2JLLA

Crystal structure of ncam2 igiv-fn3ii
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
389
structure length
381
Chain Sequence
QPHIIQLKNETTYENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEKSLDGRIEVKGQHGSSSLHIKDVKLSDSGRYDCEAASRIGGHQKSMYLDIEYAPKFISNQTIYYSWEGNPINISCDVKSNPPASIHWRRDKLVLPAKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNHIGTRFQEYILALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASEIWKIVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPILEYIVKYRSQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANLGYSEPTVYEFSMPPKPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEURAL CELL ADHESION MOLECULE 2
publication title Structural Model and Trans-Interaction of the Entire Ectodomain of the Olfactory Cell Adhesion Molecule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 67
structure length 381
sequence length 389
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
A PF07679 I-set Immunoglobulin I-set domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jllA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jllA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jllA03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jllA04
3WFHB 1QSFE 3K81A 1UKQA 5CEZH 3QJFB 1FFQA 4N8VA 4MXVF 1SJEA 2YZ1A 4JPIB 3X14B 3S34H 3EYQC 1A2YB 1OD7A 4LIQH 5ESAB 1WTLA 1T5WB 4PG9A 2VQTA 4XP1L 1I9IH 5MEPB 2XG4A 3CIQA 4L3EE 1G9MH 4LCCA 3ZDXF 1D9KA 1MELA 2DQGL 4I77L 5D1XB 4U1MB 2AK1H 2BOBA 3IFPA 4QKXB 3TPKA 2RR3A 2W9DH 4RX4D 5EIVA 3E8UL 3QA3A 2H45A 4GRWB 3U48A 1F4AA 1R3KB 5DHYA 3QCUH 4JZJB 4PIRF 5EORL 4QHKJ 4ZAKB 3PDOB 2HJFB 3SDDA 8FABA 4LOUD 1HI6A 5JA8B 3TO4C 5DVOA 3S4SA 5A2JH 3H3BC 1LO3L 3GHEH 4QY8A 2V2TA 3IRPX 2OBGA 1S5IL 5IROA 1JHLH 5KN5A 1WT5C 4YDVA 5GPRA 2BHUA 1N5AA 1GCFA 4OLZH 3EDFA 4MD0B 5HDQL 3DROB 1XCTB 2W60B 2CIKB 3BP6B 3ULUE 4LSUH 3WE6A 1JGDB 2WLYA 1YN7A 4H25A 5TDNB 5EOCL 2GTWA 1EA9C 4NUJB 4OD2A 1EIBA 3MOBH 1RUKH 4G9FE 4C57C 1CL7H 3ROLB 4NCC1 2CLZB 4YDKL 4TVPE 3PABA 5FB8B 4J3OC 1JWUA 2O5YL 2OS7A 2H8PB 3MGTB 1DSFH 3KR3H 3HN3A 1SMOA 2YRZA 1Q94A 2E8YA 5EC1A 3ARPA 3SGDH 1QBLH 4L1DA 2ZJSL 4NKIL 4ZTPL 3HZKB 5J9PB 4ISVA 3N9GL 2EH7H 2ICCA 3HZVA 3CPLB 3LKOB 4I48A 4NNYB 4PJCF 35C8L 3TIEA 4YDLC 4DKFH 3FAWA 3K74B 3VXMA 5HPMA 5IQ9B 2IH1B 5C07B 4NFBA 2IF7A 3I2CL 4RGNC 2JJVA 5TQ2L 1EFXB 5DJZA 1JPFA 2XWTA 1CIUA 6CGTA 4P57A 3BMVA 2Y4SA 1RQ5A 5E1AB 2JB5L 4YGAB 3RIAK 3O6KH 1MCHA 3MLVL 4O58L 4JN1L 5BV7L 5KSAB 4OZHA 1T2JA 3L3OA 4L4TB 4HIXH 1OCWL 2YD2A 5E6IC 3UTTA 1U8JB 2AJXL 1AIFB 4MX7A 5HY9A 4WNQA 3GI9L 5FKPB 5D7IF 1EHAA 1LNUB 4ONHB 1SBBA 4IMKA 1SJHB 1QO3A 4XPTH 4LSSL 5F97E 5EU5B 3WJLA 4RISL 2WIIB 4KV5E 1KPVB 5CEZE 2H9GA 3GSVB 3KHOA 3C2AH 2ITCB 4R0LC 1DQQA 5GGTL 2DWDA 2Y72A 3DLQR 1IEBB 5DJ6A 4AEEA 1LO2L 2W0FA 1FL3A 1WUNT 2F74A 4JFYB 1EZVY 3CSBA 3LV3A 4LIQE 3IJSA 5I17A 3ESUF 4FQPA 4U0RB 3MO1B 3O2DA 2UY7A 5KSBA 3EIFA 4HUXB 2UUDK 3DV4B 1J0ZA 1OSZB 4XP1H 5DMIL 3AY4C 3BP7B 4KMQA 5EIIB 2CDGB 2DQGH 3LD8C 2KUTA 1NBZB 1EZVX 5IVXF 2ED7A 2I5YL 3BZEB 5B4MC 4QHMB 5F9JB 2XWJA 3E8UH 5ANMA 4AIXA 5GISL 4Z7WF 1WZMA 2L7JA 1QSFD 4ALAL 2WNGA 2XQBL 5EO1B 1MPAL 4ZYKA 1N59A 4MNQE 5EORH 4YGVB 4KFZC 5DRZA 1SY6L 5FYKD 5K9KA 4EDXA 4OAWB 1LO3H 1I9EA 2VLLA 4CNIA 3F6LA 4YHML 4HW6A 3FHQA 3WUZA 1S5IH 3W9EB 5MENA 5FO9A 3ULSA 4JFPB 5K59F 4U2ZA 2V17L 2HTKC 1G9NL 3OAZH 5F9WB 5HDQH 4HH8A 1PX4A 1A7QL 3ALXA 1QFWL 1EHXA 2CJUL 3RUGF 4JO2L 1VFBA 3SY0B 1AGCA 2LTQB 1BOGA 2NTFA 2H6PA 3BQUA 3BP4A 3I6GA 3VXSB 1IJ9A 5EOCH 5E8OB 5D72L 4QHNB 3KYOA 1ZXQA 3GMLB 3TESA 4LKCA 5DYOB 3GBNL 2X1OA 1EUUA 1IAOB 1AO7A 2O5XH 3FOMA 3FTGB 4YDKH 3F12B 3QRFM 5CUSL 3CSYB 3H6JA 2O5YH 5CWSB 4OFDA 3F65A 1ERNA 2JKXA 3HE6A 1MCCA 3BGMB 3MV7B 3ULUD 4XMLL 1CTOA 1KEGL 1EO7A 1OGTB 4RDQG 2ZJSH 4NKIH 4ZTPH 3LKQA 3TVMD 4OZGA 1WSST 3N9GH 4ZUVB 3KJ4C 5D2NC 4JFXA 1KPRB 2YPKA 1A7OL 4P2RE 35C8H 2HJLA 2BRQA 2Q86A 3AB0C 5ISZA 5F89A 4G9FD 4I18A 3OR6B 3WXVL 3RPIB 4ZNEE 1BQHA 4X6CA 3SDCB 4RMSA 3O2DL 5GGVL 1AY1L 1RHHA 1XT5A 4DK3A 1QNZL 3ARED 5F21B 1HDMB 3I2CH 3VI3E 1XF2B 1FNEB 5TQ2H 5C0DA 4OCSL 4KKAD 1UQSB 1OLLA 5DVMA 4F7TB 3PDDA 3NIFF 2JB5H 1MI5D 2DI8A 3EOAA 2F19L 2ENSA 5CLWA 3O4LA 1T0PB 3MLVH 1BPVA 1BWWA 3QFDB 4O58H 3G5ZB 4JN1H 5BV7H 3RL1A 4I13B 1FYTE 3U0TA 1HHGB 4L4VE 1OCWH 3HG1B 1A9EB 2AJXH 2IANB 1MCLA 4JGUA 3L5IA 4GG6A 3T0BA 1QYGH 3GI9H 1QSEB 3B3IB 3EDEA 3RX7A 1G84A 2YPVL 2PTTB 3UTOA 4DVRL 4QRTA 2YXFA 4RISH 4DCQB 1VEMA 3TV3L 5CLTA 4HMDA 3UTSA 3BWAB 1S9VB 5GGTH 1H15A 1LO2H 2PW1A 4KC3B 3MROB 1M71B 3OJDB 3TN0D 2YSSA 3GSUB 4PJHA 4N9OB 3IDNA 2SEBB 4HUVB 2WWKO 4NYLA 3DI2B 3L3HB 4QTHB 4V2CB 4YR6B 2QHRL 2ZCLL 4FFZL 4O51A 5DMGC 4FQXA 5DMIH 4YBLB 3DUUA 5K93A 4ZXBA 2I5YH 4Y0GA 4QEGA 4F8QA 3O3AB 4X5XA 3OR7A 3U4AA 1A14L 4L3CA 5DJDB 3ECBA 4RA0C 1FG2B 3PNWB 5GISH 3W2DL 4ALAH 2A0LD 2XQBH 1LO0L 2A6IB 4GLRI 1MPAH 5IBUG 1NEZA 5F70A 4U6VL 1F11B 1WBYA 1LE5B 3JV6B 1KB5A 4Z7UB 2UVEA 4PJFA 5SWSB 4YHMH 3U2SA 1F3DJ 1H8NA 2FATL 2DM7A 3OGCB 4XX1E 1E4KA 1GRWA 1TITA 1S9WB 2V17H 4P9HC 1G9NH 4WI6A 