKB 1IQZA 5GADI 4JI5K 4KREA 3NWGA 5IT9Y 4QPTA 3BO4A 4YFUA 4DV6F 1TKDA 2DIUA 4BC7A 4Y2CA 4WU2A 4ZVGA 2DNRA 2ZGYA 4FO0A 4UQGA 5HRNA 5GMKa 1K8KB 5F8IA 4RW4A 1NK7A 3MMCB 4Q44A 1RWMB 4OI4A 1ZM2A 3QJJA 4JP8A 2CPHA 3LDLA 3VR1A 1QSSA 1FKOA 3U7JA 3JAMU 5FLXU 3ETOA 4EYHB 1U2VB 3H40A 4J7CA 3JS9A 1IVZA 1TZ0A 1K8AO 3VPZA 1KTQA 4USMA 1FERA 3ETMA 4O3NA 4NB4A 2HNDB 4NLRA 2VPXB 3L7PA 2P9NA 4EZ9A 3G10A 2JNJA 4K0KK 3MMAA 4CK3A 1UP1A 3H4DA 1SH2A 2Y8YA 1U7LA 4O55A 3A13A 1S6QA 3LGHA 3T19A 2C2KB 3RWUA 2QYCA 5TKYA 2Z58B 1RBUA 4RKUC 3QQCD 5I42A 2KI2A 3TZXA 4DV2J 2M52A 3HI9A 3AH6A 2G8VA 3SAGA 4RW6B 3KK1B 2RU3A 3IUCA 1RT1A 1VCTA 3BSCA 4DV3J 2CZ9A 2AKWB 4FJ5A 2P9PB 3MFHA 1BO5O 1NDPA 1DARA 3CJ2A 3O9RA 3ZETA 2V0NA 2HQ3A 2XI3A 2C3OA 3G8SA 3A4TA 3UDEA 3OUYA 3G6EN 4BC3A 2RHSB 1RQ0A 3M2UA 2J8AA 1RU2A 4AF1A 1FRLA 3T1AA 3KOAA 3LOUA 4BRNA 1SCJB 4W4MA 3GB0A 2RD5C 2VFVA 1NMDA 5C10A 2PO4A 1LWEA 2EBGA 4ZPVR 4CZHA 3ASMA 4NRTA 1CVJA 1KQSM 3ICLA 4AXJA 4Q7AA 1B0PA 4X62J 4DV4J 5H1SQ 2RQCA 2GS8A 3DKDA 2KZMA 3WX8A 3IC1A 3DRPA 2G2OA 2PD1A 2BJ8A 1M5KC 4HUFA 1K44A 4LSNA 1GAOA 4C0OC 4JRPA 4TU8A 3VESA 4P10A 2E1YA 4LF8J 3MR5A 2UXDF 2CDQA 1G7CB 3DRYA 2P9IA 3FLCO 1KC8O 2VG7A 2EXUA 4FP9A 3TO8A 3EZ5A 5I3UA 4DS5A 4NA1A 1RGIA 3TR8A 1RCXB 5EVZA 2BJ9A 4CBWA 1BOTO 4ZP6A 2O4IA 4KB0A 1S1UA 2C2NA 2Y1JA 5JLHA 1HMVA 3V81B 4BR4A 4I64A 1OS5A 5GAGU 2VGMA 4QWCA 5KFZA 1HR0J 1N88A 3CCMS 5M1NA 3F41A 3TEHB 4HCCA 2VA2A 4NXMK 2B5JA 3HZEA 3F2KA 3DHWC 4DV1J 5DZ7A 2MB0B 1NSPA 3BQ2A 2OPSB 3W5XA 2FLLA 1JLGB 4KH1B 4H5TA 1CJKB 1NXIA 4NYFA 1BUPA 1VC0A 1V5IB 3R6GB 1N33K 3CCUS 3EE3A 4ETXA 1RT2A 4QS8A 1XNRF 3DWLA 1S22A 1KTVA 3M2RA 5A76A 3L8BA 3M32A 1U6FA 2LVWA 1UVKA 2FPHX 4DHVA 1U1NA 1SH3A 2W9BB 1HLUA 1NLVA 5AQUA 5M1QA 1TL3B 3D45A 2M88A 4BE0A 2Y3YA 3UDLA 1H7XA 4ZCIA 3OTEA 3UO0A 3SJJA 2N3LA 4BR2A 4CGJA 2RB7A 5KG6A 2CWKA 4B3MK 3EKUA 1HQUA 5ETRA 3PHTA 3OFHA 2W7PA 2D69A 5CXTA 2R2TA 4JKHA 3TX0A 2XO7A 3PYDA 1HHSA 2VODA 2HBRB 4WIIA 1J53A 3ISND 4P72A 2HWIA 4F9OA 4UY8T 5IWAF 1QSLA 4I2QB 1IN0A 4BR9A 4JV1A 3D0HE 4R5PB 3E2EA 3P5JA 5HVHA 4AM6A 5HROB 4KRFA 4B1UB 3T6BA 5D4LA 4RWXA 3RB6A 1UVIA 2J7KA 5K8MA 2QXFA 1C0GA 3TW0A 5A8WB 2QEXS 2F4VF 