2JLEA

Novel indazole nnrtis created using molecular template hybridization based on crystallographic overlays
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
545
structure length
545
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RNASEH
publication title Novel Indazole Non-Nucleoside Reverse Transcriptase Inhibitors Using Molecular Hybridization Based on Crystallographic Overlays.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 139
structure length 545
sequence length 545
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2jleA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2jleA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2jleA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2jleA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2jleA05
3KHGA 2DPIA 1D5AA 2QXFA 3I8DA 4RNMA 3I0RA 2V4RA 1TKXA 3DLKA 3AVMA 4FBUA 1S10A 4E89A 3O4QA 1LV5A 4KV8A 2W9BA 3OSPA 4B9SA 4G3IA 3LAMA 3SFUA 4DL7A 1WSJA 4DQIA 1TKZA 1JLQB 1HQUA 4ECQA 1BHLA 3OYAA 4WZMA 4IBNA 3QINA 4I2QA 1NJWA 4FJ8A 4UQGA 1S1TA 3CM6A 2OPRB 3K59A 5F8HA 5EUHA 2AX1A 5KG7A 2ITGA 2LSNA 3M9OB 4JV1A 2B6AA 1TV6A 4ECVA 4E19A 4J2DA 1FKOB 3MEGB 4WFYA 3LP2B 1LWEA 1J54A 3F9KA 1D9DA 5HRPA 4IKFA 1HPZB 1RYSA 1CZBA 3TAQA 2HNYA 2PYJA 1SH2A 3GV8B 3QYYA 5KFUA 2Q3SA 4ED8A 1RTDB 4M3UA 2J6SA 5DQIA 4KHQA 3ZSQA 1SV5A 2DFEA 3KLGB 1NKEA 4CIGA 3T5KA 3IAYA 2IJNA 2VG7B 3IRXB 4XPEA 5KFYA 2YHAA 3CFOA 4E0DA 1SL2A 1VSDA 3AVNA 3OYMA 1S1VA 3LP0B 1TQLA 4Z4FA 3EZUA 4QOZB 1JKHB 3RMDA 1NK5A 2IA6A 2IC3B 4KFBA 1RT6B 3Q8QB 1RTIB 4B9NA 4TYAA 2IMWP 4KRFA 4F4YA 4IRDA 3VQEA 1C1CB 3VQAA 4E7JA 4OVLA 3K5OA 4JV0A 4QAGA 4R8UA 3QO9B 3T5LA 3BQ1A 2HMIA 3QLHA 5C25B 1UOCA 2YNHB 2XY5A 1I39A 3ALYA 5J1EB 1RBTA 3MF5A 2RPIA 1Q8IA 2KW4A 4CHYA 4DF8A 2VA2A 5KFPA 1DLOA 4EYIB 1Q9XA 4MKAA 3HK2A 4KHMA 4KB0A 3DM2A 3QIPB 1LWCA 3VQ7A 1RT5A 4G1QB 3BREA 4DTJA 2FVCA 3BSNA 4FLWA 3SYZA 4I9LA 2FBTA 3LPUA 3VQBA 2V9WA 1VSKA 3K2PA 2RDIA 5C42B 4MKBA 3IS9B 2AGOA 3QIOA 2FVPA 1WSHA 4QWEA 5KFZA 3H08A 2EC0A 3SNNA 3IN5A 1Z25A 3HVAA 2BE2B 4JRPA 4CK2A 3L8BA 3RAXA 4WYLA 5E41A 1BL3A 3M8PA 3PO5A 1NKCA 4IKAA 3H98A 3NMAA 1NK8A 2JGUA 4O0JA 5HP1B 3N6LA 3OVNA 4DQQA 3Q8RB 1JLGA 4LY7A 4CEZA 4W5TA 5CZ1A 4F4WA 4Q8EA 4DFMA 5KG4A 4CIEA 3MEDA 4YR2A 3BGRA 5L1KA 1RA7A 3QEVA 3CYMA 3MR3A 1ZBLA 2W9CB 3SV4A 4NYZA 3AO2A 4ZVHA 2UUWA 4M41A 3OL7A 2HW3A 5DLGA 1BQNB 4ECZA 2XCPA 1J5OB 1NK4A 3NGYA 4CECA 2IM1A 5KG3A 5KFBA 3ISNC 3CFPA 5KFEA 3NBPB 1HRHA 5CYMA 4XIUA 4CF8A 3NKYA 5HRSA 1HYSA 2HWIA 1NOYA 3QNNA 1NK0A 3E01A 1B9DA 1WNSA 2UVUA 1U09A 4PWDA 1VSJA 4WE1A 1S1WA 4FJ5A 5KFQA 5KFAA 2FBVA 1WSGA 3EY1A 2B43A 1TGOA 2ATLA 1BI4A 5KFGA 2G8HA 4TQRA 2ZD1B 1JLEB 5SZTA 1QSYA 4RW9B 3KLHB 4ZTJA 4F3OA 1VRUB 2XGPA 2ASJA 4AHUA 2HNZB 2Z1IA 1TL3B 4HVJA 2OA8A 1TKXB 4DF4A 4KKOB 5JS1A 3VQ9A 3LPTA 3GV5B 4JS4A 1U4BA 4Q5VA 3DLGB 4URGA 3NF9A 3HVTA 1TL1B 4B9LA 3OSNA 1JLQA 4FW2A 4MIAA 5DGBA 1TKZB 4CFDA 2ALZA 1HQUB 4J2BA 4DFKA 3ZSWA 4CFCA 2OPRA 4JV2A 1D9FA 4FLTA 5DLFA 1TK5A 4QWCA 3PHEA 4OKEA 1QQCA 3M8SA 2I5JB 1FKOA 3MEGA 1W0HA 3LP2A 4NLOA 5F9LA 2ATQA 3RR7A 4F2SA 4IG3B 1HPZA 3OL6A 5EDWA 1HMVB 5K14B 3KMSA 3N6MA 2KFNA 2D0AA 1RTDA 4ID5B 2GIQA 1S0MA 4J9QA 2PYLA 2IM0A 3KLGA 3WNHA 4FJHA 1LW0B 2VG7A 3IRXA 4DS5A 3QEIA 4YR3A 3LP0A 4FZXC 4DL5A 4CEBA 2ASLA 1WAJA 2DY4A 1DTQB 1QE1B 4TSXA 1JKHA 2KZMA 2Z1JA 4TN2A 4OL8A 1K1SA 1RT6A 1RTIA 3HVRA 1RT7B 4CJLA 2D0CA 1C1CA 2R8IA 3PX6A 4ZHRB 1BIUA 3MFHA 1XWLA 3CJ4A 5KT5A 2FLPA 3QO9A 1RT2B 3TAFA 2XY8A 3O3HA 1T8EA 1NOZA 5C25A 4BDYA 4O3OA 4BACA 2YNHA 1JIHA 1RBRA 4J9RA 1XR7A 5J1EA 4NCBA 4NLRA 4BDPA 3C6UB 3AVHA 3LALA 4NYFA 3O4NA 2BQUA 1ZTTA 2XRIA 5CZ2A 3NAHA 3QGHA 3QGIA 1KHWA 4DQSA 1NK6A 3Q8PB 3TQ1A 4IH5A 4HUFA 4CJSA 4ECYA 3H5SA 4KTQA 4G1QA 1EXQA 3ZSYA 2RN2A 4CJFA 5F8JA 1KFDA 2G8VA 4KAIA 2A1SA 3DRRB 4DWIA 4DTPA 5J2PB 4C8KA 3RMBA 5HBMB 4DFJA 2ZKUA 3VQ8A 5KT2A 5C42A 4OGCA 3IS9A 3KOAA 3PR4A 1EX4A 3VQ4A 3HVWA 1IKXA 2BE2A 4QWBA 2E9RX 2X74A 4N5SA 3TAPA 1LWFB 5EWFA 4IG0B 3RB0A 2HHTA 3CDWA 2DPJA 4H8KA 4DSEA 1S97A 1S9FA 4CHPA 5FRMA 3BSOA 5L1IA 3V6DB 3D45A 2UUTA 4CHZA 3NH2A 4N56A 4GC7A 1QSSA 4RNNA 4OKJA 5KRTA 2JEJA 4EZ9A 4ZP7A 3KLVA 2CJQA 3WNFA 4BDZA 5KG1A 4B9TA 2JEGA 2IAJB 3PX0A 2W9CA 3BGRB 1TP7A 1GOBA 3QNOA 4M3ZA 3AVFA 2P5OA 2FBYA 5CY4A 4FJGA 3GQCA 1CXQA 4RNOA 3G6VA 3VQQA 3OYBA 3OL8A 4CJKA 4NLTA 1BQNA 4O3QA 3PW2A 3LDSA 4BWJA 2V4QA 3PUFA 3RB4A 2ETJA 3HSTB 4OKKA 3SFGA 2R2RA 2FLNA 3NBPA 1S1UB 4ZVEA 5KTQA 4EO8A 3ZSZA 4TYBA 4NLSA 3CDUA 4QPXA 2ZE2B 4TY9A 4M3WA 4CGDA 4NLYA 3MAQA 1SKSA 3DLHA 3M8QB 1U47A 2AX0A 3GIKA 4DEZA 5FRNA 3PO4A 4GVMA 3NFAA 2P5GA 4F8RA 3OYJA 2VWJA 3KD1E 4N41A 3AO5A 3HPGA 4F50A 5KFWA 4ZPAA 3ZT4A 4CESA 2VG5B 4LH5A 3PY8A 2ZD1A 4FM1A 2XI3A 4DFPA 3DRSB 3TI0A 3SI6A 1JLEA 2KQ2A 4RW9A 3KLHA 3DLRA 2DTUA 1VRUA 2IM3A 2HNZA 1L3TA 1TL3A 4CJ4A 4CE9A 4KKOA 4DSKA 3EPGA 1UA0A 5HRNA 3MXMA 2XWYA 2O4IA 3TVKA 3DLGA 2Y1JA 2RKIB 1TL1A 2R2SA 3ICLA 2X78A 1C2PA 3V81B 1C1AA 1UA1A 3HVTB 1B92A 1HQEB 4GC6A 4WFZA 4B8CA 2I1RA 3AA5X 4KE5A 4GW6A 3QZ7A 5KT3A 2E4LA 4CJ3A 2G8FA 3DOLB 1N48A 1DTTA 3V9SA 1GX6A 3DLEB 