3DUSB 1NGQL 3QXUA 1P7KA 1OVZA 1A7QH 2ZP0T 3UAJD 1QFWH 2CJUH 4R4BB 4JO2H 1CU4L 4XAKD 4EI5A 1KT2B 4LHQB 3GBML 4NOFA 3GK8L 4MNQD 4DGYL 4JRXA 1RZ8A 4LSRL 3IETB 4ZO7A 2Y9RT 3D39B 4WIQA 4Y2OA 3GBNH 1PBYA 2XA8L 5DK2A 5F44A 3OAUL 3EO1A 1T0NA 5CUSH 1Q9WA 3ZDZF 4KMLB 2EYRB 3O41A 4PRNA 4H20L 4NZUL 1UH3A 4OT1L 4XMLH 4GRLC 1KEGH 5DI8A 5D7KD 4HJGB 3GMPB 5DRNB 3QDGB 1Q9LB 1A7OH 3PQYE 5CJOL 4Z0XA 2K7PA 3KPSA 1U8QA 4ZDHB 3BH9A 5KS9F 2JJSC 3IDUA 4MXQD 3O2DH 3RIAF 2K3TA 3AMLA 3QEUA 4APQD 1QNZH 2ATKA 2PYEE 2Z92A 2CGRL 4R2GB 4WW2F 1HXMA 4OCSH 5I66A 2FZ3A 1FFOB 3U9PL 4PG2C 3MRJA 1FV1A 5T1LD 4MD4B 4OCXL 4PB0L 2FX9L 3QP3A 3MRDB 2F19H 3LKRB 3S5LG 1N2RB 4XCNB 3SHSA 3I3EA 5DHVH 2D4DA 4WY7L 4Y4KA 4UU9B 3VXUA 3TA3B 1FDLL 2VLKB 2OTUA 2QV2A 3DETD 3VFNA 5B8CB 5BS0A 4X7EC 5IVZA 3AMKA 3AS0A 2YPVH 4F7MB 3FRUA 4DVRH 3DRTB 2GFBA 1S7SB 4PLJC 2L7UA 3TV3H 4F2MA 5LWYL 3OKLB 1I1YB 5HHOA 4NCDA 3FB8A 3MRLB 3IJHB 3LN5A 5E1HB 1W0YT 4BFIA 1QEWB 1YMHB 4GS7B 5JMRA 1QPPA 4R4ND 4PJIF 2QHRH 2ZCLH 4FFZH 3EJJX 2E7HA 5D7LA 4M7LH 1U58B 2IPTL 1CXLA 1RIUL 2X44D 4GSDL 2R1WA 3CC5A 2AI0L 4TPRL 1S9XA 4KMTL 1A14H 4LCCB 1P7HL 1YPZB 3QDJA 4NO5B 2XY2A 3D0VA 5DWUL 1IRAY 1ZA3A 1LO0H 4L8CB 5I75B 2VYRE 5SX5K 1RURL 4G8GB 4U6VH 1I1CA 5HHQB 5BV7B 2FO4A 1P9MC 1DDHA 5D96C 4BFGA 1Z9LA 2CKBB 2FATH 2B5IC 4KKCD 1T0MB 4QY8B 3CAFA 3G6JB 2YWYA 2XA3A 1FSKB 1NGQH 3MA9L 1OHQA 1J9CT 4L9LA 5KN5B 2OI9B 1TZIB 1IMHC 1CF8L 2HLFD 3H9YA 1N5AB 4QXUL 3W9DA 4G6JL 1CU4H 2IH3A 1CE6B 3BKMH 3IDIB 3ARGC 4F57L 3GK8H 4P5TB 4PJCA 5F3BA 4DGYH 4LSRH 1SYVA 3WE6B 4UNVA 4I3GA 3GSWA 4UOW0 1FNFA 3BN9C 2WMPA 1YN7B 5ECJE 4RGOL 1NGPL 1YN6A 2GTWB 2XA8H 1KGCD 3QFJB 1JMXA 4PGDB 4L8SA 3OAUH 1RUQL 5DC9B 3KPLB 1Q0XL 1NDMA 5E8NB 5SX4H 3OXRA 3MJ6A 3VFMB 2F5BL 4H20H 5HYFA 4NZUH 1INEL 4OT1H 1JWUB 2MQ0A 4PRHB 1CZ8L 1I3UA 1YY9D 4JM2F 1I85A 4WENB 4RDQF 3VXOA 4UT7L 5EC1B 4ZAKC 5CJOH 2AP2A 2X4NB 3OKMB 1T66C 5DD5L 1J12A 1NQBA 2WBJD 4PGEA 5D7IA 4ZO9A 4BJLA 5HHPB 2W65A 3TIEB 4ZOCA 1FE8L 3ALPA 2CGRH 3WUWG 2VRAA 1C16A 3VXMB 4JAMA 3MLYL 3RVTC 1EHNA 4D9RD 3NAAL 3U9PH 4R3SA 5ANME 4MAYC 4K8RC 4OCXH 4H26A 5EU7E 4PB0H 2FX9H 5DJZB 1JPFB 2XWTB 2HKFL 2P5EB 1Y0LA 1N3NB 2EKSB 1YMME 1V3LA 3PQYD 3S3PA 2G75A 1EXUB 2JJWA 1EVUA 4WY7H 4PRPA 4JY6B 2BDNL 5IMLA 5C0ND 1FDLH 5MENE 2XTJC 3WFBL 4D9LL 3KYMB 2PYED 3P30L 4Z7VF 4WHYG 3UTTB 1JWMA 1RVFL 3A0OA 5IVXA 4POZC 3RY5A 2FRGP 4WNQB 3HUJB 3RTQB 4MMZC 5EBMB 1FAKT 5CBEA 4Z7WA 1D5XA 1FNLA 5LWYH 3D6GA 2E6PA 3P4MA 1KF9B 2H9GB 2DWDB 1IL1A 5DJ6B 4JPVL 5D6DC 4ORGA 1AC0A 1FL3B 4WHCA 4ZUTB 3LV3B 3C60C 1EO5A 2AAVA 5TGBB 4LLVB 3ZL4L 3VWKD 1FCCA 3ZKNC 1F00I 3RVWD 3I3DA 3ZTNL 3W5MA 5KSBB 2IPTH 1RIUH 4LHJB 5F1OB 3GMQA 2AI0H 4TPRH 3RUGA 1TZHA 1WAAE 4WJ5B 2AKRB 4X4ME 4KMTH 5D7JB 2JJTC 2I9TA 2V2WB 2RB8A 5GIRA 4MHHG 1XF1A 5DJXB 2EE6A 5DWUH 3CDGB 3JWDL 5ISZE 1ZVSB 2X6MA 2XWJB 1S78D 1RURH 2B4CC 3D3VA 3WSQL 1D5MB 1QFUL 3TIDB 4ZYKB 5TFSL 3VI4E 5DRZB 1NJ9A 4EDXB 3VA6A 3QUXC 4WO4B 4ZFZA 1HKFA 4CNIB 4N5EC 5F88A 4LLYA 3MA9H 1U6AL 5FO9B 4ZOAA 3VFUA 5JW5A 1CF8H 2AK4A 4QXUH 2IQAA 2QADB 4G6JH 3O4LE 1OQOA 3BPLC 1H3XA 3VRLE 1LP9F 4AIZA 1AQKL 4F57H 3MBEC 4Y2DC 1BOGB 2NTFB 3BQUB 4GG6E 4RGOH 4YQXL 1NGPH 2FIKA 1JVKA 1OAYL 1GL4B 5CINL 1BEYL 4LVHB 1JPGB 1Q0XH 1AO7B 2Y07L 1PYWA 3UTSE 3FOMB 3ALWA 1FZKA 3CXHJ 1UB6B 4N0CC 2F5BH 1INEH 1MFDL 4X8XA 1M7DA 1W8OA 1CZ8H 3SCMD 3U7YL 4F9LC 4YBQD 4E9LA 1JHKL 4PJHE 4AENB 2DDQL 4Q97A 2KBGA 1S7RA 1J87A 1R5IB 2EDNA 3BD3A 4GLRH 1MLCA 4TN9A 4UT7H 4Y19D 3B5HA 2IADB 4KJQC 3LKQB 3I85A 3EOYG 5DD5H 2DKSA 1QLEL 4YEFA 5GSVB 4H5SA 3WL9A 5F6IB 3V5DA 4LLAA 3FCTA 3IS1X 1X4ZA 2GY5A 1FFPA 3D25B 1FE8H 5E8EB 2Q86B 3PHSA 4RRPA 3TH2T 32C2A 3K1KC 4X6CB 3MLYH 3QO0B 3NAAH 4CL7A 3C6LA 2X89D 2R0WL 5GRVL 4O9HL 2R0ZL 2LU3A 5BJTA 3I6LD 1CXEA 1RJZA 2IAMD 2ZPKL 5IWLA 3BWUC 1MH5B 2VC2L 4G6ML 2HKFH 3PGFL 2ZSVA 1DBAL 4G6KL 4Y7MA 1JF5A 4KY1L 4DFIA 3DXAA 3O3DB 1FRGL 3EOAB 2VLRA 3SKMA 2F5AL 5DEZA 4WGWB 3MJ9A 3VXPB 4M93B 1MI5A 3V6OC 3WFBH 4D9LH 3P30H 4W6XB 1ZLWH 5HTSA 1K2DB 4NSKB 4P48A 1AR1C 3EGSB 4PJDE 4YHIB 4BSVA 1LE9A 4P2OD 1RVFH 1T3FA 4WU7A 5BCAA 2FO1A 2G2RA 5E5MA 1GOHA 2EDWA 3O8XD 4JRXE 4MYWB 1YMMD 1S7QB 3DMMD 2AQ2A 2AVGA 4JPVH 4FG6D 2PW1B 1A1MA 3DJ9A 4KDTA 3K46A 3HE7D 1UCBL 4LNRA 3ZYIA 5K9OB 1H3PL 1WZKA 3QIUA 3IDNB 3DVIA 1M05A 4UDUA 1Q9OB 2ESVE 3FAXA 5SWZE 3Q6GL 2BFVL 3ARYA 1X6NA 3ZTNH 2X1WL 3AVEA 4JR9L 5IJKC 2WAHA 4X4XA 4U6XA 3MRKB 4W4OC 4O51B 1AGEA 3ES6A 3HI6L 4FQXB 3UZEA 3PJSB 3LN9A 3GDBA 2YK1L 3UDWA 1I8LA 3X11B 3DX8A 2VL4A 4JHAL 1PZUB 3JWDH 3OR7B 4L3CB 5C0FA 3KPSE 2RJMA 1ZT4A 5C0IA 5F7NC 4JCMA 3WSQH 1QFUH 4P4KD 4HIHB 5TFSH 4YK4B 5FHBL 1AFVH 3LCYA 1DTUA 2NZ9D 8CGTA 1WBYB 4EN3C 1KB5B 4KK5D 4M3JA 5FM4A 3U2SB 4DZ8A 1U6AH 3KWWA 3TCLB 4MXVE 4Y16B 3NIDE 1RIHL 3HAEA 2EIDA 3MLRL 3U82B 4QCIA 2JLLA 1AQKH 1P7KB 1L0XA 5EUKA 3EKCA 2ZUYA 3CDYA 3WLBA 5C0CB 5DJ8A 3HRZB 5KS9A 5DC0A 4S1SL 5TPWL 5BS0E 2DWEA 1XIWD 1RFDL 3HKFA 4YQXH 4QOKB 4X8JA 1OAYH 3MJ9L 5CINH 3GSXB 1GC1L 3VW3L 5BW7C 1ZMYA 1BEYH 5DK2B 5JOEA 1TENA 2Y07H 3QEQD 2DIAA 3KS0J 3MRFA 2CRZA 4NWUL 