3JYTB 2BDPA 1VK3A 3QEWA 3HJFA 4KI4A 4TLQA 1RAIB 1I94F 4CJSA 3P39A 3L7OA 2C2MB 4XPEA 2OTJN 3AB4B 3KHGA 3RRGA 3L2QA 1V3ZA 2L48A 2DHGA 5AQGA 1WF0A 4K8ZA 3O8WA 4KGKA 1RCOB 2V2VA 1XQSC 3HK2A 4BG9A 1JXEA 2CPYA 3G71N 1I3OB 1GEHA 2E7VA 1UPMB 2XEXA 3CMAS 2JC1A 1TUGB 2MQOA 1D4XA 4FLZA 3CB4A 3PYFA 1GX6A 1WG4A 3WX4A 4JHDA 2IM1A 3QIOA 3AVAA 5GVQA 3RR7A 2XYHB 3D0IE 2H54B 3SK3A 3B8AX 3RMCA 3C15A 3HVTA 1UCNA 2WC9A 3QLHA 4TY9A 1G99A 2C2RA 2R7XA 1SQKA 1YVNA 2FVQA 3DXSX 2YVSA 2LEPA 2XY5A 3D7EO 3HVRA 1UFLA 4IR1A 4LF4K 3NE6A 4RU2A 4FJGA 1CPZA 4MLEA 4P6QA 2AEMA 1R8CA 4HH1A 1P8GA 2X1GA 3AVMA 1IKVA 1H73A 3KJQB 4I69A 2Z2ZA 3CIPA 1HYZA 2OMOA 3DJCA 4B3RF 2KB2A 3QICA 2RU9A 1CXUA 4DPWA 4NLSA 2K1RB 5KFFA 3PIPL 2DFEA 3HFZB 3TVZA 2P9UB 5DDQC 2GQCA 2KYZA 4DUZF 1HNWK 2EC0A 4OYBA 2Q97A 1JCEA 2CPEA 1TMJA 4M63A 5AXMA 3R5BA 3KHYA 4E7IA 3D68A 1WACA 4X4OA 2WOMA 1ZAXA 5KAKA 4I6MA 2V7ZA 1RBSA 3I0SB 4FKXA 2O67A 2YX7A 3ATUA 3ALYA 3PCOB 4GV9A 2DPJA 1EETA 4F3OA 1HWIA 2XY6A 2RS8A 3MOJB 4JKGA 4OYPA 1FCAA 3OR1B 3I8DA 1HPZA 2KFNA 3UE5A 3GFHA 3THYB 1NJWA 1GLCG 4H5NA 4LFCJ 3GJRB 5FDLB 5EU7A 1WORA 3ULEA 1ZM4A 1YSJA 1PAEX 2IIHA 4ZHRB 4P71A 2QA2A 3J7ZO 4P74A 3DHXA 1O51A 1XMQJ 1C6VA 4IFYB 4F4WA 3T1YF 5KFJA 4CZFA 2MPUA 2VJVA 4K7QA 1U0HB 4KHMA 1HBMB 3H3OB 5B0FA 3NKYA 5DLGA 3UW1A 2X74A 1V6HA 1MWZA 2HSEB 3SQOP 1KLMA 1MMNA 4N76A 4BROA 4HUEA 3P38A 5I3UB 2Z2MA 3HLUA 1BI4A 4WK3A 1NGBA 2NRTA 2QTWA 3R7NB 1S1UB 4TSXA 2DHHA 1M1KT 2FF6A 1KEKA 4DL3A 1WC0A 4DQQA 4C8LA 1KFDA 3VZIA 3H1QA 4LF7F 2PN6A 3CYMA 4I6WA 3TP2A 2OD4A 1X31C 3H46O 1MSWD 2ZBRA 1YLXA 2ABYA 3CF5L 1PKUA 2K2PA 2B5JB 4HH0A 4ZS6A 3HT3A 2YNHB 2W40A 4KTWA 3AVCA 4CO2A 2AP6A 5HQMA 3MN9A 4DQPA 3K9JA 3H5XA 4IDKA 2MYFA 4PYAA 4TYBA 1GTEA 3IP0A 2A10A 4OX9J 3N6LA 3OYCA 4NXNF 1U6BA 4JAXA 4LF9K 2ZD1A 1YJRA 3GYXB 4KAIA 3KWGA 2ZZNA 3WHIA 3IMQJ 1YKWA 3TZZA 5DDOC 3OVNA 4BRFA 3GCWP 3TUJC 1Z2LA 1BLUA 1UEUA 4MFBB 1KR4A 3P8BB 1YDLA 3P83D 2ADBA 4IO9L 3V6DA 4Y2KA 1RAGB 2HB5A 4QIGA 2HWHA 2OLWA 1U1LA 5C12A 1ZAWA 4B3OA 1ZBIA 1PGZA 3LM2A 2W2OP 3CJRA 1H2VZ 3ONQA 5C15A 4BC2A 4ZPDA 3KK7A 2WB1D 2D0AA 6AT1B 1WN7A 5HSPA 3LQVA 3D2WA 3E3XA 5JUMA 1M5HA 4Q45A 2GAGC 4X66K 1U45A 