3HKWA 4NLGA 5FROA 4IH6A 2YV0X 3M9MB 4AHVA 4DL2A 2I5JA 5KFSA 2ILYA 3MEEB 4CJEA 4PUOB 1K1QA 2GIRA 3IGNA 5EWGA 3OYCA 1CZ9A 3DYAA 4M45A 2HHXA 4IG3A 4O3PA 2G8IA 2Z1GA 4W5RA 1BIZA 1HMVA 1L3UA 5K14A 5DGAA 2IDOA 1WSIA 4ID5A 5C24B 4OPJA 4CJVA 4Y3CA 4FK4A 3H59A 4CIFA 3HO1A 1LW0A 1EKEA 1L5UA 3NAIA 4PQUB 4CEQA 1TK8A 5KRSA 4O4GB 1DTQA 1CSJA 1QE1A 4J9LA 3IGVA 3KHHA 4FJKA 5F8MA 3GYNA 3PW0A 4WXWA 1O1WA 3PX4A 1MU2B 3DMJB 5D3GB 1N4LA 3P1GA 1RT7A 4IR9A 2F96A 4CF2A 2BQ3A 3L3UA 4Q43A 4ZHRA 3DI6B 1KVBA 3OL9A 1TAQA 1RT2A 4R5PB 4Z0UA 4MK9A 2W42A 1T05B 4ELVA 3M9NB 4EP5A 2E6MA 4DLEA 2WONA 4Y1CA 3L2RA 3C6UA 1WN7A 2R8JA 2YNIB 4O55A 3SQ2A 3S3OA 2C2RA 4L8RB 2YKMB 4E7LA 1VRTB 1S1XA 4C8MA 4WFXA 1UAXA 4HCBA 1UWBB 3GV7B 4KB7A 4CEFA 3RRHA 3SUQA 2UVWA 3HL8A 4OGEA 1KCFA 2Z1HA 3ASMA 3H5XA 3KTQA 3AV9A 2IGIA 3DRRA 4CJRA 4HUEA 1EETA 5J2QB 4M94A 4RZRA 4QWAA 5J2PA 4PA1A 5HBMA 3BJYA 4EBDA 2YNGB 4ECTA 4CEEA 3QERA 3OLAA 3S9HA 4F2RA 4DMNA 1ITGA 2F8SA 4XPCA 3ZT3A 2RF2A 3LANA 4NRTA 4ZVGA 4CK1A 4QW8A 1S9GB 4ZMMA 2EHGA 4AHRA 2VWKA 1LWFA 4DU1A 1IKXB 4LD0A 4IG0A 4FBTA 3TR8A 2WCXA 3T1AA 2D3ZA 2FVQA 2FC0A 4NLQA 3KJVA 4O5BA 2HAIA 4YMEA 3V6DA 4CJWA 1XI1A 1NKBA 4EEYA 3GILA 3SUOA 2HHUA 4CHQA 1ZBIA 1Z26A 2HVHA 3JYTB 4IR1A 3LWMA 3B6OA 4NLWA 1RAJA 2GUIA 4BWMA 2JLEA 3ZSVA 2WB4A 3B6PA 1KLNA 2JC1A 4FJJA 2IAJA 3AVJA 4RNHA 3L2QA 4CJQA 1SH3A 1IKWB 4Z4HA 4KO0B 4DSIA 3H40A 3OJSA 4KPYA 5I3UB 3KHRA 1RDDA 4FJ9A 2W9AA 1NNDA 4ECXA 3RB3A 2XY7A 4EYHB 3AA3A 3KKRA 1S1UA 1NJYA 4CK3A 1XHXA 5DG8A 4CHNA 2ZE2A 1SL0A 1HYVA 3NAEA 2QE5A 4F3TA 3MECB 4EP4A 2XC9A 3M8QA 3ZSXA 5EU7A 2HHSA 2OPQB 2FLLA 2AGPA 3RR8A 5KFLA 3G0ZA 3P83D 2QKBA 4LSLB 3UIQA 4CJTA 5KT7A 3AVGA 3UPFA 2OPPB 1RYRA 2X6NA 4RW6B 4ED3A 4FM2A 4RNFA 2VG5A 4KHSA 3T19A 1X1PA 4RU9A 1BISA 4J2EA 1IKYB 4DSFA 3DRSA 4Q8FA 1JLFA 1T94A 4NLXA 3OS1A 2J6UA 2D41A 1RBSA 4ECUA 1W9HA 1TKTB 3SPZA 3ZSRA 3OJUA 5F8NA 4U6PA 5DG7A 4B9VA 2RKIA 3HJFA 2HVIA 4FLYA 1T7PA 3V81A 4NZ0A 3U6FA 1REVB 3H5YA 3HPHA 1QSLA 4ELUA 5CYQB 3A2FA 4FLUA 1HQEA 2Y1IA 4Z4IA 4KAZA 3OHAA 2AU0A 4CGFA 1YTAA 4DTRA 2NUBA 4CGHA 3DOLA 1K6YA 2R8HA 4YQWA 4F4XA 2OZSA 2WHOA 3DLEA 4NLPA 4J9KA 4IH7A 1RILA 1T3NA 1DTTB 4EO6A 4M3TA 4CCHA 4MK7A 4B3OB 5DMRA 1SH0A 1HNVB 3MEEA 1B9FA 2F8TA 4PUOA 3NCIA 3HP6A 1XR6A 1QTMA 1ZTWA 1WLJA 4KB1A 1ZETA 4Z4GA 3V9XA 3SJJA 2OH2A 5HROB 3DYAB 3CVKA 4J9MA 4ZP6A 1RNHA 1GOCA 3UQSA 5C24A 3NF7A 4YNQA 1A5XA 3D0PA 3CJ3A 4PQUA 3NF8A 1YVFA 3ZT2A 3NH1A 4EBCA 1TVRB 1X9SA 5J2MB 3VQ6A 3VQPA 4O4GA 1WSFA 4E7HA 4H4MB 3NGZA 1FK9A 4TLRA 2J6TA 4OLBA 4RG8A 1MU2A 3DMJA 5D3GA 3UR0A 1NK9A 1HYZA 1D8YA 3M8RA 4Y2AA 5KG2A 2KTQA 1NHUA 1NHVA 3HT3A 3CQ8A 2C28A 3DI6A 4M3YA 1MMLA 4HCCA 3WNGA 4R5PA 4Q0BB 3K5NA 1T05A 1S0NA 3SUPA 4TQSA 3QESA 3BSCA 4F4ZA 2HHQA 3KIOA 2W8LA 2YNIA 4X2BA 2VG6B 3JSMA 1IG9A 2WONB 2YKMA 3C95A 3AA4A 1C0TB 1VRTA 5KFRA 1JLBB 1Y97A 2BANB 1N5YB 4RUAA 4N47A 1LW2B 5F9NA 1UWBA 1RT3B 1S1XB 3ZSOA 2WK4A 4TY8B 3HPOA 3EPIA 3LP1B 2UVRA 4W5QA 1X9WA 4FM0A 5J2QA 4K4XA 4IFVB 1TK0A 1IKVB 3OYNA 1FKPB 4ZP9A 1ASWA 3OS2A 2YNGA 1EETB 4CJPA 2WOMB 4U7CA 1IM4A 2GBZA 2B4JA 1C6VA 4E7KA 1U49A 5KFDA 1S9GA 3D5MA 4HYKA 4MQ3A 2BGGA 2C2EA 5KFIA 3T5HA 2RF2B 3OYGA 4MH8A 3ITHB 4AH9A 4C8LA 1KFSA 1S6QB 4O4RA 3G86A 1IH7A 4DL3A 4KTWA 2G8WA 4FZZA 2GV9A 3V6KA 3SV3A 3KJVB 2BQRA 4I7FB 4DU3A 3QEPA 4J9OA 3JYTA 2D5RA 4EBEA 1ASVA 4IQXA 1T03B 2G8KA 2E6LA 1BQMB 1RTHA 2YKNB 3RMAA 4E1MA 1L3VA 2IM2A 4CHOA 1IKWA 4KI4A 4KO0A 4LH4A 2IS3A 1ZBFA 4E3SA 1IO2A 3AO3A 4KHUA 5I3UA 3DDKA 4WXOA 1I6JA 3CWJA 2EX3A 3HYFA 4K4UA 5KG6A 3RTVA 1VSHA 3AVAA 4CERA 3PW5A 5HLFA 3MXJA 3AO4A 4CF0A 1S0OA 3K5LA 1CLQA 3MECA 1WNEA 3CJ5A 3AVBA 4O3RA 2OPQA 1SL1A 4QW9A 2ASDA 4LSLA 1D0EA 5SWMA 5KFJA 3FFIB 5F8IA 3V4IB 4K4YA 1JXLA 1JX4A 3VN5A 4DQPA 1JLCB 3FSIA 2OPPA 4CFAA 2BRKA 5KFVA 4DTNA 4ECRA 4RW6A 3OY9A 3OYHA 3LWLA 4AHSA 4C8NA 3I5AA 4FS2A 1IKYA 4YR0A 3N6NA 1JL1A 1RT1B 2R2TA 2ILZA 2R8GA 5L1JA 3LZIA 1JLFB 4NRUA 1TKTA 4FJXA 3TAMB 3PR5B 3V1OA 5KG0A 4FZYA 5JS2A 3KLFB 3V9ZA 4DSLA 1RA6A 4O0IA 4WZQA 2E9ZA 1JL2A 1REVA 1NJZA 5CYQA 4W5OA 1R0AB 1S48A 4MFBA 4LSNB 3CG7A 2R8KA 4XO0A 4B9UA 1S6PB 1N6QB 1U04A 4C8OA 4MK8A 1A5WA 3SUNA 4RUCA 4M3RA 4TXSA 4H54A 4B3OA 4N76A 4FCYA 1JLAB 1HARA 3S3NA 1HNVA 4RW7A 3AO1A 5JXSA 4URQU 2XY6A 2JEFA 3FRZA 3PW7A 3KMQA 4BE2A 3BR9A 4ID1A 4FW1A 3PZPA 3Q8SB 4ED6A 5HROA 3NF6A 3L2WA 3QEXA 1C1BA 3SI8A 3HP9A 2FJVA 4RW4B 1XHZA 4GMJB 3L2VA 3H5UA 1I3AA 5DQHA 1QAJA 3QIDA 5KFFA 4K4TA 4DLGA 4PY5A 2OPSB 5T7BA 4ECWA 3CM5A 1TVRA 5J2MA 5JUMA 4F4KA 3L2UA 4H4MA 3KK3B 2XI2A 3PW4A 2GC8A 1XR5A 2AJQA 4R0EA 2YHBA 1CXUA 3V6HA 1RDRA 1S9EA 1FK9B 2AGQA 4DG1B 2P51A 3AVIA 3K58A 3MR5A 1FXXA 3KD5E 3TAEA 3NE6A 3E51A 1NK7A 4DL4A 4Q0BA 3IG1B 2IJFA 1EP4B 1TKDA 4IDKB 5KFKA 5DK5A 4ED0A 1D1UA 2VG6A 3VQ5A 4DTUA 4I2PB 1C0TA 1JLBA 1HJRA 2BANA 1N5YA 3QGGA 4IFYB 1LW2A 3JSMB 4FXDA 1RT3A 3BQ2A 3I5CA 4TY8A 4J9SA 4QCLA 3LP1A 1F21A 5FDLB 3KNAA 3PJWA 5F8GA 1YVUA 4IFVA 4MIBA 4O44A 1S49A 1IKVA 2JC0A 1FKPA 3NL0A 3AVCA 4FK2A 4CGIA 2HNDB 1YT3A 2C22A 2WOMA 1X9MA 4J9NA 3LP3A 1VSLA 2IOCA 3P5JA 4M42A 3ULDA 3OYIA 4OPKA 2F8EX 1RT4B 2XCAA 4YFUA 