3NFPA 1MFDH 5HHOE 1G7MB 3CUPA 3VXTB 3U7YH 1IKNC 5IFAL 4MAUL 5CEXB 1JHKH 3GM8A 3O41B 4PRNB 3UTQA 1JN6B 4KAQH 3KYNB 1D6EA 2YD6A 3VMNA 4MJ5B 5DI8B 5I9QC 4ENED 1GYAA 1A6AB 4OCYL 4P46D 1QLEH 3O4OC 2FBOJ 1HILA 1T21A 5D7LE 2F54D 5KSVB 2VISA 3EJZD 1I7RB 3PGCA 5I73C 1LWRA 5D93B 1IEAA 1ORSB 2DF3A 3RY6C 5GGQL 4WU5A 3BGFC 3MV8E 2VXTL 2W0PA 3QDJE 4Y4FA 1YEGH 3V0AC 2ATKB 3VWJD 2Z92B 2B0SL 2HFFB 2R0WH 4O9HH 5AZEL 3O6FB 1KLGB 2R0ZH 1HXMB 4MJ6B 2ZPKH 4P9ML 4APQA 2VC2H 4G6MH 5AAMA 4R97B 2EDBA 3PGFH 4P5KA 1DBAH 4G6KH 1QOKA 2UWEF 1XGPA 4KY1H 4NQCB 3ZKXB 5IB2B 4PV8A 1FRGH 2IPUG 2CKNA 2GJZA 4R7DA 3MR9A 4NKMA 4TUOB 2F5AH 5I1AA 1AHWA 5EFIA 3RWFB 3VXUB 5E00B 3RVVD 2LFGA 3D85D 2OTUB 3HC3L 3VD5A 4NBYB 4D8PA 4ZPVB 3VFNB 4HBQA 4KPHL 3RZWA 3GKZA 3L6FA 3MXVL 3FRUB 4MD5A 3DGGA 2IPUK 5JO5A 4PJCE 1HWGB 2DIJA 2V7HA 4F2MB 4IOFD 5I71B 4LEOB 5BQ7B 4QRPD 4LCIL 3LOWA 4ZOEA 4H8WH 1UCBH 1H3PH 2NY4D 2K9UA 5IOPA 4BFIB 2CPCA 1I1FA 3Q6GH 2BFVH 1T04A 2C7UB 4JR9H 2V5MA 4IOSD 1NBVL 5TE6L 3X12A 5EZIL 3UJTL 3LKPA 3HI6H 4ZTOL 1RIVL 1KXTB 2YK1H 4X6EB 4WWKC 3CC5B 1FZOA 4JHAH 3LZFL 4JFQB 2LQRA 3D0VB 3WNLA 1QPXA 5D7IE 4M8QB 3TFKC 5JDSA 5T3ZD 3QWQB 5B8CC 5DJAA 5FHBH 5SWZD 1ZHBA 1VACA 2VH5L 2CH8A 4ZFOB 5F8RC 1JE6A 1AC6A 4EI6B 1KJVB 3WS3A 3MRNA 2GJJA 4UBDC 3LSOB 4JM2A 5F6HI 1RIHH 3L7FB 1CICD 1XGRB 3HNVL 3MLRH 1CDHA 1CS6A 5CGMA 4CGTA 4U33A 1XGYL 3W9DB 2VTFA 3U46A 2G5BB 5CGYC 5I74B 1I8IA 4S1SH 5TPWH 1KNOB 5CKGA 1RFDH 5F3BB 4MLIA 5JPNA 2HFTA 5IVXE 1TETL 3MJ9H 4JVPA 3GSWB 3VFPA 1GC1H 1FNGA 4KDVA 1YN6B 3MLPA 1PG7X 2CO7B 4Z7WE 2O61A 1X5GA 3MUHL 5C0EA 2CSPA 3CCHB 4L8SB 5KTEL 1IC1A 4NWUH 5JXED 3UJJL 5IFAH 4MAUH 2AJZB 1J0KA 4HF5L 3MREA 3QI9D 4LHUD 5TE7L 4YHZL 1MCNA 4OCYH 5K59E 2DJUA 3O3BB 1HK6A 4Z7VA 1X5LA 3VXOB 3QXTA 2FWOA 1AGDA 1P69B 2QHLA 4JVWA 1A6WL 1FO0B 5GGQH 4R96B 4J8RA 4U7MA 3WDJA 2VXTH 5BVJA 1J88A 3ZDYF 1JTTA 4X6DF 4U7KA 2B0SH 3RZCD 5HVHB 2DL2A 1C16B 2J12B 5AZEH 4JAMB 4P9MH 5HHNA 4GO6B 1IGTA 1W72L 5JHDE 3WFCL 2VL5A 4KZEL 2OR7A 3BPCA 5C08D 4WEMB 1JF1B 5FAAA 1YEDA 3ULVE 1QKZL 1Y6NR 3AUVA 4CMHB 1UM5L 2HVJB 1MEXL 3G5VB 3HC3H 3SKOB 2AK4E 2HN7B 5IB3A 3B5GA 4KPHH 3HB3C 1HHHB 4JFDA 3MXVH 3KPTA 5J11C 1OB1B 3F5WB 4M6AA 3CMOL 4C58B 1DL7H 3UZVB 4IM8A 1LD9B 4JO3L 1D5XB 3TNNA 1GGCL 4LCIH 4OCRL 2WUCL 2BSRB 1SQ2N 3H42L 4TRPL 3LKSB 2DTML 3WNOA 2Z91B 4JRYE 4ORGB 4HD9A 1CE1L 4IRJA 4U1JB 2PW2B 2APXA 5INDA 5TE6H 1IAKA 1NBVH 3L95A 5EZIH 3NIFE 4NZRL 5TQ0L 3UJTH 2HT3C 2I25N 4ZTOH 1RIVH 4IOIA 3OL2A 1P7QA 4EIGB 1A02N 1KJ2A 3GMQB 1ZA6A 5LGJB 1J1OL 3RA7L 1CD8A 1TZHB 3RUGB 3LZFH 3K1DA 3REVB 4UNUA 4RZCA 3DVNB 5GIRB 3NCCB 4HIIA 2AXHA 1I7UA 2HT4D 2APWA 3BP5A 2EYSA 2VH5H 4JY5L 3OKEB 1JYWA 3C8DA 4RFEB 4RSVA 2OMBA 1QSFB 4DOHB 5HGDB 1NJ9B 1TCRB 2UV3A 4TTGA 4PJ9A 2FH8A 4ZFZB 2UUDH 3GMNB 5F88B 3HNVH 4OGXL 4WV1A 3VFUB 3DXAE 1F5WA 4PGBA 3T1FA 2IQAB 1XGYH 1FNHA 3L5XL 1G6RB 3WBDA 5C0AE 3VD4A 4AIZB 1JGVL 3K7UA 4OI9A 5B38G 1T5XA 2XXCB 4GW5B 4CW1A 3KLSA 5CJ5A 5ERWA 1YNTA 1KBGL 5LJYH 1TETH 5D6CA 1JGEB 2FIKB 2E6QA 3X17A 3MRMB 1UM4L 5KTEH 2EZ0D 4PRAB 2BNQE 2BNRE 2BHZA 3UJJH 1PYWB 5GS1A 1FZKB 5DQ9A 5ID0A 4HF5H 3C9NB 3S5LA 4KJYB 4Q6IC 1NSNL 4UB0L 3VGBA 5TE7H 4YHZH 2P24B 4YX2L 4XXCA 2J8UF 3W81A 2L0DA 1DUYA 2NR6C 2X41A 1MLCB 3RGVA 2NY1D 5FUCC 1A6WH 4WO4C 3QH3B 3WL9B 3V5DB 1R5WA 1I8MB 3FCTB 1I7TA 3DYPA 3HNSL 2R2HA 3VD7A 2QADC 32C2B 4JFED 4NQVA 2HH0L 1XR8B 3WNNA 1OP5K 2YA1A 4Z5RA 1W72H 2FX7L 1KJ2L 4KKBD 3WFCH 4KZEH 5BJTB 3AREB 1PD6A 1VFAB 2X89A 4G7YL 4PJBF 3QWOA 1LEIA 2IAMA 1R3JA 1QKZH 3BUTA 5FK9B 3SKMB 1RUMH 1UM5H 1MEXH 2NY0D 2X4SA 3F7VB 4JQVC 3EYQD 1MI5B 1FFRA 1ZGLA 3BX7C 1Z3GL 1K4DA 1NC4D 4BSVB 3BYTA 1LE9B 2DM2A 3ZSTA 4K94C 1WCBB 2FB4L 4NPYB 3TH4T 5JIIA 5JHDD 4YHPA 5F7DB 1FL5A 1Q1JL 2H3NB 1CGSH 2G2RB 2PXYA 4JO3H 2AXGA 3CXDL 4RMVA 5C3LD 1GGCH 4OCRH 2WUCH 3H42H 4M7KL 1CFQA 4TRPH 4Y4HD 1OTUC 4OB5L 4JN2A 1IGML 3ULVD 1A1MB 4J3TA 1CE1H 1U3YA 4LNRB 3TO4D 3U36A 1QBML 1E4WL 3QIUB 2YOCA 1IKFL 5TQ0H 1M05B 5DZNA 5A40E 4ELME 3RWJA 3HE7A 4MA8L 4W6YB 3TN0B 2JB6B 4Z78B 1KACB 4U1NB 3MXWL 4KUZL 4X4XB 3TBYA 1TQCC 4URTB 1J1OH 3RA7H 2BP3A 4MHHI 1DEEB 1VA9A 4X99A 4YPJA 1OF2A 1GZQB 3R06A 3D1MC 3DARA 4M48L 1ZT4B 3Q5YA 4P3WA 4JY5H 3T08A 3DX7B 3ARRA 2ADGA 4E0RB 2NY2D 2DQUL 1MQ8A 1GIGL 3TZVC 3BPNB 2Y6SC 1IM9A 3FO1B 2AV7A 5ESVA 5E8PA 4OGXH 4DZ8B 2WW8A 3KVQA 2LV4A 2C1PA 4TULL 4H88L 2EXYD 4PJIE 3L5XH 4QGYA 3HAEB 4X4ZA 4CDGC 1JGVH 1UEMA 5FOJA 5EUKB 3MGOA 3MV9D 5D70L 3WLBB 3DGCR 2ZUTA 1KBGH 1V05A 4LEXL 3EYUL 5C09D 1MCPH 2DWEB 3WUWA 4LVOC 3WS6C 5IIEB 3LN4A 3MLZL 1HEZB 1VESA 1XIWA 1UM4H 1A6TB 3KPOB 3PUCA 3EJYC 3WDHA 4RGND 4DW2L 1H3VA 2GK2A 3MRFB 4LFHD 3VFRA 2UWEA 1HHIA 4H1LG 3NFPB 4CU8A 2P49B 1NSNH 3O3EB 4UB0H 5C0AD 4PRIA 3V0WL 3HS0A 5I1KL 5J13B 5KZCD 2C3WA 4FQLL 1YEIL 1DQDL 3FT3B 2F53E 2XTLA 4EVNB 4U6YA 3LHPH 4CN1A 5HPOA 4MNGA 4OQ1A 3WXWL 3T0EC 3ETBF 3HNSH 4D9QE 4NBZB 4Y16C 2BNQD 2F54A 2BNRD 4WU5B 3DX9A 3KDMB 4EUPG 2HH0H 3TT3H 1T22B 1NMAL 4PREA 3WN5C 3PWVA 2FX7H 1KJ2H 4JKMA 3RWGA 3TBVB 3PWUA 4XH2B 4MA1C 4DKDC 4APQB 2RIKA 3VWJA 1I1AD 