4AXIA 1Z05A 3QWUA 5B09A 2A1RA 1RA6A 2GO8A 3GILA 2R7SA 2FBXA 4FDFA 3T69A 1O5JA 2DR6A 4O3RA 1TKTB 3OR2B 4FBTA 4X64J 2QI2A 2IBOA 3OTOJ 3TAPA 2A3ZA 3WQPA 3BH7B 1KKHA 2ILZA 5E26A 4BQLA 4DR3K 2MXYA 2XGQA 3C95A 1LFPA 1C4AA 3MTJA 3NCPA 1U1OA 1JLCA 4A8QA 3TJAA 1RK8A 5C24A 4JBCA 4QCLA 4B9SA 2V69A 4QR0A 4ZVOB 3WNHA 4JI0K 2EFPA 4OI3A 4F4KA 1F1BB 3ZT1A 2UUBJ 1Q5VA 3IN5A 1AT1B 4KHRA 1H3DA 4JI5F 4C9DA 4BRAA 3HPOA 2IRXA 3M8YA 1S10A 4E8UA 3TVYA 1XR5A 5ETQA 2V4RA 3ZSQA 5HJYA 4CGDA 4WK1A 3IAS9 3W2VA 2XY7A 2ACMA 1ZM3A 3NF6A 4HEA9 3NEKA 5JS2A 2HBMA 4JI7K 2ASOA 3J81O 1NPPA 2JFKA 1OH5A 2F9DA 4JK8A 3CC2N 3K5LA 3CCLN 3HVTB 2VIHA 3POTB 4HHTA 4TU7A 1SV5B 2PMZD 5KFWA 5KT4A 4ZJLA 3R7SB 2UV8G 2BQUA 1PJ7A 3A3PB 2W41A 1RWUA 4FJHA 1J9AA 2Z1HA 5BR8J 5JVHL 3RR8A 4DWIA 4DCOB 4ISFA 4A8YA 1G15A 3L09A 1KQKA 4FF4A 2FF3B 4K4UA 4K0KF 4KY3A 3N28A 1QVFM 3SQ4A 3HULA 2H4YB 5AQOA 4DQSA 2QIFA 4QJVA 4MK9A 5KFYA 1C4CA 3UD4P 2FLNA 2G2YA 3BB5A 4O4RA 3J7AN 3CJBA 2F8SA 5IT4A 5AQSA 3SUOA 3VN5A 4DJBA 2ZQBA 2C3YA 4H4KA 5CYMB 1SKSA 5F8JA 3GYGA 2XLJA 3PIPQ 4WFNL 3CMES 2ZOFA 1NUEA 4C6AA 1XBWA 4PCQA 2YX6A 1QDUB 1XNQK 2HIYA 4CZKA 3JSRA 2KVQE 1QE1A 2ZC3A 3MR2A 4CHPA 2Y1IA 3IFRA 1HWJA 3QAEA 5KFBA 4DN9A 1NK6A 3HHDA 1T03A 2VZ9A 4DQIA 4E2FB 2FQQB 4J5OA 4QOZB 1UEVA 5KFTA 2BOPA 1UTAA 4RUAA 1RISA 3AO3A 2CNOB 4Z2XA 3BF1A 2ILYA 1WHWA 2D0BA 5IQ6A 1IKYB 1VQMN 5K14B 4O3QA 4YHHF 3AVKA 4W90B 1RHRB 1TV6A 1NOYA 1Z6RA 2SXLA 1BWVA 4B3SJ 1FW6A 4H4OB 4K8RA 3SUQA 3DYAB 3UN5A 4OKEA 3JTOA 4BRGA 4JV5J 5KG4A 3ZZUA 3K59A 4JS4A 3EPIA 3IAYA 3PM9A 3Q8QB 3D1HA 4OX8A 3OHBA 1HNXJ 4H0YB 2QLWA 2LEAA 1WC1A 3OJUA 4F2SA 3N9UC 4DUYK 2WSEC 2HKEA 3PEHA 4JRQA 1TUWA 4FK2A 3JAMY 5FLXY 1KVCA 2BEFA 2F8TA 1CZ9A 4CQ1A 1CJVA 3P6YC 1S4FA 2PA8D 2DHSA 4CDIA 4EYIB 2H1YA 2QWLA 2ZH5A 1IV0A 1XC9A 5DGBA 4R0JA 2BE7D 1TVRA 5GIOA 4MT1A 4B1XB 3EMTA 3CF5Q 2MY7A 3CC4N 3AQOA 4OYXA 1KCFA 2FBTA 3I55N 2ZKUA 2YV0X 4NXMF 4W92B 1HBUA 1FD2A 3MK6A 2GUPA 4YNQA 2BABA 4DZDA 2HNYB 1YZ7A 4O0IA 5KT5A 3QO9A 3QAUA 1P1TA 5AQNA 3HBTA 1WD6A 1M90T 3NY0A 3S9HA 1N33F 3ZZTA 3DGPA 3M6XA 2HEKA 3J7Z5 1RBRA 5KGXA 1FXXA 3ID8A 1H72C 1UFWA 2YJEA 4JUZA 3LALA 1FRMA 1HKAA 5KG2A 4F3QA 4TY8A 