5KGXA 4HHTA 3ITHA 1C0UA 3TARA 1S6QA 3GIIA 3L3VA 3KKSA 1SUQB 3DOKB 4WYWA 2KZZA 4JUZA 4DTOA 3OYEA 1S4FA 1C0MA 1S5JA 3DLBA 4J9PA 4I7FA 1QHTA 1SKRA 2B5JB 3RMCA 4K8XA 4AHCA 2XO7A 4ICLB 4ED1A 3QEWA 3KLEB 4DTSA 1W25A 1T03A 4Y2CA 1RCHA 1BQMA 3AVKA 2YKNA 3OYKA 1KSPA 3RWUA 4FYDA 4RW8B 1RTHB 3SQ4A 3TANA 4OJRA 2C2DA 4NLVA 2UVVA 3RRGA 3FDSA 4O3NA 1KVCA 3RBDA 4KBIA 3SZ2A 4ZTFA 4NYNA 3I5BA 1GX5A 3CO9A 4O3SA 2FBXA 3SQ1A 4K4VA 2VA3A 2W7PA 3KLIB 4OLAA 4Z4CA 3VA0A 4K4WA 4LQ3A 3AVLA 5HLFB 5HRRA 2KFZA 1RDBA 4LQ9A 4FJIA 3THVA 2IBKA 4H4OB 3VQCA 1WSEA 5J2NB 3OHBA 1RTJB 1RBUA 1WAFA 3FFIA 3V4IA 1HNIB 3DRPA 1JLCA 2QV6A 4FLVA 3HXMA 3KK2B 2YNFB 3ZT1A 3NH0A 2AWZA 1RT1A 4CJ5A 4W5NA 3I0SB 4KI6A 5I42B 4Q44A 4DU4A 2E9TA 2O4GA 3TAMA 2G8UA 1BCMA 2FJWA 2HB5A 1VK0A 3GIJA 2D3UA 3KLFA 3MR2A 4JRQA 3V1QA 4NCGB 2A1RA 3BQ0A 4YP3A 3C6TB 4HTUA 2X6SA 1R0AA 4M95A 2V0NA 3VQSA 4M3XA 5DG9A 3SPYA 2D7SA 1KLMB 3KK1B 4LSNA 3TAGA 3V1RA 5KFOA 3WNEA 2OZMA 1S6PA 4MFBB 1N6QA 3MXIA 3I0RB 3NDKA 4KREA 3DLKB 3HHKA 4KHRA 1VSFA 3AA2A 3F73A 1JLAA 5KFTA 3CFRA 3MTKA 2JEIA 4KV8B 2W9BB 4FJMA 2DFFA 3RB6A 4RW7B 1KHVA 3NHGA 1LAWA 4FJ7A 4CJUA 3NGIA 3T5JA 4Q45A 4ECSA 1KRPA 4RW4A 4IRCA 1C1BB 4I2QB 3FQLA 4FJLA 3PVXA 1S1TB 3CIZA 4URSA 4DTMA 1NJXA 2OPSA 5KFMA 4KHNA 2AQ4A 5L9XA 4B9MA 1VSEA 2CKWA 1G15A 2B6AB 4CEAA 3KK3A 1TV6B 3V6JA 2D0BA 2FVRA 3V9UA 1LWEB 5KFXA 3QETA 3V9WA 2QKKA 4AILC 1JXBA 4K8ZA 4HKQA 4DG1A 3VQDA 3O3FA 2HNYB 1S9EB 2ZQBA 4KSEB 3K5MA 3K57A 3MFIA 4CEOA 4CF9A 3IG1A 1SV5B 1EP4A 3OYLA 1ZBUA 4IDKA 3OYFA 1S1VB 3H2LA 2XGQA 4I2PA 4CGGA 1Q9YA 5KI6A 4IFYA 2IC3A 1ASUA 4QWDA 4FVMA 3GIMA 3BSAA 5KT6A 5L1LA 4ELTA 2WRMA 3G6XA 4KFBB 3S3MA 5FDLA 3PJXA 1ZYQA 1QAIA 1TAUA 1RDCA 4JLHA 4K4SA 5KFCA 3SCXA 4R8UB 5KGWA 5KT4A 4E7IA 2XHBA 2HMIB 3QLHB 2HNDA 5KFNA 3EZ5A 4O44B 3OS0A 4FLXA 4CF1A 4FLZA 4KTZA 1ZBHA 2FJXA 4E1NA 3LZJA 5F8LA 4Y1DA 1SKWA 4DQRA 1RT4A 4JS5A 1XC9A 3QIPA 4ZPBA 1DLOB 3D28A 3ZT0A 2PZSA 4FK0A 2HWHA 3T3FA 1U48A 1J53A 2HHWA 3DM2B 1LWCB 1SUQA 3DOKA 4J2AA 1C0UB 1RT5B 1KTQA 1QS4A 3TWHA 4FJNA 1VSMA 2PY5A 2B5JA 4CEDA 3SQ0A 4K50A 4ICLA 3KLEA 1JXEA 3PV8A 1Z4UA 4Y34A 2BDPA 2BR0A 3HM9A 5T14A 1J9AA 3G10A 4RW8A 3ISND 3M8PB 4KHWA 3MR6A 2OYQA 3CJ0A 4Z4EA 1OS5A 4DS4A 3U3YA 4ZP8A 3RAQA 3OLBA 5HP1A 3U3GA 1GOAA 4ZVFA 4ED2A 4NCAA 2W8KA 1A5VA 1JLGB 3H4BA 3KLIA 2W7OA 3QZ8A 4KHYA 2WTFA 3TABA 1LAVA 1KVAA 3C94A 3MEDB 1VSIA 2DFHA 3O3GA 4H4OA 3VA3A 4EZ6A 5J2NA 1RTJA 3CJ2A 3BDPA 1RDAA 1U45A 1HNIA 3ZCMA 4I9QA 3LAKA 5KFHA 3NGDA 1J5OA 4DSJA 4IOBA 1RBVA 3EYZA 4CGJA 4DL6A 2RDJA 2O5DA 2P1JA 3KK2A 3DRPB 2R2UA 1BGXT 2YNFA 3FQKA 4NLDA 4BE0A 3RBEA 4HUGA 4B08A 4ZPCA 4DTXA 5KG5A 3I0SA 2HHVA 5I42A 4CFBA 3UDLA 5EWEA 5CYMB 2FVSA 4NLUA 2QK9A 5DQGA 5C5JA 1L3SA 1BCOA 1HYSB 3CDEA 4ED7A 3E01B 1QUVA 2BRLA 4AHTA 4BE1A 4FS1A 4NCGA 4ZPDA 1YTUA 4IRKA 4PWDB 4WE1B 4B8AB 1S1WB 3C6TA 3OYDA 2R7YA 3KHLA 4K4ZA 1N56A 1KLMA 3KK1A 3H4DA 3G6YA 1BI4B
chains in the Genus database with same CATH superfamily
2IHR1 1QLNA 1D5AA 3AAPA 4MT1A 2QXFA 4E1JA 4RNMA 5KOWA 4W90B 1TKXA 5CZXA 3DLKA 3AVMA 2B4OA 3DHXA 1S10A 1EJ7L 5BYSA 3A4TA 1LV5A 4A48A 1YIJS 5BN8A 3OSPA 4G3IA 4X65F 1S22A 3D67A 1WSJA 1ELOA 4NE9C 1TKZA 2FGOA 4JI2K 1HQUA 4LRBA 3BF4A 4DX6A 3HZ6A 5HMZA 2EFQA 1PYTA 4QR2A 2BE7D 3DLLQ 1AFJA 3UO0A 2AX1A 2ITGA 2DH9A 1FHTA 5ETTA 1SJFA 2C3MA 2NSCA 4JV1A 4GMKA 1YWXA 3CCJS 4FNHA 1FKOB 3DOMA 4ZCKA 2VU5A 1FX4A 4ZJQA 5IFMA 3M30B 5HRPA 2R9LA 3JS9A 3TAQA 1SH2A 5K8PA 3MCSA 2Q3SA 3KVGA 3MUVP 4DU8A 4QIEA 1CS4B 4KHQA 3KJFB 3OT9A 1NKEA 1AB8A 3Q0AA 3N9UC 2O01C 3TZYA 2VG7B 2VWBA 5KFYA 1RHKB 3OYMA 4DV0K 3LP0B 2WSCC 1TQLA 3ILLA 5ETRA 4B1XB 1JKHB 1NK5A 2IC3B 1IWGA 4DR3J 3VQEA 3NS5A 4E7JA 1EX8A 3K5OA 1KVKA 3ID6A 5C25B 1EQ0A 1E4GT 5JVHQ 2V63A 1UOCA 2MB0B 3GDQA 5GIOA 1MWQA 5J1EB 3MF5A 3UN5A 3NMRA 2VYPA 4U96A 2GELA 1VC6A 4OYOA 2HFUA 4IOAL 1CJVA 2D1KA 4KHMA 2B9EA 3CJRA 3DM2A 3QIPB 1LWCA 5HK4A 1Q8BA 3NVMA 1RT5A 3G6EN 5AXMA 1DURA 4ZPWR 2M4MA 4I9LA 3OPKA 4RU2A 2XULA 2OMLA 3L0QA 3K2PA 3SSQA 2W4CA 3AA8A 4O0NA 5KFZA 3C14B 3IN5A 3HVAA 4USUA 2HOEA 1FEEA 3I87A 1AZSA 5ETKA 1O5JA 4CP5A 2O8BA 3QMQA 4LF8K 3WIVA 2PMHA 3FZMA 3NOCA 4DV6J 4FP9A 5HP1B 2QA1A 1RWMB 2LP4A 1T9VA 5CZ1A 1B70B 3H1QA 1OQ3A 2HS4A 4MMOA 4Q8EA 3MEDA 4YR2A 5L1KA 4KGXB 3VF2A 4BR9A 2W9CB 3TJ8A 1JJCB 3J8AA 4M41A 3OUYB 3R5JB 2HW3A 4P72A 2CNKB 1BQNB 1U8WA 2UXBF 1YZ6A 2CQDA 2YQ1A 2W01A 3MCOA 3M2UB 5KFBA 1X0PA 2N3OA 1YXQA 3RBXA 2GW8A 3CFPA 4OZ1A 4XIUA 4CF8A 2ZH5A 2F4FA 1YJRA 4DPTA 1NK0A 3E01A 2ZBIA 3D1OA 4DN0A 1ATRA 1B9DA 1WNSA 3AAWB 5LL6d 2A40A 4WE1A 2EWSA 3KUGA 2FBVA 1RAOA 1PGZA 4USJC 1TGOA 5J1NA 2CQ4A 2G8HA 2AIRB 1ZXOA 2ADBA 3OBIA 4CO4A 1ATNA 3TSUA 4PXEA 4DXLA 3W5XA 4RW9B 3EDQB 3ENAA 2DR8A 2DNNA 2Z1IA 4HVJA 1TKXB 3LDNA 4CNYA 2E1ZA 1VQ4N 3FFKB 3GV5B 5AZIB 3NF9A 3HVTA 1VQ7S 1Q86O 1JLQA 2GFFA 4K0KK 4MIAA 1TKZB 4CFDA 5D0GA 1HQUB 2MKCA 2RD5C 5IT9Y 4I6MB 2H9ZA 1NLVA 3CMAN 4GO5X 3J7YU 2BJ3A 2LKZA 4X4PA 2ZWPA 5F3ZA 3M8SA 3QFUA 2ATQA 1H2UX 1YTYA 1Q82T 2J4RA 5C12A 1JMTA 4IG3B 4EWTA 1WUAA 1H72C 1V3ZA 5K14B 3QJLA 3E8OA 1RTDA 4RBTA 4KIAA 2PYLA 3P6YC 1QQMA 3KLGA 3IRXA 1BOTO 3QEIA 