4G7YH 4GQPH 4M7ZB 2DI9A 4P5KB 2GHWB 2BC4A 1OOAA 2NMSA 3O45A 3LPWA 5T1LB 4FFVC 4NKMB 1AHWB 5K9QI 4LLQA 1QZ1A 1H5BA 4NQSA 5HYJD 1Z3GH 4QNPF 2VDNL 1A21A 5SV4A 3SDYL 4D8PB 2FB4H 4NKDB 1D5ZA 5C92A 3KPPA 3CFBA 3C5ZA 3GM0A 1Q1JH 4ZS7L 5B4MD 1O5DT 1R6VA 3L5HA 3CXDH 4MD5B 3JV4B 4XNZC 2ZG2A 3BSZL 1A3RL 4M7KH 1R3HA 3KJ6L 4HZLB 4OB5H 3UEZA 1IGMH 3ELAT 4OTXL 2XZAL 1X5IA 3K4DA 3FO2A 1YDPA 2ARWA 3TH3T 5LGHL 3RPKA 4NT6A 3RDTD 2YBRA 2DQJL 1QBMH 2A6DA 1IKFH 5T3XD 4G42B 3HPLA 2X4PB 3HFML 3KLAA 4NZDA 3O6FC 3MXWH 2GCYB 1UXWB 4KUZH 4FTVE 3X12B 1J1XH 2HTKD 3LKPB 4PLOB 4ZNCD 2X9YA 3LPFA 2GITA 2KH2B 3QWRA 1FZOB 4J3UA 5A1AA 1MHPL 3CFIC 5EU3B 4M48H 2BNUA 2LE9A 5HYIA 2M8XA 3T3PF 3H7BA 4HJJH 1CK0L 2F8OA 5JDSB 4YXLL 2DQUH 5DJAB 4LLWA 4QXGH 1GIGH 3OG6B 4MS8C 5DQJB 1OM3L 3WS3B 3MRNB 4HFUL 4QWWC 5I71C 4RWYL 1FZJA 1D5BA 3AS2A 4JM2B 2D3VA 2GJ6A 4H88H 4TULH 1H0DA 3C08L 3OMZA 1K8DA 5MHSD 2DQDL 4NO2B 5D70H 4LNVA 1FL6B 4JFHD 4LEXH 3EYUH 5SX5H 3PV6A 2Z31D 4X6DA 5HHMB 4JFDE 2DS4A 3VFPB 3MLZH 1OTTD 1FNGB 2YC1A 3EYVA 1MIML 1OAUL 4Y5XC 4V1DD 5BVPL 3FQTB 3IAQA 1DBBL 1S7TB 3QIWC 5C0RH 1A1OB 1DCLA 4X6FA 3MCLL 1AH1A 2B1AL 3MREB 1RJLB 3V0WH 4OJFL 4FQLH 1DQDH 4WI4A 4BA8A 4WI9A 2VABA 4Z7VB 3OKDA 4TNVK 1U8HA 4LHUA 2FWOB 3WXWH 1C12A 1LP9E 1AGDB 1V3JA 3Q2CA 5BVJB 2VDMH 1NC2D 1NMAH 2BVQB 1VKXA 2WBJB 4I2XE 5FM8A 1T7WA 1KG0A 1FQ9C 3H2WA 2COQA 3GB7A 4PBWD 5DRWB 1I7ZA 2Z93B 3BKCL 1CG9B 4D9QD 5DMGD 2VDNH 4WWID 3BN3B 3PQYB 3SDYH 3QUZA 1TFHA 5I18L 3L5WA 5IB3B 4QRQA 1A7RL 2WSKA 2DQIL 4ZS7H 3B9KA 2X7LA 5I15L 3P73A 1G7IB 4FN0A 3GFUA 2P5WD 1ZT7B 4ZPTA 3BSZH 1A3RH 4ZUWA 3KJ6H 1UJTA 1R24A 4OTXH 5EO0A 1MQKL 2XZAH 3GGWA 3QO1A 5LGHH 4YO0B 1IZKA 3AM8A 5HGBA 4DQOL 2DQJH 5MERA 2FHBA 2Q6WB 1F4YL 3HFMH 4AT6A 1T89A 1BREA 2IMNA 1DEDA 4X7TA 1IAKB 3QNXA 1Q72L 3L95B 1QRKA 5JUEL 5CP3H 2JF1A 3V0VA 1C5BL 3P4OA 4DZBA 3VWKB 2YD5A 1ZA6B 1MREL 3QG6A 1MHPH 1NMCB 2CLVA 1T2XA 3BO8A 1B9ZA 4CMHC 1CK0H 4HIIB 1UA6L 1N4XL 2FSEB 2E7LA 3ARFC 4WHYH 4YXLH 5DR5L 1RZ7L 4PR5A 3BP5B 1ODAA 3N1PC 5GGVY 4FTVD 4WHTA 1VENA 4AY0A 4IS6A 4AZ8A 1YC8A 4HFUH 1DUZA 3NPSB 3ZKMC 4RWYH 1NGXB 3W39A 1CYGA 5EOTB 3C08H 2J8UA 2DQDH 4RNRB 2VLJD 4NN5C 5GGUA 4PGBB 3T1FB 1A6ZB 4BYHA 4EJ1C 2HT2C 3DOSA 2DL9A 3FB6A 3IDJB 1FZMA 2W91A 3GO1L 4KKLC 1XF5B 4FQIL 4I4WA 1YNTB 3CMGA 2P44B 4LSVL 5D6CB 1MIMH 1OAUH 2WIMA 1J18A 5ICYA 3B9AA 5GS0C 3S36L 5E2TL 4HGMA 5BVPH 4GAYB 1DBBH 4PJBA 5GS1B 1PFCA 3ARBC 5DQ9B 2B1AH 3L3GA 3WLWC 4PYHA 5E70A 2DOCA 5TE4L 2DYPA 4OJFH 4AEIL 4FOMA 5E6YA 2XV6B 3P9MB 5HVWA 3SCMB 1DUYB 5CSZB 4K9EC 5FGCE 4S2SB 1QUNA 4PJ8C 4C55A 4U3HA 4Y19B 2HTLD 1R5WB 1UVQA 2DRUA 4IRSA 3AFLA 2DLHA 5EU6E 1JIBA 4E41A 2XRAL 3MJ7B 5H35A 4JFEA 1PLGH 3GUTA 4XRCA 3EBAA 3H0TB 2R1XA 5LVEA 3MYJB 2HFEA 2IAMB 3D0LB 3BKCH 2QSVA 4NHCL 4Y5VC 5ELIA 1IVLA 1HOCA 4PRBA 1INQB 3TYFB 1LGVA 3VJ6B 5I18H 3DBXA 3AROA 1TQBB 1A7RH 3MRQA 1NGZA 3CFKA 2DQIH 1IILE 5I15H 2HYMA 3IXTA 2P48B 1VCAA 4U6TA 4P2OB 3SKUD 1FL5B 1ITBB 5KANG 2AXGB 2EH8L 2WWKT 1MWAB 1MQKH 4DGVL 4J3SA 4F80A 3ULUC 3I6KA 2JJUA 4FQHA 2EC9U 4JN2B 4FHBD 1AXSB 3O8XB 1F4YH 3TVMC 3BEWB 1YMMB 4RA3A 3BDBA 1AKJA 3T0XA 2UWEE 4RFNC 3V6BR 4HFWB 5BMFL 5JUEH 1BJ8A 3RWJB 3HE7B 5HYQA 3E6HA 3RL2A 1X5YA 2OJEB 4LKXA 4J4PC 4PRIE 3VXQB 1MREH 1WT5A 1QLFA 3ARGD 3MJ8A 4EZMA 1OF2B 3T09A 4KKAC 5FA3A 2DBJA 2WBWB 2G9HA 5DD6B 1N4XH 4LRNL 1NMBL 3BN9D 2R29H 5I16A 5KVEL 5DR5H 5CEYA 1U3HD 1YJDC 3NA4A 3QAZB 5CD3A 3QNYA 4P4KB 3C09B 2AV7B 4MSWA 2ZOKB 2UY6A 4XTRC 1GZPB 1KJMA 1HSBA 1EDQA 4OBRA 3DRQB 1CFSB 1TJIL 2JCCB 3QXVA 3GO1H 1BGXL 1T66D 3BIKB 1WCQA 4FQIH 1B0RB 4OLUL 1PEWA 4PJGF 3TN0C 4LSVH 1F3JB 3BI9X 3CX2A 1DN0A 3VXNA 4BZ2L 1LQSR 3S36H 5E2TH 4RMRA 3RVTD 5C09A 1XIWB 1PVHA 4TNVF 2VQ1B 3B2VL 4MAYD 12E8L 1P84K 4ODXB 3T4YA 3VFRB 1IGYA 1FP5A 4DTGL 5TE4H 2VWEE 4YXHL 3QEQB 3CJJA 4PP2B 5EUOA 4AEIH 5KG9A 3GZKA 5FDWA 3TCXA 2XTJD 3HS0B 5IW3A 3O9WC 2XWBA 4GRWF 2VXQL 2HJKB 4MNGB 1G9MC 1BVKB 4POZD 4P46B 4DAGL 2GSIA 4R4FL 5JW4M 1XGQA 5E6IA 2F54B 3DX9B 3BH8A 1MHHA 2XRAH 3M07A 4F58L 1Y6MR 4NQXA 2ICWJ 2XZQL 2NXYC 3OPZL 3CU1A 4G8IA 4X98A 3TNMB 5MEOA 2VR9A 3PHQA 4XB8A 1TJGL 2X1PA 1CFVL 3UAJC 3VWJB 2G60L 1P2CA 4BSJA 2DJ4A 4R0LA 1T7YA 3C60D 4OGAD 3MUZ1 2BC4B 2RFXA 3OKOA 2NY6D 2FD6L 4NHCH 4PGZA 1S8DA 4NQTA 4FFWC 3ZKND 1TNNA 3FB7A 5DD1L 1N8ZB 4LLQB 1CTNA 2B1HH 4PJAB 1U93A 2GJ6E 2APBA 2IJ0C 4F7CB 1R3IL 2H2PD 3HMWL 4N0FB 4LMQE 2EDQA 4NO3A 5TH2A 5EU6D 2EO9A 4OM1L 3LS4L 1XZ0B 4JJHA 4E5XA 3EDDA 3KPPB 4FMKA 1KELL 3QXDB 3AY4A 4JDZA 3D85B 5J13C 3HI5L 1JGLL 4DGVH 5DO2D 4P3DB 4OZFB 2PO6C 5IB4A 1BZQK 3QUMB 1YDPB 2Q20A 3RWDB 2EDKA 2X2YA 2YBRB 4QRPB 1AP2A 3QUXD 3VGAC 1BBJB 4N5ED 2E9JA 4LSTH 1CBVL 4BK5A 1JI1A 5F9OL 2O5ZL 1U0QA 3KPMA 1U8NA 5B38A 2H1PL 4Y2DD 3PL6C 1J8HA 4LRNH 1NMBH 1V7ML 4F8TA 2E27L 4HPOH 3VD9A 3O81A 5KVEH 1S7UB 1NCWL 4C54A 1C1EL 4ZFFB 4WDIA 2NXZD 4N0CD 5D9SB 4O02L 2GUOA 2VB5A 2CUIA 4LRIA 1FZJB 5IM7A 4C4KT 1T03L 4LP5A 4FABL 2BCKA 4I1NB 4P2YA 1TJIH 4KJQD 1BGXH 3VFVB 5I8CA 4NKOB 5HBBA 1ADQL 1BD2D 1MHCA 2QTEA 4OLUH 4FQQB 3FZUD 1NEUA 3TJHD 1ZS8B 1ZVYA 3PV6B 