4PKHA 1XWLA 3VHQA 2HHHJ 5CZ2A 1WEXA 4IO9Q 5M1PA 4M7XA 4GMKA 4PPDA 3H2VE 4B3MF 4YDXA 4BHQA 3KLEA 1NGIA 1K9MO 1AZSA 2BACA 3VQ7A 3DRXA 4DN0A 4AHCA 1VQ4N 3OL6A 3CJSA 4N5SA 3E66A 1BISA 1HBNA 5IOLA 1CQMA 4LUBA 4DV0J 4CEOA 1OH8A 5A8KB 3DOKA 4NL5A 4DR6F 4DV4K 1WSVA 2Q1LA 5AXNA 1JNRB 5L1JA 4ZA1A 1ATNA 4ZVRB 1T05B 2ZE2A 4DX8H 3G6VA 2ZUGA 2E1RA 1MROA 3FQKA 2KXHA 1CLQA 4U8VA 2R7YA 4LF8K 2UUTA 4CZIA 1NK0A 1YI2N 4IQMA 3GR0A 2O8CA 1W7AA 1DKGD 2ZGZA 1IBLJ 1OIAA 3OJSA 3MM9A 3VAHA 4MTPA 3JQKA 4P75A 3EDQB 4GKJJ 2RKIA 3WDOA 4X65F 4ECVA 3K5MA 1WDDA 2ZHAA 4NZ6A 5M2RA 5HBMB 4WE1B 3B78A 2F8EX 1BE4A 5HANA 1Q95G 5CZ1A 1JJHA 2XZDB 1N5YB 3PFOA 1KWMA 1HR0K 3LPUA 3IMXA 3G82B 1J5EK 2ZH4A 1X9MA 4I67A 1RWVB 2EFOA 1WSHA 1NKBA 3CD6S 2XM3A 2J0WA 3R7BB 1Q1KA 1ZOTA 1RHJB 3CE8A 3DLEB 4U7UD 1HNVA 1LOTB 4H5RA 4AT1B 5SZTA 1U49A 2FHOB 1SC1B 4JI4K 1XMOK 4L3QA 4ERDA 2IYIA 3RAQA 2QC3A 3UD3P 5F3ZA 1XEZA 2C1EB 3M2VB 5CHCB 1HD0A 3DCAA 3CPWM 3F56A 2BE2B 5JVHQ 1NGEA 2KM8C 1FDAA 2UYTA 3DOMA 1SJ3P 2A0FB 5A0YB 5KPTA 4H8KA 4LF4F 4CZCA 1S1VB 3H8YA 3E8OA 5J2MB 2OKQA 3AA5X 3CQXA 4I6AA 2DCUB 2YX4A 5L38A 2YWFA 4MDAA 3FK4A 2J9DA 3PJ9A 3PACA 3KLHA 2ZWHA 4ZVPB 5EWGA 1YT3A 3TA2A 1F9HA 2B9WA 2E7WA 4WFNQ 2OPQB 3LA0A 3EM1A 1G4CA 1HNWF 3ZZOA 3GIRA 3LTOA 3K9KA 2I8EA 4CP5A 4KJIA 3MURP 1Q9XA 4DL2A 4B1YB 3GU0A 4F36A 1SC4B 4CYUA 4BC5A 4J9VA 3M8WA 3CCVN 2UUAJ 4B9NA 3U9ZA 2O8FA 2W6KA 3KMQA 4KPYA 3RYLA 2ZUAA 2FXUA 1X9SA 3Q7CA 2CFXA 4M5GA 2CA9A 1VISA 1L3KA 5JVGL 2E9RX 1PBAA 5F9NA 2GVZB 2CAJA 2FJWA 3T3FA 3QMQA 1NGDA 1MA9B 3KHLA 2CQIA 5H1SV 2F5GA 2GTDA 1Q78A 4DR4J 3MECA 4IFVA 3AA8A 1C1CB 4JS5A 1VC5A 3RMAA 4C8KA 3MR3A 4FM2A 2C3MA 1VYAA 1BY9A 2ZH3A 2D3O1 1HRHA 3CJTA 2X1FA 2CQ2A 4LQ9A 5IV4A 1FNOA 3QNNA 3SV4A 2QK9A 2ZF5O 2MQLA 5AE2A 4C7QA 5BYQA 3I56N 2G13A 3MUMP 3UVJB 4CFAA 3J81j 2WONB 4M42A 1CJVB 2D0OA 2X3GA 5SWMA 1IWGA 2GQ2A 2DH7A 2A6OA 4M3ZA 1VQOS 3FMBA 1LWFA 3RRHA 1UJ4A 1X5TA 4C1NI 3J81U 2VGNA 3E9PA 3NOCA 1DGKN 2E44A 4URQU 2CGLA 1RT5A 1EQMA 1CJTB 1TAUA 2ASMA 1RBVA 5CQGA 4AL6A 2AZ1A 3MCNA 5AQPA 1J6ZA 1R0BG 1X9JA 4DOZA 1NJIT 1S0VA 2B9XA 1NDLA 3DLHA 3JSBA 3QT5A 2WBNA 3TTDA 4GO5X 2P6SA 4O4GA 4HTIA 3QPIA 5AQMA 5F41A 3C19A 