4HTLA 2HHHF 2Q66A 4WPAA 3PM9A 3GJSB 3AXKA 5CE3A 2L9NA 1WAJA 2DY4A 2EFGA 2E29A 4TN2A 2AEJA 1K1SA 2DNLA 4DV4J 1C1CA 3CC2N 1WHWA 5LL6Z 5AQVA 1BIUA 1RWPB 3Q22A 1RT2B 4O3OA 2U1AA 1KAXA 1JIHA 2JFDA 3QT5A 2CNNB 1XR7A 3HMJG 4NLRA 1N34J 3AVHA 2O8EB 1WELA 1XNQK 4HHJA 4PHTX 1Z2ZA 4CI6A 5B08A 3HFKA 4HUFA 1EWRA 2JVOA 3QJPA 4G1QA 3GCWP 1HNZF 2RN2A 4CJFA 1KFDA 4KAIA 3DRRB 3SMZA 4DTPA 1PAEX 5HBMB 4DR7J 2GGPA 5MLCV 4UUXA 3UKUA 4CZIA 5GINA 3PR4A 3VQ4A 1IKXA 1YJTA 2RSQA 3F56A 4X4UA 5DM7L 1VQYA 3AD8C 1NB2A 3L4BC 4IG0B 2HHTA 1YBTA 2DNKA 2FHJA 3ZZ0A 3F5TA 1MA9B 2H1YA 4A8YA 5AZJB 4CHPA 3BSOA 1VBKA 4N56A 4GC7A 1JXVA 3FSYA 3T1YF 2X3GA 5JJBA 1ZPVA 5U47A 2Y8WA 4S0MA 4BR7A 4ZP7A 2ZC4A 1TFWA 2CJQA 1N5VA 3WNFA 3CJSA 1P9YA 3ETOA 2J0SD 2JEGA 2DISA 1GOBA 4BR0A 3QNOA 2QI2A 2FBYA 5CY4A 2G2OA 3VQQA 3E9LA 3PIOQ 2FZKB 3OL8A 3QDKA 2BW7A 1Q8LA 3LDSA 3HKZD 2Q97A 5A2QY 4DX8H 4ZVQB 3TX8A 3A3OB 4USHA 5TKWA 2FLNA 1FD8A 3NBPA 1PYSB 1S1UB 4B3SJ 3NNHA 5KTQA 3MCNA 2MQPA 4CQ1A 4CGDA 4OZ3A 2AX0A 2QT7A 5FRNA 3NFAA 4CI0B 2VWJA 3KFWX 2VPYB 3HPGA 3IBFB 2CFXA 4ZPAA 2ITMA 3V4MA 2DD8S 2I6WA 3DRSB 4PKDB 3TI0A 3MXHP 3PEJA 1VRUA 2VBYA 2DNRA 1M0SA 4DSKA 3EPGA 4JI0J 3QBWA 4KH0B 2XWYA 1FDAA 2Y1JA 3SCJE 2I0XA 2X78A 3I96A 5DDQC 3HVTB 5DRKA 3VEOA 1GTEA 5IC6B 1B4SA 4WFZA 4B8CA 2I1RA 4PAAA 5JVHL 3K8VA 1UJ4A 4ZITA 3IBCB 1D3WA 1FRMA 2ZH3A 3ENBA 4CJ3A 3DOLB 1N48A 1F5CA 1YZ7A 4DOZA 3AOAA 4NLGA 4IH6A 1T9TA 3UVJB 2DTJA 2XS7A 3KKFA 4CO3A 2CPDA 2I5JA 1MWKA 3MEEB 1U2RA 3MD3A 3W9IA 2F65A 1HBOB 1IJJA 1CZ9A 3DYAA 4O3PA 2Z1GA 4W5RA 1BIZA 3ZO7A 5DGAA 2GO9A 1UJ6A 2IDOA 1BY9A 2XMKA 5C24B 4ES2A 1RU2A 4B3TJ 5AR0A 4OYMA 2PC6A 3LGMA 3WX8A 4CIFA 5IC4B 1LW0A 1O8BA 1YJWS 2FHMA 1EKEA 3W7BA 4EMDA 2XG8A 2UV8A 1TK8A 5ETNA 1DY3A 4O4GB 1DTQA 1CSJA 3IGVA 1WEZA 4FJKA 3AARA 3GYNA 1FTRA 3WZ0A 3PW0A 1HBUA 1D4XA 1O1WA 2PAVA 3P1GA 1LNQA 4CF2A 3TZWA 5IT4A 2DR9A 1F5BA 4MDAA 1SIWB 4YOVA 1URNA 3ATUA 2MKIA 4Z0UA 1X4GA 3M9NB 3KWIA 3SBTA 2Q36A 3J7ZO 2V2KA 4I6AA 2WONA 5AE2A 3L2RA 3C6UA 3NGSA 4G9ZA 2C2RA 2QLBB 4DV5J 2ZHBA 4RUHA 4KJIA 4HCBA 2UYTA 3GV7B 4C8ZA 1IBMF 4AT1B 1N8RO 3ENWA 4X64J 2RVJA 3KTQA 4G1IA 2CQGA 1EETA 4M94A 4RZRA 3GYXB 4PG7A 5J2PA 5B0CA 4YDDB 3GCXP 1S72S 3EGVA 4HDGA 2YKAA 4DZDA 3OTCA 4ZLPA 2OD4A 5H1SQ 4F2RA 2F8SA 1Y3KA 4J9UE 4NRTA 2KG1A 1S9GB 1NGJA 5A6PA 1LWFA 1IKXB 4W92B 2HQGA 3P5BP 3T1AA 1RGIA 3JTOA 4WFBQ 4UT4A 2P9GA 3HX9A 3Q2TC 1YHQS 3PLAA 4BHQA 1XI1A 2ASMA 4CZEA 4CHQA 1Z26A 3VPZA 3LWMA 1NAQA 3PFOA 5C2GA 4BWMA 2ZJPQ 3ZSVA 2WB4A 5DO2A 3CCVN 1UVLA 1KD1O 3P8BB 5AQYA 2JC1A 2W41A 4FJJA 3IWXA 3AVJA 4OHYA 3MGJA 4X62J 3L2QA 1TR0A 3M6WA 2GWJA 4QQBA 2E2NA 4DSIA 3DNCA 1X4HA 1G4CA 1YJ9S 3KHRA 1NNDA 2V52B 3C16A 2XY7A 3PYEA 5EXWA 4WCEL 1XHXA 2RUSA 5DG8A 2VONA 2ZE2A 1HYVA 3O9TA 2ZBCA 4F3TA 3HFVA 1M5KC 4EP4A 3M8QA 3M8WA 2OPQB 2PSZA 2AGPA 3X3UA 5E2QA 1P8GA 2V7YA 5KT7A 1N88A 3KK7A 4JK7A 2R4FA 4QJVA 3UPFA 4RW6B 4ED3A 4FM2A 4YEAA 3ZTPA 2MHNA 2VG5A 1X1PA 1SQFA 4LT6A 4JI6J 2HGMA 3JQKA 3OJUA 3ZSRA 2W24A 5F8NA 4YY3F 2E2OA 5DG7A 1VQPS 2MZTA 2HVIA 3V81A 1OQ6A 1WG5A 4NZ0A 1HNWK 3U6FA 4FNIA 2ZWOA 4JEPA 5LM7E 4KAZA 4DTRA 1HI8A 4CGHA 2C3YA 5AE3A 4DN9A 4YQWA 4F4XA 2WHOA 3TA0A 1T3NA 2AW0A 4M3TA 3VAIA 3W61A 4PUOA 1QTNB 5KQDA 3VCDA 2B4VA 3W64A 1VQ9N 1Q78A 1ZTWA 1WLJA 4Z4GA 1HPMA 5HROB 4FF3A 2NRRA 3DYAB 3CVKA 4J9MA 2LDYA 2WW4A 3UQSA 3NF7A 2KDOA 4JYAK 3EM1A 2MKHA 1TTHB 5AQSA 3W2WA 2P9IA 2ZITA 4PQUA 3NF8A 3AY9A 1JCGA 4RBUA 5LXRA 5J2MB 2B4UA 3VQPA 1WC5A 2J76E 4OX9F 3O6WA 3NGZA 2RMLA 3O8WA 3P96A 3M5RA 1M1KO 2LU2A 3UR0A 1NK9A 4FVCA 2FSKA 4QS7A 3JB9k 2KTQA 4LF8F 3DI6A 4ZPVR 2MLZA 4GV3A 2NCKL 4GVLA 5EX0A 4ZA1A 3SUPA 2E1YA 2V8GA 3EVMA 1HLWA 3QESA 3ZEUA 2XLJA 4X2BA 1UKUA 1IG9A 2WONB 1VRTA 1JLBB 3O44A 5FLXY 3F44A 3LPEA 4PYAA 4NEZA 3QWPA 4TY8B 2UVRA 4ZJOA 1M5PC 4CW7B 2HWTA 4FM0A 4HTJA 2VQFF 1TK0A 3OYNA 1FRJA 1EETB 5KPRA 2ZBPA 2C3UA 4PABA 1C6VA 1U49A 3HJVA 5KFDA 4MQ3A 3M3ZA 2C2EA 2BGGA 2F40A 3T5HA 2E1PA 4PKHA 2Z2LA 1IH7A 1XMQK 3TX0A 1VQ6S 2OO4A 4MLHA 4LF4J 4I7FB 1DFDA 2B8QA 2QYGA 3JYTA 2D5RA 2AF6A 1P8ZA 2I38A 4PG4A 3VAFA 2CDRB 5K8NA 2E6LA 2DNZA 4TU7A 3KYLA 3O6QA 3P45B 2F8MA 2YKNB 3RMAA 1DKGD 3MM8B 4CHOA 1IKWA 4OIXA 4DV3J 4RL1A 3CERA 4LFBF 2YX7A 2UUBK 5AQXA 5I3UA 4AL6A 4K4UA 3G4SN 5KG6A 2QWOA 5CYJA 5CXTA 3AVAA 5HLFA 3C16B 2P9LB 1QM9A 3H8YA 5CHCB 1S0OA 3K5LA 4DR2J 1CLQA 3UCGA 1K9MT 4UW2A 1SCJB 3I56S 1ROFA 4C23A 3AB2B 4EIAA 5F8IA 3V4IB 4K4YA 3NEKA 3VN5A 4DQPA 2E1CA 4NO7A 1JNZB 4DTNA 3LWLA 3OY9A 3D2EA 1ZH5A 1IKYA 4YR0A 1WKJA 3MM7A 3CCRS 2ILZA 3MN6A 5KQ8A 2R8GA 5L1JA 4QU6A 1Y7PA 3LZIA 2LECA 1Q8KA 4DR1J 3V1OA 5JS2A 1J5EK 2ROGA 3H25A 2KN4A 5GMDA 1G3OA 2Z56B 4B3RJ 1ZAVA 1RLCL 1F9EB 4YDUA 1NRKA 1NJZA 5CYQA 1R0AB 1S48A 2V51B 4NL5A 2KU7A 2P9CA 4DV7F 3CG7A 3SK3A 2X51A 2ZGYA 4XH1A 4CZMA 4LF5J 1NGGA 3F2KA 5ETOA 2WAQD 3SUNA 3J81Y 1O51A 4IQMA 2V2VA 3WUHA 1HNVA 2FTRA 1T3OA 4URQU 4KQZA 2XY6A 2DB1A 3DGPB 3IFEA 3BR9A 2H4WB 3PZPA 1RAIB 3Q8SB 3AT1B 1DRZA 2ZGZA 2OP5A 5LMNK 1NDLA 1WJ9A 3H6EA 1R8HA 4GMJB 1X60A 2OPSB 2FZGB 1SC6A 2E7XA 3MD1A 3MX2A 2P9IB 2QLJB 3T1HF 4H4MA 1Y9OA 3M2RB 1XR5A 3VR1A 1IBLF 2AJQA 