4X6DB 5DGQA 1LMKA 4P49A 4OKVA 3ILPB 1RSFA 3EYVB 4R4NC 5DTFB 3B2VH 1U95B 1JK8B 1KCVL 12E8H 1Q9KA 2CRIA 4Y1AA 3EYOA 3JUYA 4N0YL 4HKJA 4C56A 4LCWE 5GSRA 4DTGH 2ERJB 3EO0A 3NIGF 4YXHH 5J89A 1KOAA 4XMKL 3UBXI 3DPBA 3G08A 3HR5B 1IARB 5CMAB 2VABB 4PLKD 1AR1D 3U30C 2VXQH 1QTYT 3OKDB 3CZFA 1U8HB 3BIBX 1NAMB 3QI9B 4LHUB 1RZGA 1C12B 2NY5L 1RMFH 4XCEB 4DAGH 4QRSB 4BQBA 4R4FH 4PB9L 3B9EA 3TBWB 4CADA 4ERSL 3FO9A 4GBXA 1T2QL 3ZT5A 1GGIL 4F58H 4KKCC 2BSTB 4WUUA 4X7FC 2XZQH 6FABL 4N1HB 3OPZH 1TJGH 2BSED 1CFVH 3SO3B 2G60H 3RZCB 1HIML 3IVKB 3ZHDA 1MAJA 5ITFB 3FQUA 2BSSA 1HQRA 4YBHA 1T6VN 4J1UA 3WEXA 5DD1H 5C08B 2J5LC 1R3IH 5IEKA 4EXKA 2J8UE 2EDDA 4HUWA 1EMTL 4KRPC 4OM1H 3LS4H 4JE4B 4MWFB 4QRQB 4NO0D 3P9WB 5HI3D 3VG9C 4JJ5A 1TTFA 3B9KB 3HI5H 3P73B 1JGLH 1HQ4B 2YHGA 4ZPTB 4PFEA 4KVCH 3KLHC 4ZUWB 1I3VA 4K07A 5FF6A 1YY9C 5EO0B 2NY3C 1PKQA 2VSDA 2OTWB 4NRXA 1MFEL 1GGTA 4LL9A 3FT4A 4EN3D 5E03A 5MERB 2VZTA 2MHAA 4PJBE 2Z8SA 2WBJC 1CBVH 1F6AB 2GTZB 1KV3A 4LASH 3QNXB 5JORA 1BOYA 5F9OH 2O5ZH 3V0VB 2YEZB 3O11A 4R8WL 4YHOL 2H1PH 2XFXA 1RJYB 1HYRC 4NC2B 1MAML 2GT9B 4AIOA 4PJ5D 5I8EA 2KZWA 1V7MH 3DURA 4M9OA 2OK0L 2E27H 1XCQB 1CD0A 2DMBA 1ZHLA 1NCWH 3CVHA 4M8VA 1OSPL 2C26A 1C1EH 4NQED 4GG8A 5F7KC 4E41E 5C6TL 1RZIA 1D9KC 4H1LA 4O02H 4WHTB 2Z4QA 2JIXD 2FH6A 4IS6B 2ZNWA 4J7RA 3FRPA 3VGHA 1T03H 4FABH 1I1RA 5I1LB 2YPLA 1MOEA 3DUHA 5J1SC 3UBXA 4L4JA 1BP3B 5GGUB 1JGUL 5J6HA 1ADQH 4GRLA 3SDDC 3TBTA 5L9DL 1FZMB 3M1BB 4OD1L 4HUUA 1UCTA 4I0PA 3SDXF 3PWPA 3U4BL 4TSAH 4I4WB 4EUPA 5E9DA 3W0WD 1K4CA 3UZQA 3VWKC 5DC4B 1KCVH 1TJHL 2JJSA 2YRPA 5ICYB 1ZEAL 3RVWC 4S11A 2DM3A 3OG4B 1T7XA 1M1SA 4N0YH 3MRCB 4XPBL 4F9PC 1CXKA 1JPST 5JR1L 1F13A 1XF4A 4LCYA 3L3GB 3FQWA 4XMKH 2P45B 5I6XB 1VADB 5A2KH 3BEVB 4JLRB 4RGMC 2VN7A 3DHJA 5J4MA 5C70A 3QCVL 4LF3A 4WTZG 2YUWA 1Q8MA 5IW1A 2P7TB 2NY5H 1UGNA 1KTLB 4AEHH 2CLRA 4PB9H 4ERSH 2EEAA 2IFGA 4LGRB 4ODUB 1T2QH 1UVQB 2NY1B 3WHXA 3BKJL 1GGIH 1PKOA 4LCWD 3GMOA 6FABH 4YHYC 3T2QA 5ETUB 3VRJA 1ORQB 3OX8B 5DS8A 2H41A 1K5NB 5B39B 4P9HL 1HIMH 2VDQL 3O0RL 4JFEB 2W07A 3GUTB 3MRPA 4KRLB 3V8OA 2I9LA 4X4YA 2HFEB 3MZTA 3NCYS 2R0LL 3CVHL 1G9NC 3PWNB 1HOCB 4Q2ZA 5ESQB 1BF8A 1EMTH 1AGBB 4WWKD 3KXFA 3MRQB 1NGZB 2NY0B 1KB9J 3IJYA 4ACPA 2ATPB 1J0IA 4FQCL 4PBXA 1OP5H 1NC4B 3LRSB 1UZ6E 5F9DC 3UO1H 1OPGL 2XY1A 1MFEH 4FQHB 2BX5A 2PYFA 3BXNA 1WFUA 4MXWL 3B83A 4UBDD 4BK4A 5J1TC 5KOMC 4NQDA 4HV8A 3TO4B 4Q7DA 3DWTA 5HYQB 4R8WH 4YHOH 3ZLQC 3RWCA 1YUHB 2XN9D 3NGBC 2HLAA 4UV4L 5A2FA 1QVOA 4LKXB 1MAMH 2P8LA 3GSRA 4PTUB 4QNPE 1MRFL 2C3XA 4LU5L 1A1NA 1I3RA 4PJGA 2OK0H 1BFOA 4PTTA 5FA3B 2OL3L 3ZYZA 3DNKA 3A67L 1AXTL 3WFHA 3ARGA 1ZANL 3QJFA 5B22A 3MUY1 2RBLA 4R90L 4JPIA 1OSPH 5CEYB 4FXGB 2Y5EA 4OI7A 5FV2A 5C6TH 2CD0A 4P23C 5ESAA 4QYOB 4OIIL 4P2OC 5MEPA 1PY9A 3QNYB 4E42A 4N90D 3DTXA 1SMAA 2NY2B 1IGFL 5LAXA 4U1MA 1B2WL 5EU7C 1KJMB 4UDTB 1HSBB 1JGUH 3CU7A 2MCG1 3DO7A 4HXAL 5L9DH 3OJ2C 4OD1H 4K3EL 3DMMC 1WIPA 2HFGL 1JNJA 4FG6C 3U4BH 4QRRE 4ZAKA 3PDOA 2HJFA 4HWNA 1JYVA 4O4YL 4JM4L 3ABZA 4ZSOE 3MV9B 3VXNB 1TJHH 3QUYD 1ZEAH 5C09B 4F33B 4YDLB 1EBAA 4XPBH 5KVFL 2Y7QA 5TF1L 5JR1H 3MACL 1ZOXA 3L5JA 1IGYB 2YD9A 4RGNB 5EOCJ 2W60A 2CIKA 3BP6A 3LIZL 4YDIL 3QCVH 1YPZF 5EUOB 5KG9B 5TDNA 3CSGA 5C0AB 1CGUA 4OLVL 5KAQG 3HB3D 2XKNA 5KZCB 5EH1A 4XCCL 4CKVX 2NZ9C 4ELKB 2CLZA 3HE6C 3BKJH 2EYTB 3UC0L 1EEZB 3S35L 4PV9A 5FB8A 2GSIB 4G8EA 1J8HE 2FR4B 3BGAA 3MGTA 3ARWA 3K8LA 3G6JF 4HS6B 4NQXB 4P9HH 2VDQH 2VOTA 2BNQB 3ILQC 2BNRB 3O0RH 4PD4J 3SJVD 5IHLB 5MEOB 3PHQB 3MC0A 3NCYP 4NNPL 3HZKA 3VXRD 4I18C 3Q6FA 4R0LB 3CPLA 4NNYA 3UCRA 1I1AB 3R8BB 2R0LH 2X4UB 3CVHH 5D6DA 5EULV 4HMEA 4L29A 4LPVA 2HT3D 3FB7B 3C60A 1MRDL 5IQ9A 1FVEA 2IH1A 4YZFF 4H1LH 4Z7NF 2QQKL 5CGTA 2AV1A 1U91B 5KANI 4XP4L 4E5XB 1IT9H 4FQCH 5HYJB 4OGYL 1AE6L 5B3NA 4BUGA 2JJTA 1G0YR 1OPGH 3INUL 5E1AA 5DJ0B 3LD8B 1BECA 1YZZA 15C8L 2H26B 3SGKA 1WF5A 4O00A 4ONOA 5KSAA 4P46C 2IQ9L 4L4TA 4Y1AE 4MXWH 5GRYA 4EUPH 3GNMH 1U8JA 1L0QA 1AIFA 1AP2B 3NZ8B 4R7NA 3GIZL 5FKPA 3RDTB 3ZZ1A 1RI8A 1SJHA 2V5YA 4UV4H 5MEQB 3QUXA 3V7MA 3B5TA 5EU5A 2YR3A 2WIIA 5I30L 1KPVA 4CUCA 1MRFH 1WGOA 1OGAD 3GSVA 4LU5H 2MMXA 2ITCA 1U8NB 2FHFA 3K2UL 1IEBA 2OL3H 5F3HB 4JFYA 3A67H 1AXTH 1ZANH 3MBEA 3MNZA 1KTDB 4R90H 5LCVL 5JW3L 3VRIB 1LO5A 4KXZI 3MO1A 4LDOB 2Y06L 2PUQT 3I75B 4HUXA 4B0MM 3MRBB 4WUUE 3DV4A 1GOGA 4OIIH 4ZODA 1OSZA 1F8TL 1PX3A 4WDIB 3BP7A 1QR1B 5EIIA 5I76A 1JRHI 5E94A 1IGFH 2GUOB 4ELMB 5F7UA 4TNWK 4MDIB 1B2WH 2C1OB 3E1F1 5IM7B 3HUJF 4HXAH 3CX5K 2BCKB 4F9LA 4KWUA 1DQML 4K3EH 2NTSP 1ACYL 3RI5F 3IAPA 2HFGH 3GJFB 4YGVA 1IBGL 4O4YH 5IVOA 4U1SA 4JM4H 2VZSA 4NFDA 4OAWA 2NY4C 2N7AA 5D2NB 1NKOA 4MZ2A 4RMUA 3H9SD 1RU9L 3W9EA 4JFPA 2Z31B 5E08L 5KVFH 4JFFE 4TUKL 1Q9KB 5TF1H 3EYOB 3MACH 1PKQE 4HKJB 3S37L 5GSRB 3EO0B 3LIZH 4W70A 4MNHA 4V1DB 5T5FL 4YDIH 4HUKB 1OP9A 1L9NA 1QA9B 3VXSA 2G5RA 5IV2B 3G08B 1PJ9A 5E8OA 4AK1A 4QHNA 1KULA 5AD0A 4ETYA 4Z76A 1QRNE 3ESVF 4O2CA 1IAOA 2FLRT 3CZFB 4XCCH 1KC5L 3V6OA 1RZGB 1F90H 3FTGA 3UC0H 3F12A 3S35H 1RHFA 1WBZA 3CSYA 3TF7C 5CWSA 