1SQFA 1Q82T 1D8YA 3J7YU 4UY8O 1VBXA 3M9NB 4LF9F 4FS2A 3NS7B 2XMUA 5IT9O 4LFAJ 3SFUA 2UXBJ 1OSDA 3AA3A 1P8ZA 5L9XA 4CHOA 5C25B 1PCAA 4DI6A 4DPXA 1N0VC 2IRUA 3T1HK 3V1QA 3OTBA 4PWUA 2R8HA 2LYVA 1ZBTA 4PYDA 2WUSA 3DLGA 1TP7A 4ILMA 1IWAA 2A3JA 3UFCX 5LMUK 3GTYX 5BRDA 4JD2A 4QIFA 4DR1K 1VQ6N 2M5YA 2EK1A 2VG6B 4KO0B 1EKSA 1LW2B 3DRSB 4L73A 4LSZB 1B0TA 4DSFA 1RAAB 3NH1A 1WOQA 2K3KA 4Z37A 3QETA 1NGGA 4UTGA 2FDNA 1N34J 3Q8VA 3Q0AA 4O5BA 3EXCX 3HHNB 2MJUA 1EIYB 4CESA 2XRIA 4X66F 2ZE2B 4YDUC 4PA1A 4Q8FA 2GHVC 4IO8A 2DGSA 2IVOA 3NVMA 3DOLA 3QNOA 3BR8A 4PQAA 3BYRA 4FPRA 3SCLE 5E2QA 4RW9A 5E3RA 4CGHA 2EWHA 1X4HA 2KTQA 1F3VA 4S0MA 2FVCA 4RBUA 3D28A 1P27B 2XWYA 3H5SA 2DFHA 4DR3F 4CIOA 3FZ2A 4BRQA 3MEGA 3DM2A 2V9WA 4NCAA 3D6HB 4ZPTR 3OVSA 5E7OB 3QGPA 1Q81T 4JI0F 5MAOA 1WHYA 3CCSN 1I1GA 1HYSB 5CR4A 2O5DA 2D1CA 2P9SA 2FJBB 3RRKA 1S1WA 3OYAA 4IJNA 2DPNA 2YNFA 4NMXA 1FRIA 1Q8LA 1E6VB 2J7UA 3GQCA 4ZTFA 4F25A 1S49A 4DTPA 4RNOA 3P45B 3BEXA 1VQSA 2JEFA 1X3NA 3G8QA 3RBZA 1AFIA 2PZSA 3OS2A 4IWVA 2G8UA 4MYTA 2DB1A 3M5RA 3B8HA 2E8AA 1ATSA 1Q7LB 1IG8A 3H90A 1JK9B 1NHVA 1QUVA 4JI8F 2DR9A 3QGHA 2GFFA 2OA8A 2KT5A 2WFBA 1YXQA 1NBWA 3QIDA 3UKRA 5KT7A 3GBTA 1SJ4P 4B8CA 2HHXA 4P7VA 4DCHA 1RT6B 3NNCA 1IR0A 1U0SA 3I32A 4RLEA 3BQ0A 1D1UA 2WBRA 4ZLLA 2HHUA 4BR7A 4ZP9A 3O3GA 1TKZB 5B0DA 1DHMA 2H3EB 1I6JA 1OH7A 4Z7CA 1VSDA 3W8GA 4CHQA 1ITGA 3U9DA 2YPYA 5KFMA 1KVJA 1M1GA 4DFKA 2FJAB 3MPYA 1RDUA 1HI8A 2AU0A 4X84A 3HRGA 2V50A 3MM5A 2A5XA 2QL5B 4IOCQ 1X1PA 1B4SA 1R6YA 5CYQB 1DQ8A 2HGNA 1S77D 1H1VA 1XNQF 5HLFA 4DTUA 1T9VA 2H65B 5HP1A 2FTRA 3SAFA 2V2QA 4DL0C 1SL2A 1RDWX 4W5TA 1Y5LB 3OTOK 3MOZA 2YKPA 4ZOSA 2W2QP 3IA0A 2D9PA 5KFVA 2Q3PA 1KNZA 4ZCMA 2QE5A 3TYTA 2MDAA 1K1QA 3H25A 5KOXA 2U1AA 2BZ2A 2P9LB 2A2CA 5JVGQ 2MZJA 3C6TB 4LRAA 2LU2A 3M8QA 3PFEA 4ZN3A 4DF4A 2P9KA 4YOUA 2QA4N 2W4PA 4HHUA 1JKHA 2MKYA 4LBIA 3U27A 3U6FA 4IYQA 4EU0A 2P51A 1RTJB 3N4QA 4XEIA 1S97A 4AYBD 4FWQA 4RJVA 4ZP7A 3DMJB 5D0RA 2DXEA 4BACA 4A46A 3FBBA 4GKKJ 3A8IA 1U6ZA 3JXUA 3BGRA 4MIWA 3JQJA 4FBUA 2BOAA 4FN5A 2CNLB 1K0TA 2E6LA 2BJ7A 4OVLA 3D2EA 1MMDA 1ELOA 4FJ9A 1I5OB 2ZM6J 4CJLA 4ALZA 3OYBA 3FQLA 2GVDB 2OYQA 1WG5A 