4WFBL 4R0EA 5LMUJ 3V6HA 4YORA 2AGQA 5D4NA 2P51A 3AVIA 1U2VB 3KD5E 3HHDA 4Q0BA 2ZJPL 2EBGA 1EP4B 2HAFA 3D2FB 3CCLN 2K2PA 5KFKA 5LSOA 2BKPA 4OHWA 4ER8A 3B6BA 4I2PB 4WU2A 1C0TA 3Q8VA 1N5YA 1H1VA 3R5DA 4DR4K 3BQ2A 1YLXA 3LP1A 5FDLB 3V2UC 1X5SA 3PJWA 5F8GA 1QD1A 1YVUA 4MIBA 1IKVA 4LF6K 4AUKA 3AVCA 1KTVA 3W3SA 1QZ6A 4A8SA 2C22A 4J9NA 4H0VB 2IOCA 4CTAA 3P5JA 4BC5A 1F1BB 2E7VA 5AQZA 5GMEA 3ZFVA 2KRRA 4FYXB 2BACA 2IRYA 2ZEJA 4JI5F 2E5GA 3KKSA 2BYCA 1JJ2R 2KZZA 3AD9C 1HR0K 1S4FA 1WWHA 5H9FJ 1C0MA 3R9PA 2FGCA 2B5JB 2IDLA 4DR6K 1T03A 2P9NA 1VDHA 1BQMA 4GKKK 1IJEB 1EKSA 4AM6A 3RGIA 4RW8B 2HK3A 3TANA 5D0HA 1S0VA 1JK9B 4ZVPB 2C2DA 1EZZB 3THXA 1N0VC 2ACMA 2PFUA 1NSAA 1FD2A 1RHUB 4O3SA 4FWMA 3G71S 1RBAA 5BYRA 1A6LA 2XS2A 3AJDA 5H9EK 4OZNA 2FBXA 3TO8A 1PC4A 3VA0A 3J7AP 4U8VA 1QY7A 5HLFB 5HRRA 3A8EA 3K0JA 1RDBA 2PD1A 2MQNA 1JJHA 5BRFA 4H4OB 1WSEA 2IA0A 4LF7J 1UPPA 4DHYA 2E5IA 1CJKA 1H0HB 1HNIB 3CJKB 3TA2A 5AQUA 2LVWA 2XO6A 5L39A 4CLKA 1XMOF 2AWZA 4W5NA 4Q44A 3Q89A 2E9TA 2FJWA 5BR8J 1NWKA 3GIJA 1N32K 3KLFA 2MGZA 3MR2A 1TL4A 3NVKA 3V1QA 2A1RA 3BQ0A 2RILA 3W60A 4YP3A 2X6SA 2EVZA 2FJAB 1KLMB 3TAGA 2K7KA 3WNEA 2OZMA 4M5NA 1NJIT 4Z7CA 4GV6A 3I82A 2LXFA 1JLAA 3TUJC 3CFRA 1KOHA 2JVRA 3MTKA 1RAEB 2ZZTA 2W9BB 2BE9B 2FZCB 1PYOB 1H98A 2DEJA 4OHXA 3LM9A 4FJMA 1S3XA 4WTYA 1VQ5N 1KHVA 3ZLJA 1IXKA 2KJWA 2CJYB 5LSRA 3VGKA 3WXMB 1KC8O 4FO0A 4CJUA 1BMQB 4NXNK 2GVZA 4RW4A 3BR8A 1GFWB 4CLZA 4I2QB 3FQLA 3PVXA 4DTMA 3VAGA 2AQ4A 2LXUA 2H54B 4B9MA 3N4QA 2CPHA 2CKWA 4F67A 1G15A 2JZ5A 4CEAA 3KK3A 3PEHA 1NH7A 3AB4B 3LGNA 1UVMA 4MO4A 3V9WA 4L76A 2HLTA 1CLFA 4F3MA 2R7QA 4CLTA 3O3FA 3FGVA 3OFEA 4KSEB 4O8KA 2CH5A 3WXLA 2KYZA 4CEOA 3SSRA 4CF9A 3PYGA 1SV5B 1DJ0A 2VOPA 3UDCA 2YX6A 2ZWHA 1F6TA 2PBDA 3G6ES 2G13A 1P90A 4W98A 4I6WA 4ISFA 4PZVA 1Q9YA 4Y2MA 2HVZA 4LF2A 1QVGM 4CO1A 3G6XA 5A0YA 4KFBB 4ZKAA 4MLEA 2VD3A 2MZQA 2WB1D 4F4AA 1TAUA 4FXVA 4DV6F 3SCXA 5KFCA 3ET6A 2WW8A 5KGWA 5AQMA 4KY3A 4E7IA 2XHBA 3BZKA 3F41A 2EFVA 2HNDA 2R42A 4CF1A 1Q81T 4FLZA 3FBCA 1H2TZ 3CCEN 8RUCA 4JS5A 3Q23A 1B7FA 3EUNA 2P9PA 3T9NA 2HWHA 1X4EA 2HHWA 4JBCA 4J2AA 1KTQA 1VJWA 3KUHA 2FPHX 2MZRA 1KR4A 4K50A 1JXEA 3SCKE 2JL9A 3KG4A 1Z4UA 4Y34A 2R7WA 1DBDA 3TWZA 4Y2KA 4DUYK 3ISND 2MTLA 2HEKA 3IM8A 3W0LA 4Z4EA 2WSFC 4ZP8A 3OLBA 4H0PA 1E3MA 3VAHA 4KRWA 4C0BA 4ED2A 1K73O 1UETA 2IRUA 1JLGB 3H4BA 3LUYA 2MKYA 2LA4A 1RJJA 2PFFB 5A6WA 4GNIA 4KHYA 4MKVA 2QMUB 3GJRB 1DQ9A 3R5GA 5BPLA 4FKYA 3H3OB 2VF3A 3N79A 4CLSA 4P7TA 4IDHA 2AEFA 4BRKA 3BDPA 5GAEU 3ZTRA 3GG0A 5IV3A 4FZVA 2IDEA 2O8FB 4IOBA 1RBVA 1WHYA 2DVIA 2F4VK 5LOQA 1VQ4S 3CPEA 4GY2B 4LFAK 4ZLJA 4U8YA 1CEZA 3UCUP 4DTXA 4CJ7A 4CFBA 4DPYA 1OY8A 1CC7A 5CYMB 2EXUA 4OYBA 4LBPA 1HD1A 2JHEA 1DARA 1BCOA 4ED7A 3CC7N 4BE1A 4M5JA 4NCGA 4ZPDA 1YTUA 2W2QP 5BJRA 4PWDB 2GIFA 4B8AB 3CMAS 3CD7A 3C6TA 1UFWA 3KHLA 1N36K 2HKEA 4OI0A 1T95A 1KDNA 2DEIA 2H51B 4A4JA 2KFYA 5C2DA 3IDHA 1YGYA 3C7NA 1HNXK 4O5FA 1P1TA 2DIVA 3BBFA 1FKAF 1WC6A 2RQMA 4E89A 3O4QA 3QSYB 3PIPQ 1VCTA 3QATA 1PCAA 3R6MA 3SFUA 4DQIA 2BJ9A 1R6YA 4DV4F 3U4LA 2KHCA 3OYAA 4DUTA 4OI3A 1OKJA 2J0QD 4FJ8A 3EWGA 3GONA 3AQOA 3CM6A 1QQNA 1L3KA 5EUHA 5KG7A 2E1MC 1ZOTA 3UDEA 5L38A 3P31A 3CC2S 4QZVB 1N34F 2GA7A 3TP2A 1V4SA 4J2DA 3TVZA 4CDIA 1O0PA 2FXUA 3LP2B 1LWEA 3TJAA 1D9DA 3MCMA 2OHDA 2BMBA 1CZBA 2HNYA 2QRRA 3QYYA 5KFUA 2GCFA 3J80U 1YX2A 5ETSA 4ED8A 1Q5VA 3B8AX 2J6SA 5FJ4A 5DQIA 3GLJA 1Z2LA 4CIGA 3T5KA 3IAYA 2O8DA 3POTA 2XEXA 4B9QA 3ZETA 1A7GE 2LQ8A 4IFEA 5KPZA 1HWKA 3GJTB 1PILA 1GLJO 2Q1LA 1F3VA 2V9KA 1URRA 3I55N 4USMA 1T6CA 4TYAA 2IMWP 4LREA 4GVBB 4R8UA 3QO9B 1RWKB 3BQ1A 3I6PA 2BVZA 2HBJA 4V19X 2YNHB 1B0VA 1WI6A 1OMSA 2QIFA 2V8DA 2XY5A 2CRLA 3LPYA 4TNOA 2HHPA 4CHYA 4AQYF 2GVDB 4DF8A 1VQLN 2VA2A 4P2XA 3CXCM 4JI3K 1Q82O 4EYIB 4MKAA 1XNRK 2K06A 2FQQB 4MJKA 2YHXA 1TL7B 1HBNA 4M63A 3VAKA 2DHAA 2LMIA 4FLWA 3SYZA 2CQIA 3ILJA 3LPUA 5ETQA 2HHHJ 2P9SA 1WSHA 2DNMA 4X4OA 2E7WA 3H46O 4BVOA 3J7YP 4CK2A 4DL0C 2BUPA 4WYLA 1WORA 3CJ9A 3PO5A 5RUBA 1NKCA 3GTYX 5IT0A 9ATCB 3UNYA 2J9DA 3OVBA 1ZM4A 1PJ7A 2D4WA 1NK8A 3MMCA 5HVFA 1W26A 3N6LA 4DQQA 1OIAA 4W5TA 4H5TA 5HQLA 4DFMA 5KG4A 4CIEA 1WB9A 3M6GA 2LLZA 1AW0A 1RA7A 3QEVA 5IQQA 4JI0F 1ZBLA 4ZVHA 1HI0P 1X4CA 3OL7A 4PWWA 2JSXA 5DLGA 2F9JA 5LMNF 2XBPA 2VBZA 5M1OA 4ZK7M 3NGYA 3EGNA 4NZ7A 2WBRA 3AFGA 1VLOA 2F9TA 1TUVA 1NGFA 4F36A 1X31C 5HRSA 1HYSA 3SXLA 2G1HA 2CH6A 2UVUA 3T41A 1U09A 2QL9B 1VSJA 5T7LA 3N5BA 1S1WA 2C2MB 2MPUA 3MAAB 2FC8A 1ZM9A 5D77A 4FJ5A 1WBBA 1NZ8A 3FZBA 3BKUA 3C65A 1BI4A 2UXCF 2RH3A 3NNAA 1RABB 2YX4A 5M1PA 4B3TF 4ILLA 4TQRA 3QNWB 5SZTA 3KLHB 4ZTJA 5IWAF 4F3OA 4LFCK 4H0TB 3C7NB 2OA8A 4FYYB 1RCOB 4DF4A 3AOCA 2MJNA 3VQ9A 3LPTA 4IEIA 4Q5VA 3DLGB 2ZM6J 1X4FA 1HBMB 4YB6A 5GADI 4B9LA 1NGHA 3CO0P 5D0EA 4UY8T 4ZDNA 1WBDA 3PNIA 4X66K 1F5AA 1S12A 5HVHA 3M1VA 4OI4A 4DFKA 3ZSWA 4CFCA 3B4MA 3CIPA 2OPRA 4FLTA 4ZS6A 3VALA 4HWIA 2VCPA 1TK5A 1RXOB 3PHEA 5GAHU 1QQCA 1YSJA 1IM6A 3TQEA 1MN9A 2EWHA 3MEGA 3RR7A 2F7TA 4DV5F 3NWGA 1GMWD 1HPZA 1EHWA 2LU1A 1HMVB 4ALZA 2HG4A 2KT2A 2PDAA 2GIQA 3A5LC 2CJAA 4FVUA 2QWPA 2IVMA 1HR0F 1KONA 