4PJEB 1EPFA 1MFCH 5I8KL 3OGOE 3HCVA 3KAAA 1CICC 1OTUD 1NC2B 1OGTA 1PY4A 4DK6A 3UYOD 4YNYB 1KPRA 1I3GL 3FQUB 2V9RA 4NBXB 3OR6A 1ZHNA 1NCDL 1MRDH 3V7AE 1FVCB 4LCUB 4OLXL 5IEKB 1HDMA 2ERJC 1XF2A 1HZHL 1FNEA 4XP4H 1L0YA 5EPMA 1I4FB 5F1NB 5FDYA 4OGYH 4W4OA 2UZYB 1AE6H 5F7YC 5JXEC 1UQSA 3ARDC 1OAQL 3INUH 2ADFL 5GS2D 3PWPE 3BUYB 3NVQA 2ZOLB 5BRZE 4I3RL 4GRWH 15C8H 2X4QB 5E9DE 3QFDA 3G5ZA 1CLYL 1Z0NA 2P5WB 1HHGA 2IQ9H 4M00A 1A9EA 4XBEL 2IANA 1H8SA 3TZVD 2Y6SD 1AXIB 1QSEA 3B3IA 3GIZH 4EN3A 4A6YB 3BHBA 2QJDA 5JORB 3I84A 2VZUA 5MI0B 3GSNB 3SO3C 4N0UB 5I30H 3O11B 3UPAA 2FDBP 3BISA 3BWAA 3KYAA 1M4KA 3K2UH 3WV0A 4K8RH 3SDXA 3OJDA 3CFDA 1HWHB 3HI1A 3DURB 5LCVH 4HUVA 5JW3H 5FCUL 5FECB 2AABL 2Y06H 2E3VA 3ARZA 25C8L 1X4YA 1HHKB 3EJYD 3F7RA 4TQEH 1NBYB 1F8TH 4OLEA 1CDUA 5BW7A 1QBAA 2Z4QB 4WFGD 3ISWA 4OI8A 1I9IL 1U3JA 3ARVA 4Z7QF 5JQ6L 5GGRY 2GK0B 5H2BB 1WFTA 1JNHB 2C3VB 2D7TL 1DQMH 3UBXB 1ACYH 1NGWB 3STLB 1BFSA 1P4IL 5J6HB 4GRLB 1RUPL 2D7QA 1F11A 2EDXA 1IBGH 4B5EA 2VLJB 1LE5A 3T0ED 3KXFE 4S1QL 4PY7B 1BZ7B 1U36A 5SWSA 3T65A 1G7JB 1RU9H 4L9LC 3ORJA 1DLHB 2A2QT 4KGJA 5HJ3B 4G6AD 3RY6A 5E08H 2EC9T 4Y8DC 1KTKE 3MNWB 3DUSA 2KQNA 4TUKH 4KI5E 3S37H 3BVNB 4R4BA 2FJFB 2VR5A 5EZLB 1KT2A 5T5FH 1XF4B 4LCYB 5C0BD 1EH9A 3GI8L 5FA4A 1HYSC 1OAXL 5ICXB 4J3XA 1S5HA 3D39A 1BM3L 4NQDE 5EBGA 2OXHA 1G0DA 5KAQF 5CCKL 5GRWA 4LP4A 4JO4L 5C1MB 4P2QE 1KC5H 1FPTL 1KIRA 2Y5TB 2CLRB 4OD3L 3VFTB 4KHTL 3DHMA 1NCNA 3JWDC 2EKJA 5JNYA 5I8KH 1I85C 2QR0B 3KGRA 4HKXB 5L0QC 5CZKA 2YD1A 3EDJA 4NGHL 3KPRD 5FYLL 3GMPA 3MFGB 3WIHA 4NZJA 3QDGA 3MRPB 5ITBL 4JG0L 3MOQA 2XOTA 1HSAB 1NCDH 2I9LB 3MTRA 3S88L 2VZVA 3OAYK 4Z77B 4OLXH 1JFQL 4JKPL 5DRXA 4Q2ZB 1HZHH 4TSCL 4F7EA 4IJ3C 1FFOA 2EZ0C 4GRWE 4R26L 4MD4A 1RJCA 4NC0B 3IJYB 4JANB 5GGRB 1OAQH 2ADFH 3MRDA 3LKRA 3P9LB 1G7HA 4I3RH 1IFHL 4XCNA 4XPHL 1CLYH 2EDYA 5FM5O 2MQCA 1ZV5A 3S8WA 2VLKA 4XBEH 5B8CA 2UZIL 2PYFB 4ZUSB 3NBNA 1HHJB 1U9KA 3DRTA 4DKEL 2BY3A 1S7SA 4UTBL 2XI9A 1EK3A 3HC0B 2B5IB 3PWJA 1QVOB 1UJ3C 3AC0A 3K4AA 3GSRB 2P8LB 3OKLA 4KKBC 4OQTA 3MRLA 4K7PY 2XN9A 1A1NB 4NJ9L 2X4RB 1I3RB 4YAQB 1U42A 4TNWF 1BFOB 2EEDA 4PTTB 5FCUH 2AABH 3JUZA 5L2KD 3ARGB 1QEWA 1YMHA 1FVDA 25C8H 5INCB 1UG9A 2NY0C 4HKZA 1HE7A 1U58A 2XXMB 1T4KA 2AS5M 3QIWD 4NN6C 3SOBL 4K7PX 2D4FA 5JQ6H 2BVTA 4E42B 3DTXB 1YPZA 2YZ8A 5LAXB 4NO5A 1U8MB 3WMSA 2D7TH 5C9JB 1NFDB 4L8CA 3T77A 3V6ZB 3G9VA 3DO7B 1P4IH 1RUPH 1TVHB 4G8GA 5C07E 4Y4HC 3PXHA 4PJ7B 4M6ML 5HHQA 3IDMB 3ULVC 4S1QH 1OTSC 4U3CA 2CKBA 3OXSB 4JHZA 4XZUB 1WFOA 5DZLA 1T0MA 3G6JA 1BVLB 1OARL 4HAFA 2R9HD 4AH2A 5H8DA 5FHAL 4RMQA 1TZIA 4WTXA 2HVKB 2XNAB 1CE6A 2Y7QB 2KKQA 3IDIA 4MAYB 4P5TA 3JSSA 3SE8L 5JOFB 3GI8H 4L4TE 4CVZB 1OAXH 2EDJA 3FFCD 5L2JB 1BM3H 2VLME 4KXZH 2JE8A 5CCKH 4JO4H 3V4VH 3R0MA 3QFJA 2D7MA 3VFWB 5J57B 1FPTH 4PGDA 3ZE1E 2XKNB 4OD3H 2NY2C 2XTJB 3KPLA 4KHTH 4RQQA 3BZDA 2CRYA 5E8NA 1WEJL 2O5XL 4KI5D 4HC1A 4PV9B 3VFMA 1CDBA 5EZOL 3TWCL 4G8EB 4QRUA 4NGHH 4PRHA 3OKKA 4JZNB 5FYLH 4XI5D 2EXYC 3HAEG 1FNSL 4KQ3L 5DJYB 3BE1L 3S96B 5MP6L 5ITBH 4JG0H 2X4NA 3OKMA 1ND0B 3QHFH 4BH7B 3SJVA 1WBXA 3Q6FB 3NIGE 1DBML 2M2DA 3S88H 5HHPA 3C6LC 1JFQH 4XCYA 4JKPH 4L29B 2OZ4A 4MJID 1VERA 3C60B 4TSCH 5K9JL 1FVEB 4JKKA 2NY6B 2VITB 5GGSY 5HYEA 3PIQB 5T1KD 4OCMC 2AV1B 4R26H 4K23L 1UWEL 1VB9A 1NGYA 1IFHH 2P5EA 2Q76B 4XPHH 2EKSA 1N3NA 1JP5A 1GC1C 1DQLL 1EXUA 3ARFD 3F62A 4JY6A 3BMWA 1FG9C 1A8JH 4YFLF 3KYMA 2O93L 1II4E 2UZIH 2CKBL 3ZKMD 4CN6A 4DKEH 1QYGL 4UTBH 3HUJA 4R7NB 3RTQA 5BZDA 1JWSB 3ARXA 5EBMA 5FUZL 3GSQA 3QUXB 43C9B 1WZ1L 2HT2D 3NZHL 4NJ9H 3N06B 4KKLD 4G9DA 1I1AC 3BPLB 2RCSL 1G7PB 4ZUTA 3IU3B 4EQ3A 3MBEB 3MNZB 4Y2DB 4XC3L 5TGBA 2MJWA 2AEWA 4LLVA 3FO0L 2PNDA 3FN9A 1LO5B 5GS0D 2BOCA 5TDOA 4Q74A 1PZ5A 3MV7E 2WP3T 1DR9A 3GIVB 3L1OH 3ARBD 4WJ5A 2AKRA 3SOBH 5D7JA 3WLWD 5I76B 5E94B 4OZIB 2V2WA 4HC1L 1BWMA 2CDEA 4KRMB 2ENYA 5AUMB 1XGUA 2NXZB 4WTZA 5DJXA 3CDGA 5DK3A 2VN4A 1ZVSA 2DQHL 3MA7B 4HK3N 1ED3B 1F45A 1MCWM 4Q0XL 4JEGB 4M6MH 1D5MA 3TIDA 3MLTB 4PJ8D 4XVTL 4MQ7A 3RDTC 4U1SB 4WO4A 1BD2B 2OZ4L 1OARH 5GGSB 5FHAH 5LG1A 2VKXA 3MSPA 4L3ED 1NH6A 1E27B 2C3HA 2V6HA 5DK0B 1CWVA 4UI2A 1QQDA 3IAGC 3A6OA 3SE8H 4MNHB 2FL5B 3HG1E 1IE5A 4WW2C 1U8OB 1QSEE 3P4LA 4HLZG 1EFXD 4WI7A 5AD0B 2EXWD 5SWQB 2ZUWA 4Z76B 4O2CB 1JPGA 4JQVA 5FYLE 1WEJH 1CLCA 5IFHL 1UB6A 1TNMA 5EZOH 3TWCH 1WBZB 2E9IA 1RZJC 4WFEE 3M8OL 4M7JL 4AENA 4O5LL 2D2OA 3VE0B 1J0YA 1KYOK 1X5FA 1R5IA 1JHTA 3HCVB 1LILA 1FNSH 4KQ3H 3BE1H 1W0WB 5MP6H 2IADA 5IMMA 2FNBA 1OT2A 1BLNB 5GSVA 4U49A 1DBMH 4YLQT 3D25A 4X9IA 2AGJL 5E8EA 5JXAH 4QXTB 2Z31C 4B7IA 1ZHNB 5K9JH 1WWCA 2XICA 2MQ3A 3QO0A 4TVPD 1OTTC 4WUKL 4J4PD 3KNBA 4K23H 3HZYA 5EPMB 1UWEH 5F7LB 1XAUA 3HNTL 2J4WH 1P4BL 4HG4K 1MH5A 4S0SD 4HCRA 4OUOA 3JWOC 4LDLB 4YJZL 1DQLH 4XX1G 4NO0B 1NUGA 3QEHB 3O3DA 4Z7UE 3PDGA 5SWSE 2VAAA 3VXPA 4MCZB 1N26A 2FEEI 1CI5A 1K2DA 4NSKA 4YHIA 3EGSA 5IK3B 2CKBH 5D5MB 3ULUF 5HGGS 4XTRD 5FO7A 5FUZH 4EN3B 3TZVA 3BHBB 1WZ1H 5HDBF 2AJSL 3ZYJA 4LLUA 3WKML 3NZHH 4GKZA 3D39E 1S7QA 2EDEA 2RCSH 3SDXB 3S36X 2R8SL 