1N8RT 2Q79A 5CD4A 3K17A 1QVGR 4H0XB 2EWSA 3AOAA 3PW7A 4Z94A 2RJZA 4ECWA 2H4WB 1LFWA 3CC7S 4X2BA 3QBXA 2JRSA 4PG8A 2O8DA 2BJ1A 2FSKA 4FJMA 4WIQA 5ITHA 4C11B 2GIQA 2WVBA 5AXLA 4DPYA 3VF2A 1QLNA 3D6FB 5LMNJ 1FI4A 3H3NO 4UOHA 3D1QA 4OV1A 5C42A 3EE9A 3HFVA 5ETKA 3V4IB 3DU5A 4CI0B 2ROPA 1WWHA 1U02A 1NK9A 3SCXA 2K7KA 1KONA 5IM0B 2YHBA 3MWTA 3TJ9A 2IS3A 2DNMA 1X5SA 2JL9A 2LQ8A 2Q2RA 4L8RB 3Q22A 5CYJA 2K7JA 1TL1A 3PXGa 4YY3J 1R89A 4LIWA 4HHHA 3L4IA 1VQPS 1MWQA 4KGVB 3O2IA 2NQPA 1SUQB 3UCUP 4FXWA 4TQSA 1JMTA 4KTZA 4RCHA 2ALZA 1RTHA 2BANA 4OLPA 2NRVA 1FTRA 3H5YA 3F44A 2VB6A 1FK9A 3AGKA 3N79A 3OQ2A 5A8RA 3PKMA 2QZ8A 4WKRA 3MCSA 2MKCA 3SSSA 3QWPA 2B4UA 2NUUG 4B3SK 2ERRA 3HP9A 3M30B 4DV4F 4IG0A 4PL8A 4FJLA 4ED7A 3H7HB 1JXVA 5RUBA 1BHLA 1HNXK 4WBFA 3W9IA 5DO2A 3IGVA 3VQQA 3FZLA 3BSAA 3U3YA 4LF8F 2HHTA 2DHXA 4GO7X 3I0RB 4IRKA 3EICA 2G4BA 2GELA 4UY85 3TI0A 1JX4A 3MEKA 4PQUB 4YOYA 3HHLC 5CA5A 3IBWA 3Q23A 4TLRA 3WBZA 1IJEB 4A8FA 5K8PA 3N01A 3L3UA 3G6YA 4USKA 4BC9A 2LXIA 2H48B 2YNFB 4ITSA 1HR0F 4AQYK 3NXZA 2OPRA 5B0GA 1ITPA 1XI1A 5A2QO 1UVNA 3ZT0A 1IBMK 3EYZA 1YTAA 1WNSA 1XERA 3MMBA 4EIAA 2E4LA 4FWPA 1RAJA 2ZNYA 4JI3J 4W5OA 5KQDA 1K47A 2GMLA 4DLEA 3EY1A 4M3WA 3HDSA 1KHVA 4JI4F 1XMOF 2HQDA 4CERA 2CNKB 4NI2B 2V8VA 4CLWA 3VV2B 4A4JA 1NWKA 4JKEA 1VAZA 1HL6A 1J5OB 2MZ1A 2MZRA 3Q86A 2Z8QA 4CO3A 4IG3A 2W7AA 3J7YI 1BWFO 3DI6A 1RHQB 2I5JA 3S01A 2AYGA 2VQEK 1Y4ZB 2F7VA 3DLKB 5ETOA 4KHNA 3M8ZA 5IT9U 2W2PP 3FCWA 4DEZA 1BIUA 3DNCA 2YTCA 3SQGA 3BDPA 3NH2A 1UVMA 5E33A 4EBCA 3QSIA 4CO1A 3AVIA 3QEVA 2IDOA 4RG8A 4B9MA 4OHWA 1XR6A 4WQ5C 4BY9C 2OPPA 1RAOA 3W63A 4WYWA 2VD3A 2IM0A 2XZTB 1ZYQA 5FPMA 5J2NA 1S99A 1YJUA 4FJXA 1YITS 5BREA 4LRFA 4JYAJ 3P4UB 3KJNB 2GGPA 4KHPJ 1Q86O 2A18A 4FVCA 1EX8A 2OUGA 2E2QA 4G3IA 2XC9A 1E6YA 3MN5A 2FZCB 4ICLB 2RRNA 4JEPA 1HFEL 3VALA 4K4ZA 1VRQC 2Z57B 2P9KB 4ID5A 3CCMN 3KK2B 2NXCA 1JLFB 3TR5A 2R42A 1S6UA 3EZUA 4RNFA 1TL7B 1VQLS 2C42A 3PIOL 3LP1B 3SDEB 3RBXA 4JV0A 1SXLA 3QERA 2CJKA 4BRLA 4LBPA 5CCLA 2ZJQL 4LSLB 3O9UA 3CCUN 2KN4A 5ETPA 3L95X 3BSNA 4FYWB 1U04A 4M5KA 5KG7A 3ZLJA 3MF5A 3L4QA 1E3MA 5D0EA 1S7IA 1AFJA 3TPQA 2IGIA 2F8MA 2HNZA 3TA1A 1CS4B 