3N5FA 4BQZA 5K8MA 1K0TA 3IRWP 4Z7YA 4YR3A 4DCPB 1U1OA 2V50A 3L3CA 3ZETB 4TSXA 4OL8A 5A8WA 1RT6A 1RTIA 3HVRA 1RT7B 3E9PA 4YS2A 3PX6A 4IO8A 3FVYA 3ZNJ1 2NSBA 4BDYA 3U1LA 4BACA 3PXGa 1IR2A 1UZHA 3W9JA 1RBRA 4J9RA 3CD6N 4BDPA 2J9DE 4JNEA 4XH4A 1FXDA 3THTA 5B8HA 5CZ2A 3NAHA 5BPMA 3TNVA 2XSJA 4YN3B 4DQSA 1NK6A 3Q8PB 1X3NA 1KQFB 4RTFD 2AJ1A 4NYPA 4F0MA 2BBEA 4KTQA 3CCVS 4U67Q 2G0IA 1EXQA 3SAFA 2ZUGA 2G2ZA 5F8JA 1S59A 5JLFA 2DNPA 4JV5F 3WQPA 8ATCB 3RMBA 5HOOA 4DFJA 3VQ8A 1F60B 3JAMY 5C42A 5KT2A 3IS9A 2H5JB 2NZCA 1EX4A 2I7PA 2BE2A 4QWBA 4DR7K 2P6TA 2X74A 5TKYA 2CNOB 5EWFA 2UUAK 3TUPA 4WFAL 3CDWA 5M1NA 4WK3A 3EMTA 4DSEA 4QIGA 2G4BA 1ATSA 4OPAA 2ACYA 4H5RA 2UUTA 4CH1A 1QSSA 1NMEB 4DV2K 3QPIA 5AQPA 5KRTA 3HDSA 3OBWA 4AL5A 2KJVA 1NMNA 3KLVA 3PIPL 2XZTB 4IOCQ 3MAHA 2YPYA 5KG1A 4UOCA 3PX0A 1RBLA 2OAUA 3BH6B 3OTDA 2P5OA 4BR4A 4FJGA 3CE8A 3OYBA 3M6XA 2PO4A 3HT0A 2NRHA 2YWHA 3P5TL 5K9FA 1RCXB 1Z6RA 4XDDA 3RB4A 3SQGB 2GTDA 2HBKA 1WOSA 3HSTB 2R2RA 1NEEA 3L09A 2QEXN 2KI2A 1N5QA 3ZSZA 3CDUA 3V5RA 4OYWA 3VV2B 1UZDA 1ZBSA 4F26A 2IVPA 1MWZA 1N33F 3MAQA 1RWNB 5AQQA 4JKHA 3DDIA 3MM9B 3GIKA 4DEZA 3OYJA 4WP3A 1UVJA 3QJJA 3KD1E 1KAZA 2M3DA 4F50A 3J7AN 5KFWA 2V8VA 3ZT4A 4CESA 1Y00A 3MX5A 3PY8A 2ZD1A 1U1LA 4X4QA 1VHFA 4DFPA 4USKA 1JLEA 2HBLA 4B3MK 4FOEA 2VASA 3BYRA 1Y0HA 3ILIA 2HNZA 1L3TA 1TL3A 3UD3P 3ZTQA 4CJ4A 4ZOSA 4H5NA 4KKOA 1UA0A 4QS8A 5HRNA 1VC5A 2O4IA 3TVKA 1TL1A 1U1QA 2R2SA 1C2PA 3W1YC 1MG7A 3TOQA 1A9NB 1YJVA 4DUZF 1HQEB 1PG5B 4LF9K 1RHMB 2BOAA 2VFUA 4KE5A 1UVIA 5KT3A 2PN6A 2G8FA 4GRSA 3BN4A 2M8DB 1GX6A 3DLEB 3HKWA 2EK6A 2YV0X 4AHVA 3MK6A 5KFSA 2ILYA 2Z8QA 4NOHA 4CJEA 3IGNA 3LDQA 2LQBA 5E3PA 3CSKA 4OX7A 3EX7B 2HHXA 3D6FB 2G8IA 3W66A 4NI2A 1NPKA 4CLWA 3BF3A 2NRXA 4ID5A 4OPJA 2JOQA 2AJ2A 2HBZB 4UTGA 2AD9A 3HO1A 4DV0J 1QHAA 1DT9A 4YY3J 3C15A 4CEQA 2F63A 4NMLA 3EZOA 2LQ9A 4M5DA 1QE1A 4J9LA 2QGFB 1UVKA 2DNOA 3HF5A 4MYUA 3J7A1 2HF4A 4DCJB 5D4OA 2KXFA 1MU2B 5D3GB 1N4LA 4B1YB 2UXDK 2BQ3A 1S4EA 4B1VA 4Q43A 2QTDA 4ZHRA 2VPWB 3OL9A 1HHSA 3MWPA 1SAZA 5AQTA 4R5PB 3WEEA 2W42A 1I3OB 1T05B 4ELVA 1HA1A 4HT5A 4DLEA 3VGTA 1T11A 1B64A 4CLFA 4Y1CA 3R7NB 2YNIB 2HFNA 4JKAA 3SQ2A 2OEMA 2UUCF 2YKMB 4B17A 4C8MA 1IJFB 1UAXA 1UWBB 4KB7A 3H1VX 2UVWA 1SPBP 2PA3A 3W8GA 3L9ZA 2Z1HA 2IGIA 4XAKA 2GQQA 2BJ7A 4HUEA 1GTHA 5BRHA 4QWAA 2A6MA 1SZ2A 4ECTA 4X64K 4OX9J 2KKHA 4EFAC 4C4WA 3BUZB 4DHVA 4ZVSB 4CZKA 3J80O 1ITGA 3ZT3A 4C9DA 1BDGA 2DNGA 4DR2F 2NXJA 3VGUA 4QW8A 4ZMMA 3G4SS 2EHGA 4AHRA 5L8RC 2CXEA 4LD0A 2GHWA 4LF8J 3TR8A 2WCXA 3HHNB 2D3ZA 3M32A 3CJCA 2OIHA 4UY85 2HAIA 3O3LA 3V6DA 5LSLA 1NKBA 3SUOA 3GILA 1RWOB 4IR1A 2DO0A 3ZTOA 4NLWA 3B6OA 2O8CA 4PPZA 3M2VA 3MZIA 1Y10A 1UFLA 4PG6A 2L9DA 3M6VA 1EB0A 1WG1A 1KLNA 4DR1F 2IAJA 4A8XA 1R43A 3VEVA 4GKJK 4X4VA 4CJQA 4Z4HA 4KO0B 1FFWB 1WKLA 1SS6A 2VQFJ 4X62K 1RDDA 1VQNN 1RISA 2W9AA 3PSIA 2WVBA 4KPCA 1LK5A 3US5A 4EYHB 3TU5A 4HH0A 4CHNA 1SL0A 3NAEA 3CD5A 5FPDA 4DI6A 2QE5A 4N77A 2HHSA 2RQ4A 2FLLA 2VB6A 3UDVA 5H1SV 1VQON 3HSGA 3AVGA 2DR6A 2HZVA 1RYRA 2X6NA 3C6AA 2OUGA 3L4QA 4RNFA 4KHSA 3LTOA 3ENQA 2HFZA 3H7HB 1SJRA 3S7RA 3A3PB 4M5IA 3DXMA 4RBVA 2J6UA 1I5OB 2I7NA 2D41A 1RBSA 3O8MA 4ECUA 1TZ0A 3UWTA 3HHLA 4OMFG 3CCUN 3MMAA 2C42A 4OQJA 1Y3JA 4JI8K 2F9WA 4U6PA 2RDDA 4B9VA 3L6QA 2RKIA 2P9KA 3DWLA 4FLYA 4DR5K 4K0KJ 5HO4A 4XH5A 1REVB 3H5YA 4ELUA 4FLUA 1SIZA 3WC2A 4Z4IA 1T3VA 1VAZA 1GEHA 4DPOA 2COLA 3CUNA 4CGFA 1P27B 1YTAA 2NUBA 1CULA 2KL8A 3BEGB 1Q0NA 5IV4A 3K2YA 2OZSA 4IH7A 1WOOA 2IFXA 2A6AA 1K9MO 1GXLA 5F41A 5DMRA 2XSFA 4JI1K 1B9FA 2F8TA 3GFXA 3HRGA 4U67L 3CCLS 4KB1A 1BLUA 5GIPA 3SJJA 2Q6BA 2OH2A 4JI4K 1G7CB 2HF3A 5E26A 3AH6A 2XS5A 1ZAWA 2QSFA 2DNYA 1IBKF 5MLCQ 1A5XA 2J9EA 1V4TA 1Q5YA 3GG1A 4U7UD 3MM6B 3CJ3A 4OYAA 4CZJA 3ZT2A 5AQRA 3NH1A 4EBCA 1UWAA 3OFHA 2DHGA 4E7HA 3QSIA 4FF4A 4H0XB 1OWXA 1VQMN 4TLRA 3DU6A 4U7UK 2JJ4D 2YXLA 3P4IA 1NB7A 4RG8A 1UL3A 3DMJA 6FDRA 1M5OC 1HYZA 3I33A 1X0FA 1KQGB 1D8YA 4GVEA 5IT9O 5KG2A 2CQ2A 1FX2A 3LOUA 1MMLA 3WNGA 1WDDA 1S0NA 4IOCL 4ETXA 4DCHA 3S8SA 3WEEB 3FUYA 3BSCA 2DJWA 1XNQJ 2VG6B 4NXMK 3EXYA 4X4NA 2BANB 4RUAA 1LW2B 3DDNA 2V2ZA 1RT3B 3ZSOA 2WK4A 4A59A 3KJNB 3HPOA 2MY7A 2GUPA 4K7QA 4KGMA 3Q2SC 4W5QA 4H5VA 1U8SA 2EC2A 2BV3A 5J2QA 4IFVB 2YWKA 2CGJA 4O23A 2B9WA 4U95A 4ZP9A 2YNGA 3T1HJ 4CJPA 2WOMB 2YBVA 4U7CA 3MMBA 3I9V9 4CO2A 4IEEA 1UW9A 3VEYA 4E7KA 2F9DA 3IR7B 4HYKA 2J8SA 3H3NO 3OYGA 4WQ4A 1C4AA 3ITHB 4AH9A 1KFSA 1S6QB 3FNNA 1G6BA 1UEVA 1KBRA 1GAOA 3QBXA 4Q2LA 3IFRA 2GV9A 3T69A 5EOYA 3V6KA 4HACB 3M32B 4C11A 4DU3A 4J9OA 1E6VB 1V3SA 4YOWA 3GSIA 2E1AA 1RTHA 2ZDPA 1B0TA 3D4JA 1NH8A 1NO8A 3PDNA 4HDHA 2IM2A 3F0NA 3BBBA 4KI4A 4LH4A 2IS3A 1QAXA 2V8HA 3FMBA 4WXOA 4YB7A 3OXLA 3THYB 4OJ1A 4DV3K 3HYFA 3JS6A 1X5TA 3RTVA 3OR1A 2FDNA 4ETZA 3DXKA 3MECA 1WNEA 4LIRA 1HFEL 3AVBA 1OSCA 4PPDA 1MNEA 4QW9A 2ABYA 4LSLA 1D0EA 4FF2A 1JXLA 1JX4A 3D2WA 5EVZA 2OPPA 1QQOA 1Q95G 3SDEB 3TR5A 2JH3A 2B8PA 5GAGU 3D3BJ 2J5AA 4FS2A 2Q43A 1RDUA 1VQ5S 2ZJQL 4BBYA 1N0UA 3KXDA 1SQGA 3LL3A 4NRUA 1NLKL 1TKTA 3ONQA 3DXMB 4FJXA 3G71N 3O5TB 3PR5B 2CPYA 3CCZA 4FZYA 1PSDA 4L72B 3D6RA 