3CFDB 3HI1B 5K9OA 3BOVA 4XC3H 4G6FD 5F7EH 3FO0H 5ID1B 1Q9OA 4PJ5B 1KN4L 5CHNA 3X13A 3UYPA 3WS6A 5IHZB 3MRKA 3PJSA 2Q87A 4M7LL 3B4NA 3MRHA 3X11A 5AYUL 4HC1H 4DN3L 5CEZD 2EDLA 4NQEB 4K94L 2V5RA 3H8NA 4UIMA 2DQHH 2JIXB 1CGVA 3NN8A 4MA3B 5IHUH 4Q0XH 3PP3K 5EIQA 1M7IB 4O2EB 4HS8H 3O9WD 3BRDA 2NCMA 3OKYA 1N6UA 2X10A 4HIHA 4XVTH 5I9QB 2X5PA 5DQDL 1F3RB 1VGKB 2E5EA 3RGHA 2EDHA 3O4OB 1PEZA 2OZ4H 5MI0C 3T65B 5FGBA 3BRGC 2B7DT 3F6IA 4OFYA 1ZVHA 3T0EA 5I73B 3TCLA 2C9AA 4Y16A 2NXYD 3BGFB 3W0WB 3NA9L 3WN5A 4ODSL 3NCEB 1U3ZA 4LSPL 2KPNA 4U31A 3BKML 5C0CA 3HRZA 1SYSB 4FFWD 3MX0A 1MF2L 4FQ2L 4QOKA 1YA5A 1RY7B 3C5SB 4GW4B 5FA4B 1VSCA 3L3KB 5C2BL 5C0BA 3EDKA 4JRWA 3GSXA 1S5HB 5ILTL 1T1WB 4FP8H 43CAB 4HT1L 4G3YL 5IFHH 3KLDA 1KIRB 2D9QB 1G7MA 2QQLL 3VXTA 5JNYB 5CEXA 3M8OH 2R23A 4M7JH 4O5LH 1DVFD 1JN6A 4PJXE 3KYNA 1OL0A 2R56L 4MJ5A 1X5JA 1HINL 3RQ3A 3WDIA 4QLRA 2PO6D 4LCWB 1L7TL 1A6AA 3E2HB 5DJCA 4XBGB 5FIEA 5KSVA 3BZFB 1I7RA 2V9TA 2NX5A 2AGJH 3DI3B 1ORSA 3NH7L 1YPZE 4WUKH 1KJ3L 2HFFA 1E4XI 1DBJL 5DRXB 5DF0A 3O6FA 1KLGA 4F7EB 4MJ6A 3HNTH 1P4BH 1WC7B 1BHGA 3PL6D 3QDMA 3MLSL 1SEBA 1X6LA 1O7VA 1T1XB 4NQCA 4WWKB 4Y5YB 4C59B 5IB2A 4JKWA 4YFLI 1G7HB 4NRZB 4TUOA 5E2WL 1QD0A 1Z5LA 3K8MA 4P2RD 3RWFA 1I8KA 3G6JE 5IVNA 5E00A 1U8IB 3FQRA 1MVUB 4G7VL 3AU1B 4ZPVA 5D1QC 4I3SL 1MNUL 1KB5L 5DUBB 2HTLC 1MJJA 1OLZA 3SQBA 3HTLX 4YFEA 2AJSH 4X83A 3WKMH 2VERN 3PWJB 4LEOA 2Q3ZA 1ZLUH 5BQ7A 4CAGA 3VH8A 4YZFE 3RKPA 3T04D 2ICWI 2R8SH 4IRJC 3QFJE 4X5WB 2XN9B 1XF3B 1FYTD 5DVNA 4L4VD 3C5JA 3ME0A 1KN4H 2LAAA 2C7UA 5HVGB 1FVDB 3U4EA 1CFTA 4KKNA 5DMKA 3GMRA 4PRHE 2BMKB 4HKZB 2QQNH 4X6EA 2WQ8A 4Y5XA 1T4KB 5AYUH 5CIPA 2DIBA 4DN3H 4K94H 5FYJL 4JFQA 3QIWA 2EIZB 4D0DA 2QLVB 3T77B 4M8QA 3U9UB 1V5JA 3VXME 3ZE2E 4ZO8A 4X7DC 2FEEL 5DQDH 4ZFOA 4RX4A 7FABL 3I3BA 1AR2A 4EI6A 1KJVA 5F1KC 4J2XA 4WV1C 5AEAA 4CU7A 2R4SL 3LSOA 2P5EE 3L7FA 1XGRA 4UZGA 4AH2B 3NA9H 2FIRT 4ODSH 1IM3B 4LSPH 3QUYB 4HCRH 2G5BA 5E0QA 1QACA 4OZHE 5GRJL 5IB5B 1KNOA 3FN3A 1MF2H 4WFHE 4FQ2H 3UTTE 5C2BH 2ILLA 4K3DL 4XNQB 2PN5A 1A4KB 5ILTH 3HUJE 4HT1H 5J0BA 1U3HC 4G3YH 4KRPD 3FFCA 2D0HA 4DEPC 3CCHA 1U92B 4X7CC 1JZ3A 4RQQB 2QQLH 1AI1L 2AJZA 5E56A 4XXCC 5CJXC 1EHLL 4QRUB 3KLHD 4CVXA 5J11B 2R56H 4S1DD 2Q7YB 5J1AB 3RGVC 3OKKB 1HINH 3PWLB 2NY3D 4DN4L 3SGJC 1L7TH 4HIJB 4IBLT 1C5CL 3O3BA 1G6VK 1MCFA 4WI5A 5HGHB 5KSBE 3JVGA 2VKWA 3ZMRA 3SJVB 1WBXB 1SHMA 1FO0A 3NH7H 1RK1B 4R96A 5HI5C 4K71C 3VXRB 2VDRL 2W92A 1KJ3H 4WW1B 4JG1L 2VDOL 4P59L 1DBJH 4XCYB 4CBPA 3W11C 2B8OT 3BD5A 5ABDE 1TIUA 4OCWL 3MLSH 3AXLB 4IMLA 2ICWA 1NGYB 1JF1A 5E2WH 3EAKA 3E3QE 5F1IB 5KOVC 1DANU 5FOBB 5DEGB 2HVJA 1X5XA 3BESR 3G5VA 5JIPA 4G7VH 3SKOA 1D9KD 2HN7A 4ZFOL 4I3SH 1MNUH 1KB5H 3RWHB 4HGWB 1HHHA 2P42B 2PXYC 5E8DL 1OB1A 4LGPB 1T7ZA 3F5WA 3QYCA 5BZDB 4UILH 3E0GA 2APVA 4ODWB 4Q58C 3GSQB 1LD9A 2EDTA 4Q9BA 4M62L 4X0KA 1M7XA 3SDDD 2BSRA 5DFWH 4LSQL 3LKSA 1NCCL 2Z91A 4G9DB 3JWNC 4EDWL 3JV5A 4PRDA 3QULA 1OGAB 2XYCA 1AO7E 2VQUA 1KN2L 4U1JA 2PW2A 2V7NB 2YN5A 4OGAC 2NY6C 1ZWIA 1A22B 2BOCB 4D0CB 5TDOB 1PZ5B 1E4XL 3SN6N 2H2PC 5LGJA 2AXFB 5FYJH 3REVA 4KUCD 4OZGE 3DVNA 5DA4A 2A83A 2CDEB 1SM3L 4LDEB 1XGUB 3JTSB 3QG7L 2VXVL 4Q6IB 5FKAB 2WINA 5DO2C 4HWBA 4X6CE 4OZFG 3GJEB 4OCLC 1T80A 3OKEA 4RFEA 7FABH 3O2VL 1L9MA 2AQ3A 1AFVL 2A73B 1QSFA 4A2MA 4MQ7B 1FO0L 5HGDA 5TDPB 4PJ8A 1TCRA 2R4SH 2P47B 5GJSH 1EAPB 3GMNA 3B8SA 3QUKB 1G7LA 4KI1A 1WISA 2V2XA 3IKCA 5C3TA 5HGAB 1YECL 1G6RA 2NQCA 5C8JB 3H9SB 3TPUB 4LSDA 4L3EA 1KCSL 5GRJH 1QQDB 4GW5A 3N1QC 2D7OA 4GMTL 5CJQH 2DAVA 2LAGB 3QDAA 4K3DH 2HAZA 1L6ZA 1JGEA 3BT2L 3OB0K 1JYXA 1QP1A 2DI7A 3VMPA 5IKCB 3MRMA 4U1LB 1PDKA 4PRAA 2KZ1B 3P3YA 1AI1H 2NXZC 5JW4N 3C9NA 4BSWB 4KJYA 1EHLH 2ZG3A 2EECA 2DQCL 5DHXB 1JBJA 4DN4H 2P24A 1C5CH 5FO8A 1JHTB 4WFHD 4KAQL 2W9LA 1YQ2A 5AZ2L 5IMOB 1AD0A 5IMMB 4UQ2B 4U0QB 4YIQA 2QSQA 3SBWC 3QH3A 4PGCA 1TVBB 3IDGB 4X7SL 1I8MA 2FGZA 3SQOL 3FZUC 5F6HJ 3TJHC 2VDRH 1MRCL 3TVMA 3UTZA 4JG1H 2VDOH 4P59H 3WIIL 4NCC2 1U2CA 1XR8A 3FFDA 1YEGL 5GJTL 4G9FA 1RK0B 1PAMA 4OCWH 3KNBB 1QR4A 1A6VL 4GXVL 3HZYB 1FJ1B 2N4IA 3AREA 2HRLA 3SE3A 1TQCB 1VFAA 2IGFL 5HI4C 2GI7A 4XNUL 4NDMB 2EE2A 3OJMB 1H5BC 3Q3GB 2GAZB 2B20A 2IBZY 5FK9A 4BUHA 2J2ZA 4PJFE 3VFSB 3D69B 4GH7B 3F7VA 2VAAB 4HWBL 4P23D 2A74A 3C5ZC 1YEEL 2CO6B 3HR6A 4PLKC 2HWZL 5D7SL 3N1MC 5K9QG 4K9EL 5E8DH 4LHUG 1WCBA 4NPYA 4UT6L 5ADOL 5F7DA 2H3NA 5FO7B 1R3LB 1U8LB 3TZVB 5FYKL 3BIAX 4M62H 2IBZX 5ALCL 5CZVL 4QOKE 4LLUB 3QIBC 1G6RL 3V52H 1M6OB 1MCEA 2BY2A 4LSQH 4GKZB 1NCCH 3SGDI 1D7FA 4EDWH 4OLWL 4WGVB 3T1WA 5MEND 1FN4B 1KN2H 3QNZB 4H8WL 2ID5A 1IAII 3RWIA 4RAHA 5IR1A 3TN0A 5FYJE 3EZ8A 2JB6A 5CHNB 4Z78A 3X13B 4U1NA 1IGJB 1IAIM 4LVOB 5D2LB 1E4XH 1DEEA 3MRHB 5EU4B 4M61B 1GZQA 5HI3C 1SM3H 4BQ9A 1OAZL 3QG7H 4NN7C 3NACL 2VXVH 4UIMB 3NN8B 4IHOB 1LVEA 2VO5A 1AO7D 4IIQB 5KW9L 3L3JA 3DX7A 3SKJL 4E0RA 1NLDL 3C8KB 3O2VH 3ULUL 4YHKL 1FO0H 3O9WA 3MCG1 3HE6D 3OB8A 3FO1A 1R0AL 4UUJB 1H8OA 4OF5A 4NQCE 3T0EB 3N0PB 1JMZA 2VUOA 1IGCL 1B88A 3ILQD 1YECH 4S10A 1KCSH 3WN5B 2KQMA 5ISZD 3O6ML 