3CQ8A 1R43A 1VRTB 2BQ3A 5GINA 1M90O 3GJQB 3R1LA 2FSNA 3GONA 3SMZA 5KFQA 3HP6A 3NGSA 3FBFA 2DVIA 3V2UC 4WF9L 1U2FA 3PX0A 5DM7L 1VQ9S 1JLAA 2RAQA 3L3VA 2B51A 3CPEA 3THVA 4CLLA 2CPDA 3PSIA 4CJ5A 5DQHA 4QZVB 3BO2A 5GAEP 4HT7A 4ZK7M 1CJUA 2UXCK 3ZX3A 4WCEL 2M9KA 4FWKA 3C46A 2B7CB 4AFFA 1O8BA 2GMHA 2CQ3A 4J90A 3KWIA 4E1MA 4DTXA 3CD0A 3EDRB 3KLGB 2WRMA 2Q36A 2WAQD 4A8WA 2O8EB 1IKWB 3V5RA 4HI1A 1HKBA 1HBOA 2W4DA 4FLTA 2QEXN 1KVAA 4CJFA 2RUSA 2YNIB 3BR9A 3AQPA 3VQ4A 5AT1B 2CH5A 1KVIA 3C14B 2RS2A 2QSFA 1NK8A 1T9TA 3QRRA 5F0WA 3BP8A 5HATA 3T1HF 4ANEA 1SBRA 4BREA 3NGUA 3E01B 1EJ7L 3MPUB 2LCWA 5LMUF 4M5DB 4DR1F 3EGZA 3KNAA 1F5AA 3CMAN 5E3PA 3MX5A 4NLXA 5KFPA 1QAYA 3ENAA 3CJ1A 4KC5A 5IS2A 1EAYC 4PWDA 1XMQF 2V8GA 3KJVA 3CIMA 2J9DE 4V19S 5H9FJ 4DKWA 4WKYA 4OI0A 3R5GA 3AA2A 3SV3A 4M94A 4LF5J 2VUGA 1FXLA 4NCBA 1TKXB 3GLJA 3VQCA 2ZBPA 3U1NA 2JWNA 3DDIA 2ZC4A 3FEXB 3EZOA 1K0VA 1OWXA 1X4BA 4ED5A 1RDAA 1T9XA 1W2BM 3D3BJ 2C2DA 2E6MA 1BA0A 1IG9A 1Y11A 2X51A 4ZVUB 3Q8PB 2DNKA 2KHDA 1NSAA 2MKHA 2QWOA 5T7LA 4KIAA 1JJ2R 3ET6B 5KPZA 3T9NA 4YOXA 1BU6O 3J81Y 3P1GA 1H38A 4Y0FA 3CT9A 4OYOA 4FF2A 1RTDA 3CJ9A 1NDKA 3AHPA 5HL7Q 4NPOA 4P7TA 1NZ8A 2UUCJ 1ZXOA 4NASA 2OMLA 2ZDOA 2LP4A 2E5LJ 3RBDA 4IH7A 1VLOA 3TUZC 2KM8B 2O8BB 4CGGA 3UNGC 4Q0BB 5EDWA 3U8XA 1MW7A 1DQ9A 4IEEA 1A0OB 4M41A 2R8KA 3D7SB 2ZH1A 4A59A 4ILLA 1BQXA 1NGHA 3N6MA 3CMQA 2UXBK 1JLEA 4JKAA 3LP0B 4GC6A 5TKWA 5GADU 3H4BA 4RNHA 2EEYA 2LMIA 1FESA 4CVNE 3IWXA 4IH6A 4I0WA 1DJ0A 2Z2YB 3KD1E 1QUPA 1ASVA 1R0AB 4JI1K 1D9FA 1B7YB 4EHUA 1OJ4A 3L4BC 1S72S 1E4FT 3EEQA 1RHKB 1GLJO 4A61A 1OY8A 2F63A 2PDAA 3CCJS 4BDPA 2HK2A 4DV6J 4NLTA 2MEWA 2HS4A 2DGWA 2BTFA 1CC7A 2VHGA 1YWXA 3CCES 4U7CA 2JWLA 3KKRA 4YDDB 1FE0A 2RE1A 1ZPVA 3U1LA 6FDRA 4ECYA 5BN9A 5EN1A 2X78A 3OTOF 1BQNB 3PR4A 4X4SA 3PDNA 3TAGA 2QJ3A 4LQ3A 3AA4A 2XMTA 1JLQA 2Q1NA 1P9YA 2QWQA 3VF0B 5KT2A 4NYNA 2OCEA 4MYUA 2UUBF 1HI1A 1TYQB 2EVZA 1SB6A 3K0JA 3PIOQ 1KD1O 4CM0A 4A8SA 2D74B 3SPYA 4KAZA 2KQ2A 1N6QB 4P2XA 4C3KA 2ZJQQ 3R5CA 1PJ5A 4EBEA 1KBRA 2EPIA 1S9EB 4CFBA 4EK2A 5E3AA 5DG8A 3HSGA 3ENQA 5ELZA 3QRPA 3AVFA 2LU1A 3T5JA 4LR7A 1ZETA 3JSMA 3TTCA 5A2QU 2VKZG 3VQPA 4L3NA 2KJVA 