5SUHA 4WZQA 5EX3A 5AJ3F 4EK2A 2GHVC 5A2QO 1YRXA 3IUCA 1B0PA 2NREA 2J7UA 1M90T 3WXKA 3CC4N 2R8KA 3OR2B 2HVDA 4XO0A 1N6QB 1S6OA 2QC3A 4RUCA 4B3OA 2P5VA 4PCQA 4FCYA 3L7UA 3ZX3A 1HARA 3MURP 1T44A 4ANDA 5JXSA 2JEFA 5M2RA 3KMQA 5LJWA 4H03B 2VZ9A 2KM8C 3FRYA 4OHVA 2EFPA 3EICA 3CJTA 1XMOJ 3SI8A 4B02A 2QFJA 3G8QA 1XHZA 5E33A 5ETLA 1QAJA 4K4TA 4UZBA 4DLGA 1D9AA 4ERDA 5T7BA 3A12A 2C1EB 5A8KA 1WKKA 1TVRA 2LEPA 4IZ9A 4F4KA 3L2UA 1AFIA 1Q53A 1WG4A 4NB4A 3D66A 2Z2YB 2AT1B 2YHBA 1CXUA 3MDFA 2BKNA 5G4DA 3CB4A 3AGRA 3CCES 3LQVA 3MR5A 2E2PA 3TAEA 1NJIO 3E51A 2WTUA 4DL4A 1GMVA 2NNWA 3CCQN 1RUSA 1HLUA 4DV2F 4TU8A 4C2MA 4ED0A 3BYPA 4TKTA 2IVFB 1HJRA 2Q79A 4IFYB 1MROA 2K3IA 4PR6A 2KYXA 3RAMA 4GV9A 3KNAA 3VMFB 4BRIA 1N5TA 4ZPTR 1I94K 1HWUA 4O44A 3MWBA 1S49A 3C66A 2JC0A 3QAUA 1FKPA 1E4FT 3IWNC 1YT3A 3U1MA 2YHYA 1VSLA 2K1RA 4HEA9 4M42A 4NA2A 3I31A 2F8EX 1RT4B 1FJGK 2XCAA 4LVOP 4YFUA 2KM8B 5KGXA 3C0BA 2AYBA 1CJUB 3CJQA 4I68A 1C0UA 2YJFA 4ANCA 3L3VA 1SUQB 3BY5A 3IA0A 1SC3B 4DTOA 3OYEA 2ZOMA 3DLBA 1WTFA 3IR5B 4J9PA 1QHTA 2ASOA 3RMCA 4K8XA 5LY3A 2KG0A 3S6EA 4ICLB 4ED1A 3QEWA 4DTSA 4C11B 4G6VB 2RQKA 3W2VA 2V8PA 2AV5A 3RWUA 2NUUG 1RTHB 2YKOA 3SQ4A 4DV1F 3FDSA 4O3NA 1KVCA 3RBDA 2VUGA 4ZTFA 3NMUA 1XBWA 3CC7S 4M5GA 4LF9F 1CJTB 3I8BA 3SQ1A 3THWA 3KLIB 4LQ3A 1Z1ZA 2RJZA 2AJFE 3E3XA 3CCMN 3DRXA 1U2CA 2IBKA 5EN1A 2QG9B 3VQCA 1N5SA 2H65B 3O80A 2YH1A 1WAFA 3OHBA 1RTJB 1RBUA 3FFIA 1YBUA 4RX6A 1FNMA 4NZ6A 2D3OR 1JLCA 4QYZK 4XTTA 4FYVB 1ZC6A 2H4YB 4HT7A 1VK8A 4F02A 4I6YA 3HXMA 3KK2B 2YNFB 5B0EA 3ZT1A 4ED4A 1RT1A 3PCOB 2RB7A 4CJ5A 4DPUA 4HLBA 3QICA 2MKKA 1YUWA 3IM9A 2DRBA 3NS7B 3TAMA 2G8UA 3LM2A 4UZCA 4I4BA 5L46A 1NBWA 2E1RA 5BR8K 2Q6CA 2R7UA 4HTUA 4D3GA 4WFNL 4UF4A 1R8PA 4LSNA 7FD1A 3BDEA 2W6LA 2ZKTA 4OV6A 1S6PA 2DCLA 1RWUA 3DLKB 2GQCA 3G8SA 5KFTA 2JEIA 5AQOA 3J7ZT 4BVPA 2E5HA 2X1BA 4M5HA 4BCAA 3MEKA 4OYIA 1QZ5A 1BG3A 2HRUA 3OTOK 2V4JA 4WF9Q 1HI1A 3J81j 4URSA 2XMMA 3I55S 4LRAA 5KFMA 2NRZA 1U25A 3VOVA 2RIJA 1TL5A 5HN0A 3V6JA 2D0BA 1XERA 2B56A 4LMZA 2GX9A 1TFYA 3DOMB 2FY1A 2GMHA 4XEIA 4AILC 1TUGB 3PRDA 4K8ZA 3IAM9 2DH8A 4DG1A 2Z30B 4PWUA 2ZQBA 5GAEP 4OZLA 4Z37A 3K5MA 1VQLS 1T9WA 1RDWX 1Y4ZB 3IG1A 2ZUAA 2X1GA 4CLUA 3U27A 4I0WA 4IDKA 4MO5A 1R31A 1N52B 3MPWA 3H2LA 3OFFA 4RWXA 1MDUB 5KI6A 1CPZA 4QWDA 4GKJF 3GIMA 4HH1A 5KT6A 1VJQA 4X65K 2XWXA 1FJEB 3S3MA 4H4KA 3FBFA 4FPIA 3MCPA 3HI9A 4A46A 3VF0B 2RS8A 4JN4A 3RJMB 4KHPF 5KFNA 4O44B 2CPZA 4BG9A 1DQ8A 1ZBHA 4ITSA 3UCZP 1Z05A 2ZHAA 3LZJA 4JOUA 1SKWA 2ZBQA 2RRNA 1U6FA 2VPZB 4DQRA 4ZPBA 3LGHA 3D28A 1CJVB 4JKDA 2PZSA 4FK0A 2B4PA 4RJVA 1J53A 3DM2B 1UCNA 1LWCB 3DOKA 1C0UB 1RT5B 5FPMA 3GB0A 4C98A 4FJNA 1WUUA 4HI1A 3E9OA 5JLHA 3EGWB 3KLEA 4JKEA 2B0GA 2W2NP 4CD3A 2BDPA 2BR0A 3HM9A 3D0HE 5JMVA 2VFVA 4NYOA 3CNQP 1BWFO 1OY9A 1AZSB 4JI8F 2DPNA 4L6V3 2XYGB 4OJHA 4KHWA 4DR5F 3E1YA 2O8BB 3MR6A 4DS4A 5IS2A 3ZX2A 4NA3A 3U3GA 1GOAA 3EE9A 1KEKA 3P39A 2W7OA 4AQYJ 1XN9A 3QZ8A 1J6ZA 3TABA 4RR5A 2QWQA 2V6AA 2VH7A 1KVAA 3RSEA 3MEDB 2Z0GA 1HUXA 1NSPA 1BHNA 5ITHA 3CJBA 2DFHA 3O3GA 3GIRA 3VA3A 4EZ6A 5J2NA 1EWQA 1RDAA 2ZM6F 1U45A 4I9QA 3LAKA 2R3VA 3DLLL 1J5OA 3IWLA 4CGJA 2OGUA 3JSBA 4FWNA 4BC4A 2AYGA 2R2UA 1BGXT 4BE0A 4NLDA 2VPXB 1FEHA 3RBEA 4HUGA 4ZPCA 3I0SA 5I42A 1M5VC 1O6XA 2VL1A 3TRGA 4WKYA 1J5EJ 4I1TA 3UN3A 1L3SA 5F0XA 3HBTA 3E01B 3BS9A 2Q31A 4IRKA 4BR5A 4WE1B 2Y1RI 2VQEF 3AAQA 1FWLA 3D1QA 3KK1A 3H4DA 1G1XA 3EE8A 4HTIA 2YCHA 3G87A 1FRIA 3I8DA 3I0RA 3BGUA 3AD7C 3FGUA 2V4RA 1XC3A 4CM0A 3FZHA 1X3MA 4FBUA 3CHWA 4F9OA 2MJUA 2CWXA 2I9SA 4A62A 1JJ2M 5C2FA 4KV8A 4NXMF 2RS2A 2KKZA 2OMOA 4FOIA 3CETA 4Y28C 5LMNJ 3LAMA 4FYWB 4OJ3A 4FWSA 4DL7A 1ZM3A 1QUPA 1JLQB 4ECQA 2MSSA 3AJ2A 5HVGA 4OHZA 3R7SB 2Q1NA 4QYRA 4IBNA 2UXBK 3QINA 3AQPA 2FSNA 1NJWA 3OQ2A 4UQGA 1S1TA 2V4JB 2ZZMA 3K59A 5F8HA 1T9XA 2LSNA 1MSWD 2B6AA 1TV6A 1X8DA 4ECVA 4GO7X 4E19A 1PO6A 1T9YA 2UXCJ 3RZAA 3SSSA 1RAFB 4Q2MA 1KWMA 4EHUA 2BJDA 3CD6S 3GV8B 1R7IA 1Q16B 2PI4A 4WIIA 4IYQA 1RTDB 2A3JA 2AMCB 1Q7YT 3J81O 5IWAJ 3ZSQA 3KNGA 1P1LA 4J37A 3KLGB 3S1TA 3TSQA 3IRXB 2YHAA 3CFOA 3AVNA 1S1VA 3QFWA 5BYQA 4N7TA 4Z4FA 1OO0B 4DR4J 3EZUA 1AROP 4QOZB 2DHSA 1HIYA 3DCAA 2ZH6A 4ZVRB 3ZZUA 4UY8O 4CZHA 3L7OA 3Q8QB 3OW2M 3MPYA 5AQIA 4B9NA 2KB2A 4KRFA 4F4YA 1C1CB 4LF6J 3VQAA 4BC2A 4JV0A 3HHLD 4QAGA 2HMIA 3QLHA 2KXHA 1I39A 2P8IA 4JK8A 1Q8IA 2KW4A 2B3TB 4JB8B 3S41A 5KFPA 1ULRA 1VS3A 1DLOA 4XK8C 1Q9XA 3H42A 4KB0A 2CPIA 2QO3A 1IUJA 4X4RA 1HQ2A 2EEYA 1HR0J 4G1QB 2I8EA 4DTJA 1TYQA 2FVCA 3BSNA 2ZNYA 4DR6J 4CM2A 5GVQA 4YB5A 2V9WA 5LJ5Y 1VSKA 4GKKJ 3BGFA 3FBEA 2GGPB 2AGOA 3UKUB 1WC0A 2FVPA 4QWEA 3H08A 3QIOA 3SNNA 1Z25A 3L8BA 2V67A 4LBHA 5GAHP 1D09B 1RTZA 1BL3A 3M8PA 3J7Z5 2QEXS 2DR5A 2MXYA 2P2CB 1JB0C 4C97A 5IM0A 3ENOA 5H9EJ 5IXUA 3EEQA 2YWFA 3D6HB 2JGUA 4ZCMA 3MI7X 3MM5A 5M2UA 2XMAA 1FERA 1FI4A 1X7VA 1LXNA 4KGVB 4F4WA 4UUWA 5CAAA 3UFCX 3R2DJ 3CYMA 2HIQA 5LT5A 3MR3A 5F1XA 1FW6A 4NYZA 3AO2A 2BA9A 4JI2F 4WF9L 3CQYA 2A6OA 4JV5J 1RWXB 5AQWA 4IOAQ 4ECZA 1LFWA 1J5OB 1HNZK 1NK4A 3DHWC 1RGVA 5KG3A 3DC2A 3IO1A 2W40A 3ISNC 4K41A 5KFEA 3NBPB 1HRHA 1AT1B 4KR0B 1N32J 