4RBVA 3K7RA 2O01C 3Q2TC 1QM9A 1UZDA 5DM6Q 4WFZA 3Q2SC 3VQEA 4WF9Q 3R2DJ 3K8WA 3V4MA 5DM7Q 5HAOA 4BWJA 1JLBB 1TK0A 1Q0NA 4FWSA 4Q43A 2J5AA 1K73O 4Q2LA 2AJ2A 4OGCA 3LP2A 2D3UA 2OEKA 2GJFA 1T95A 3HOTA 4IXCA 2DNHA 4C0BA 2WVDA 2CVIA 2XSJB 4TNOA 3TUPA 4U7UK 4WCEQ 4K4VA 2KL8A 2ZVSA 3SIPB 5D15A 1KXPA 5M1OA 3W64A 4NLOA 1YVFA 3EZWA 1U25A 1DEJA 4R79A 3FSYA 4WXWA 2FSJA 3WC2A 1FNXH 1UAXA 1NHUA 3J7AP 3V1OA 1PSDA 2B4OA 1W0HA 2DR7A 3GZ7A 3M6UA 4CJKA 3UR0A 4DLGA 2UXDJ 2HBZB 1HPMA 2W24A 3CD7A 4J9QA 4UW2A 1HWUA 4CEEA 1S59A 3TAMA 3ILLA 1T6DA 1IBKJ 2E29A 5CAAA 3RAMA 3D0PA 3W8PA 2OP5A 3TQ1A 1KSPA 4B3TK 1OYDA 1CZBA 3UDVA 4BR0A 3VA3A 9ATCB 1VMBA 1GMWD 5KQ8A 3ISNC 3CJ4A 4LF6K 2F1FA 2Z2LA 3MAAB 4IZ9A 3VMFB 2BM1A 1UJ6A 3TSUA 3IO1A 4KRWA 1UA0A 2AJ4A 4J9RA 5F1XA 2DXFA 5THWA 1H98A 4B3SF 3LO3A 3AD9C 3ITHB 1FWKA 2JLEA 2OEMA 3OYLA 3Q7BA 1R6VA 2W9CA 4QWAA 2AJQA 4NLBA 3GIMA 3BY5A 4CLKA 1NRKA 2C2ZB 3W9JA 3GOIA 2HRYA 4E7JA 2LEBA 2WVEA 4E7LA 4H0PA 2IM2A 3C8YA 1QVGM 1D0EA 1HNXF 2JWKA 2QG9B 2ZM6K 3OYKA 1PAUB 1PYOB 3FUYA 3H08A 4DR2K 4PZVA 5JICA 1PIEA 2ITGA 1HD1A 2ZHOA 1VQ7S 2MQ8A 4M63C 2NNWA 4AH9A 4QOTA 3KG0A 2IC3B 3H59A 1SL0A 3T5KA 3I33A 2BW7A 4I56A 4KPCA 1F9EB 3VGKA 2QMWA 3ELHA 3ZNJ1 3CMEN 4QIVA 4AQYF 3KLIB 2JGUA 1GXTA 1GT8A 2C3UA 3GYNA 1C0UB 1IQTA 4ZTJA 2YNGB 3MMJA 4ZPCA 3FCHA 4LD0A 1RT3A 1IBMF 2KKHA 5IWAJ 2ZEJA 4DV5J 1WB9A 4HCBA 1ILYA 1A7GE 2WBMA 4K2XA 4ED8A 3TARA 4PXBA 3SAHA 2E1AA 3PJXA 1TELA 5CE3A 2FHJD 2NYIA 3DRRB 5CZXA 1SS6A 1WEYA 1WC3A 1ROFA 3J7A1 1RB0A 4OHYA 4CD3A 4CHYA 2L41A 5KTQA 1RUSA 2CJBA 1W97L 2VQEF 3SSRA 4OZ0A 2CNNB 1TUVA 1FXRA 3N5FA 3UIQA 2YKNA 3OL7A 4AILC 3BF3A 2K8GA 5GAHU 4K25A 4EGLA 2R8GA 5F8NA 4Z7YA 2AMCB 4HDGA 3LANA 4KI6A 2IMWP 2R7OA 4DFJA 5B0CA 2PMHA 2ZZMA 1FKPB 2FZGB 2KVIA 2CXEA 1GK8A 1RT7B 2ZH6A 1IKXB 4NZ7A 1F5CA 1SC6A 2ADCA 2XSFA 1S5JA 1V5VA 1X4DA 3ZCMA 3PW0A 4URSA 2L3MA 4FWLA 1SJRA 2HBQB 2FLOA 2J0SD 4EFAC 2F65A 3AA9A 3IG1B 1Q5YA 1IR1A 2DGVA 3C66A 4FWNA 1ESVA 1GOAA 1VS3A 1EO1A 4FPIA 4XH1A 4ED3A 2CQ1A 4DL5A 1H7WA 2GEMA 3MR6A 3CXCR 1XHXA 1QQNA 2FHJA 4C8NA 4Z4CA 2KRBA 3OY9A 3VEYA 1H74A 4EO8A 3X3UA 2OFGX 2V67A 1WI6A 2GNKA 4G9ZA 3ZEUA 4FL9A 1FO1A 3PSFA