2HWIA 5CHIA 1WACA 2HYIB 1NSQA 4LRFA 1FFGB 1RZMA 4A61A 4NA1A 4A2BA 2MYFA 2PE8A 2PT0A 5KFQA 1REGX 2MLYA 2G9OA 4L75A 2ATLA 3OHRA 2QLXA 4CLYA 1LOTB 1LXJA 2N7YA 4CBWA 2RU3A 3AA9A 3I9ZA 2QX0A 1QSYA 3T1YK 4DV0F 2GJIA 1VRUB 5AXNA 4JKFA 3UE5A 2XZWA 3ZZZA 2DNQA 5JS1A 3ATVA 3MPVA 3R27A 3WDOA 3KDOA 1FXLA 3MCAB 5DDOC 4J90A 4X4TA 3QFHA 2IBOA 1FFSB 5AQNA 1FRHA 3ZNUA 4PL7A 1IR0A 2YHWA 3VVUA 1W2IA 4DX5A 2BJ1A 1D9FA 2M5YA 3R9LA 2YPZA 1WHVA 2HS0A 1N33J 2MZJA 1XUPO 2E8AA 1DEJA 3TA1A 2I5JB 1GQEA 2GJFA 1FKOA 4NLOA 3B4DA 3CTRA 1FJGF 1XQSC 3M30A 3PFEA 5EDWA 5LXYA 4QBUA 3KMSA 3N6MA 3D9BA 2CPXA 4V19J 1V3RA 2W25A 2A2CA 3BB5A 1ACMB 3WNHA 5HQ8A 5HSPA 4FJHA 1LW0B 2VG7A 3VWSA 4DS5A 3LP0A 5K20B 4WQ5A 5GADU 4LR9A 4DL5A 2OD6A 1DTQB 4QR0A 1JKHA 2KZMA 4DUZJ 2Z1JA 3QQCD 2CJXB 1HBUB 1QJHA 2Y1LB 3UN2A 1U02A 2YX1A 1VQSA 4CJLA 1FTCA 2R8IA 3CJ4A 5KT5A 4A47A 2FLPA 3R7BB 1HKGA 2XY8A 1T8EA 3EKUA 1NOZA 3FJ2A 5C25A 2N4CA 1HWJA 1Q7LB 3HZEA 3CEDA 5J1EA 3PYDA 4NCBA 5G0RA 3C6UB 2MLXA 3Q8YA 3PIOL 3O4NA 1ZTTA 3VZIA 3QBCA 4IH5A 4CJSA 4BGBA 2QYCA 4PYDA 5D4LA 4C3KA 3DU5A 4OLOA 5CZVA 3ZSYA 1FVQA 2G8VA 2A1SA 3WC0A 1U6BA 4BS2A 1DZ5A 4MAKA 4IO9Q 5J2PB 2NXEA 2HS3A 2ZKUA 1EARA 4OGCA 2V7ZA 3C14A 3VGLA 1WSRA 1VQNS 3X1LB 3M8ZA 1TU0B 2B51A 3TTDA 1X4AA 3L95X 4M7XA 3CCTA 2YJEA 4W4MA 4N5SA 3TAPA 1LWFB 1W2BM 4Y2IA 4CLLA 1NGAA 2VC0A 2X3DA 4G65A 3RB0A 3U9DA 1VHXA 1N54B 5ADXA 5FRMA 5L1IA 3NGUA 1UMJA 5IM0B 1EAYC 3D6MB 4CHZA 4KH1B 4L74A 1VQOS 4OZ0A 2XMWA 1KNZA 3E66A 4RCHA 1BA1A 2UUCJ 4YHHK 8AT1B 1F3FA 1VQKN 4BDZA 3FZLA 1HKBA 5C10A 3NGRA 2FUG9 2W9CA 3L7PA 3CDAA 2ZH9A 2MMYA 1JQGA 2BTFA 4K0KF 3OUYA 3G6VA 2F4VJ 2ZBRA 1IBMK 1C0GA 3OBYA 1BQNA 1RB0A 3CCUS 4O3QA 2V4QA 1KQSM 3OTOF 4DX7A 3PUFA 3GE9A 5D15A 1LQ9A 3M2UA 2ETJA 2YQ0A 4FWOA 4OKKA 4MKYA 1ICEB 4ZVEA 3SIPB 4EO8A 1VGYA 1YVNA 4TYBA 2PMWA 2HBRB 4OX8A 4QPXA 1YRUA 4JD2A 1H6KX 2ZE2B 2XZDB 4M3WA 3CJ8A 4RUBA 1FJCA 4KGKA 4NLYA 3KG0A 3DLHA 3M8QB 1YJUA 4JAXA 3FZFA 2P5GA 4GVMA 5AQKA 1T9UA 1VMBA 3AO5A 3VF6A 2LQ5A 2BOPA 4K25A 1HNXJ 3MPUB 2G1DA 2VG5B 4LH5A 2RE2A 4FM1A 4JI7K 4YOUA 3SI6A 4RW9A 3M05A 2DTUA 4Q7AA 3RBZA 1K8AT 2YY3A 2NUHA 5AFUA 5B0GA 1W7AA 4C1NI 3D54A 3NG8A 4NX9A 1O13A 5AZIA 3A5NC 2GAHC 3DGVA 4CZFA 1VYAA 3GJQB 3V81B 1RADB 1YI2N 1C1AA 5F0WA 1CZAN 3U9ZA 4GC6A 2ASYA 3P4UB 4WJBA 2VHGA 3PSFA 1VQMS 3AA5X 4OJGA 1MN7A 4I6MA 3QZ7A 2FHKA 2XTJP 1BWEA 1DTTA 3P49B 3UB5A 4NMXA 3H45C 4JKGA 4FL9A 3SJHA 3RVCA 1XNQF 4PUOB 2GIRA 1MMNA 5EWGA 1H7XA 1F0XA 4M45A 2A0FB 3PTWA 4IG3A 3GFYA 2QLWA 4CNZA 1L3UA 5K14A 2ROPA 5DZ7A 1WSIA 3NWRA 4TVAB 1WEXA 4J5OA 4Y3CA 3W2WB 1GH8A 3H59A 1RHQB 2ALYB 3BH7B 1ZS6A 1L5UA 3JSRA 4PQUB 4JKBA 4YB1P 1VOMA 2VV5A 4U7BA 2F7VA 5KOXA 4M8LA 2Y3YA 3D0IE 3ULHA 4NASA 4YY3K 1I1GA 3KHHA 1GT8A 2VBWA 3PX4A 1CQNA 1IV0A 1K0VA 3J80Y 1SBRA 4CH7A 1ILYA 1LEOA 3DI6B 1RT2A 3FR0A 1JNRB 3GL1A 2NXNA 4MK9A 1JCEA 9RUBA 3DXBA 4EP5A 2CQ1A 1K73T 2JWNA 2NPIA 3AY0A 4JI3J 1YG0A 1WN7A 4O55A 3ZEUB 2O8EA 2DGWA 2CJBA 1XNRJ 2BM1A 1FXRA 5G0RB 2JWKA 1VRTB 2QW9A 3R5AA 2PA8D 2KT5A 3RRHA 2DT9A 3SUQA 5I3PA 4A8QA 1IBKJ 3VEXA 5B09A 3HL8A 1XK8A 2O67A 4OGEA 3H5XA 3QGPA 1S76D 2W7AA 3DRRA 4CJRA 1VI7A 4A8WA 4PA1A 5HBMA 2NYIA 3BJYA 3O1BA 1QVFM 1SJQA 1BXNA 3QERA 4CZLA 1EO1A 4DMNA 2MDAA 4XPCA 3BO3A 2BJEA 3ADAC 2RF2A 3LANA 4OX9K 2V5HG 2IRXA 4DU1A 4IG0A 2Y0BB 1OYEA 1HWIA 4DKWA 4YDUC 2UU9K 4K5SA 2FC0A 4NLQA 5AZJA 3O5BA 1HW8A 2R7RA 4WYBA 3SCLE 4O5BA 3Q8UA 4CWBA 2AZ1A 4CJWA 3H20A 2BH1A 2E20A 2HHUA 4USIA 2HRTA 3TUIC 2HVHA 3JYTB 4HHUA 1RAJA 3PKYA 2E88A 1U6ZA 1YBAA 3EL2A 4DPXA 5EY4A 2F3JA 1U1NA 4RNHA 1IR1A 3S01A 2M0GB 3K9KA 1IKWB 3M8YA 4XDCA 5KAKA 2BM0A 1PC5A 3OJSA 2A41A 5I3UB 3I4PA 4ECXA 4PKIA 2APOA 4LRCA 3RB3A 2MZ1A 2BKOA 2VQFK 5HQMA 1S1UA 4FDFA 4CK3A 4J8FA 2KRBA 2QWNA 2YKPA 2CVIA 1GLLO 5HANA 2CNLB 1HL6A 3CC4S 4JD2B 2QM1A 1IQZA 1WHXA 3G0ZA 3UIQA 5KPTA 3FCWA 2ZH4A 5C7PA 2IY5B 1RQ0A 5BR9A 5GAHI 2GHPA 3T19A 4RU9A 3D2EB 1BISA 4J2EA 1IKYB 1WSVA 3DRSA 2Q3PA 4LFCJ 3QRRA 3GBTA 3MM7B 4NLXA 5HI7A 1W9HA 2XNRA 3U1NA 3JTNA 2LCWA 2XMUA 4AE5A 1R0BG 3PHTA 3HJFA 2MQ8A 5A8RA 3H2VE 2ZH8A 3CJ1A 4X66J 5CYQB 4LFBK 3A2FA 3CPWM 1OYDA 1IG8A 2XMVA 4ID8A 2Y1IA 4ILHA 4LIWA 2KHOA 3DOLA 4IWVA 3SBGA 2R8HA 2GV1A 4J9KA 2FHJD 2GMLA 3UVJA 1RILA 1DTTB 2GNKA 2H3EB 1HNVB 3MEEA 4JKGB 4K43A 5CD4H 3HP6A 1HBOA 4WCEQ 3CCQS 3W65A 3CJ7A 4OI6A 1ZETA 1KQKA 2DBBA 5C24A 4IO9L 3PKMA 4YNQA 3DLJA 4ZVOB 4BRHA 1S7IA 2D0PA 1KVJA 1BUXA 4PEOA 2CZVC 2PGCA 4ZN3A 4P74A 2PEHA 3VQ6A 5IQ6A 4O4GA 1WSFA 4R25A 4H4MB 5AJ3J 2KO1A 1UEUA 4RLEA 2EFNA 5LJVA 3LDLA 2HBMA 2L41A 2VGMA 2W2MP 4Y2AA 1R8BA 1M90O 2K3KA 1NHVA 2AA4A 2HLUA 3CQ8A 2HFSA 4M3YA 4HCCA 2HQFA 1SB6A 5C0YA 4DV7K 2JLFA 2NPFA 4Q0BB 5M1KA 5GAGP 3AGKA 2K7JA 4MYTA 2OI2A 2N82B 2XMTA 2HHQA 3B8HA 2W8LA 1UJ5A 4A2AA 4ILGB 3AA4A 1C0TB 2XYPB 1Y97A 1N5YB 1RLDA 3BF1A 2W2PP 1FA0A 1RKIA 3RG6A 3OD2A 3EPIA 1G99A 3VGVA 3LP1B 5D4PA 1YF5L 2V68A 1I51B 3JXOA 5D78A 3BO4A 3LDPA 1PJ5A 2NRWA 4K4XA 4KH4A 1H7WA 4RWTA 1KP6A 3H2UB 3VERA 1IKVB 3A8JA 4Z94A 1OSDA 3ZZOA 2ZNZA 2CAJA 4ES3A 3VF4A 4CTAB 2GBZA 4Z2XA 4FWLA 2ZFHA 2UUAJ 3NP5A 1FO1A 4AYBD 3T1HK 1S9GA 3UW1A