4U1GC 3VXUE 1CT8B 3RVXC 5I1JL 4MA1B 3QZWA 1GH7A 3PXJA 4GMTH 2XPGA 1ZLWK 3B2UC 2H2SC 5JZ7D 3ZDXE 3BT2H 5IIEA 5C0BB 1HEZA 3S9DB 4HZAA 1A6TA 3KPOA 4MNQA 4X9BA 5E4IA 4JGMA 1AQDB 5EO9A 1UT9A 3O4LD 1WITA 2DQCH 5DFVC 3O3EA 3GRWA 1WQVT 3BFOA 2R23B 2ED9A 5F9AC 3D18A 4XNZB 2F58L 5AZ2H 3FT3A 1OP3K 1WAAF 4EVNA 5DJCB 3KPRB 5C86A 3M45A 2JCCF 4X7SH 3SQOH 2DB8A 2NX5B 1MRCH 4HH9B 1O7SA 3WIIH 3UTSD 3KDMA 2CUMA 1T22A 5J12B 5GJTH 4YC2C 2NNAB 3TBVA 4XH2A 1A6VH 4GXVH 4P3CL 4UQ3B 2Q8AL 4KK9C 1B4RA 3VI4F 2IGFH 3QDMB 1GPOL 1SEBB 2EDOA 5FM5M 4XNUH 2ARJB 2EC8A 4XC1L 1ZLVK 5T1LA 2VE6B 1AD9A 1Z5LB 4HWBH 3QUZC 1MFAL 4ZXBD 1C8PA 4QXWA 1I8KB 3U7AA 1S3KL 1YEEH 3VRLF 2HWZH 3I02B 5D7SH 2BHYA 3FQRB 1A47A 4K9EH 1OAKL 4P2RA 4JVUA 3OAYH 4NKDA 1U8KB 4UT6H 5ADOH 2XZCL 3RVUC 3SPVB 5BZWB 1MJJB 3JV4A 5DEFB 5FYKH 2MFNA 1FORL 5ALCH 5CZVH 3D2UD 3E2HC 1DL7L 1G6RH 4HZLA 1NDGA 3VH8B 4OLWH 5B39G 3G04B 4NM8L 1HCFX 4G42A 2X4PA 3C5JB 1WV7T 3T8XA 3QQ4B 2MSPA 4ZUUB 3U4EB 2GCYA 1UXWA 3PP4H 3MV01 1CFTB 4P4RB 5DGRA 3C87A 1CLZL 5L2KB 5DMKB 3GMRB 4EI5D 4PJAF 5DXWA 3EHBC 4D0BB 1TPXB 4Y5XB 4Y5YC 4JRXD 2JK5A 5CIPB 5C0GB 1TZGL 5AYQA 3ARSA 1OAZH 5DDHB 4GRMB 4X6BB 3GRWL 5EU3A 3NACH 1NANI 2E7LC 3QIWB 5JQHC 5KW9H 1TTUA 4D0DB 1JNNL 3SKJH 1KLUB 1NLDH 4NNXB 1FGVL 1JTOA 4ZS6D 2ESVD 3ULUH 4YHKH 1IC7L 4G80B 3FL7A 1R0AH 5DQJA 3B8YA 1BZ9B 4OGZA 1EJOL 1J7VR 1IGCH 3VGGA 4OV5A 4NO2A 3T0DA 3KPSD 4PRPE 3O6MH 3STZB 4DGIL 5I1JH 5E99L 3TT1L 3CZJA 1FL6A 2CXGA 4LLMA 4UOW1 2MWCA 3QJHA 1IAIL 1BQLL 3B9DA 3FT2A 1S7XB 4MQTB 2W38A 5JLZA 3FFCB 2AJ3A 3RHWK 3FQTA 4DKAA 2A6JB 1S7TA 1A1OA 3ARDD 3CH1A 2YWZA 4Y4KD 1CGTA 4JFOB 4CVXB 1RJLA 2AEPL 2F58H 4OFPA 5BS0D 4POYA 1YY8A 2R4RL 4U1HA 4ODBD 5IQ7L 3EOBB 3RUGE 4UV7L 4K7FB 4JDVB 3DECA 3REWB 5LKNA 2BVQA 4C83B 3F7PC 4I8DA 2WBJA 5CZXD 5HHOD 1URLA 3QUYC 1EEYB 4P3CH 3A6BL 2Q8AH 3RWEB 4MJIB 1GPOH 3D3VE 4HXBL 4XC1H 4IMLB 5T1KB 2ICWB 1JYNA 3VCLB 1QFWM 3P0YL 3K3QA 3LPGA 1KIQA 1BVZA 3I50L 5D7LD 4CMMA 4DOHE 4FZ8L 5DRWA 1MFAH 3NIDF 2Z93A 3DO3A 1CG9A 4LFHG 4QO1A 1S3KH 1S9KC 1RUML 1KEML 1MCJA 1OAKH 3PQYA 3MV8D 5FYKE 3QDJD 3ARFB 3RNKB 5A2IH 1MLBB 2XZCH 3JTTB 1G7IA 2NW3A 2PYEA 1FORH 3VGEA 4AJ0A 1ZT7A 3HAEH 1CGSL 3WO4C 1CDGA 4J12A 4X0KB 1OWRM 4WI2A 5M94B 4YO0A 4NM8H 4NN5B 4GOSA 4HLJA 2X4TB 2Q6WA 4PRDB 3QULB 1REIA 1BX2A 1ZLSL 3S37X 2W0KA 4F7PA 4XNMB 1ZWIB 1CLZH 3VWKA 1TZGH 5GGTA 4OIAA 1IGIL 3GRWH 2MTPA 4QT5A 4F9PA 1E0OB 2A83B 3ARBB 1HYSD 1JNNH 4U05A 1VEPA 1FGVH 2FSEA 3MQIA 2ICEB 3IXAB 3MRIA 2WINB 4NRYB 4XPGL 5HDBE 1IC7H 2OR9L 3IGAB 1P4LB 4P5MB 2ZCKH 1UWXK 3MFFB 2QKIB 5BXFA 4WVRA 3RX8A 1J05B 4PJ8B 1EJOH 2WANA 2MOVA 5JW4R 5DD0H 1NGXA 1ZSDB 5EOTA 2MKLC 1G7LB 2J88L 3VFOB 4RNRA 2V2XB 1A6ZA 2VLRE 3IKCB 4DGIH 4TUJA 3EUUA 5E99H 3TT1H 3KG5A 3IDJA 4L3EB 4M1GL 4NJAL 1MI5E 4LK4A 1XF5A 1SY6A 1J0HA 1IAIH 1BQLH 1H3WM 3JBG7 1MCPL 3L3IA 3FMGL 4Y5VB 1RV6X 2HKHL 4GAYA 2FYYB 4RFOL 4PRPD 3L3DB 3R1GH 4KK6C 2AEPH 4LVEA 2RQ8A 3CH8A 4HEPG 5FO8B 2R4RH 5CKAA 3P9MA 3SCMA 5F96L 2CR6A 5CSZA 1K8IA 1RPQA 4MDJA 1E28A 1AD0B 5IQ7H 4S2SA 5KBNC 4YIQB 3LHPL 3E6FB 3M17B 4PGCB 4Y19A 4UV7H 1ZKAA 1R5VA 1F4WL 1CR9L 3TVMB 3UTZB 4OUUB 5IEHA 3KHQA 4LLDA 4RFNB 3A6BH 2ITDA 3FFDB 3TT3L 1XMWA 3MJ7A 4G9FB 4AMKL 2XQYG 4HXBH 1IC5L 2J3SA 3OQ3B 4XBPB 4BQ6A 4F15C 3P0YH 3H0TA 3GJFK 3I50H 4HLZH 1JZ8A 2I07B 3MYJA 4FZ8H 3ZDZE 3D0LA 4Q9RL 2NPLX 2Y25A 1ZHKA 5FYKU 1KEMH 1INQA 3TYFA 3VJ6A 2A74B 1SVZA 3P11L 2XQYK 3QQ9C 1OWWA 2P4AB 4P23A 5SX4I 1G7QA 4J23A 3VGDA 4I77H 4J3WA 2N7BA 3D3VD 4P2OA 5E95B 1E4JA 5KS9E 1F4HA 1I9JL 1MWAA 4XP9L 3N50A 4XAKE 5DHVA 2P8PB 2NY5C 3AS3A 5CD5C 4TYUA 1AXSA 1CD1A 3DVGB 3O8XA 4OZ4A 1OTSD 1T1YA 1I9RL 1VPOL 1YMMA 3BEWA 1ZLSH 4NHUB 3LQZB 3DMMA 2AK4D 4QHLA 4HFWA 3RWIB 1FH5L 3G5YA 5IR1B 1JV5B 2R2EB 5J6GB 4G6FB 1JZ2A 3ZT7A 2OJEA 4M4RA 1J1XL 3FHAA 3VXQA 1HH6B 2YD3A 2MPAL 3RY4A 3DIFB 1IGIH 1MVFA 3VDAA 3V4PL 2C4FU 5D7KE 5DD6A 4JRYD 4ZOBA 4XPGH 4HJJL 3L3JB 2OR9H 2AERT 5E6ZA 1F2XK 1A0QL 4YDJA 4LRIC 1VGEL 1WJ3A 3O9WB 4QXGL 5H94A 4P4KA 4DUWA 2D7PA 3MUGB 2ZOKA 2EIBA 2J88H 2OP4L 1GZPA 3ULVF 3WO3B 1UB5B 3DRQA 4N1EA 1WAAA 4U6HB 3UPCA 1CFSA 4X4MA 4M1GH 3RHWF 3MLUL 3NFNA 4NJAH 2JCCA 3STBA 3BIKA 2NXYB 4M5ZL 3QZWB 4Q9QL 3PP3H 1B0RA 2XPGB 3SE4C 3CFJA 1F3JA 3C6LD 1GVIA 4QTIL 2J8HA 3V5KB 3FMGH 3VMOA 2VDLL 2IMMA 4MNQB 1Y18A 2HKHH 2VQ1A 1FFNB 4RFOH 3T4AA 4ODXA 3DXAD 4KGLA 4JREC 5EO9B 2VLRD 4Z0BL 2C3GA 3QEQA 5C0RL 4IIQC 1NANH 3P77B 4PP2A 5I1CL 3FRPG 4JFZL 1MWAL 1DZBA 4RAUB 5J06A 5F96H 3D18B 4CN4A 2ADIA 1DVFB 3UBXG 2PTVA 4XVUC 2HJKA 4GBXC 2N56A 4BFEA 1BVKA 2PO6B 1F4WH 1QSZA 4P46A 1CR9H 3TO2B 2M26A 2H32A 4QHKI 5CBAB 5IG7B 4LSSH 5CS7A 5GQBA 2VDML 3VGAB 4G6AC 1CXFA 1HN1A 4AMKH 4WEUD 1IC5H 3TNMA 3J8F7 3T0VA 3QIUD 4ZMAT 1V3MA 3C6SB 1Z0MA 4M43L 3LS5L 3QT2A 4GAFB 4Q9RH 4X9FA 3PL6B 1BFTA 3FONB 1AD9B 1MJUL 5EUOF 1GSMA 1N8ZA 4PPTA 1HNFA 4PJAA 2R1YA 4LGSB 4HWZB 4F7CA 5B3JF 4G43B 4N0FA 3P11H 2A6KB 1FIEA 4P2RB 4I5BB 1CDIA 1K9TA 1XZ0A 3ZKSD 2OYPA 3L9RB 3QXDA 1UZ8A 4ODVL 1TVDA 3D85A 2NY7L 1I9JH 4JCLA 2UZXB 1XGTB 4XP9H 5ACLA 4FXKB 1A64A 5HHME 1AJ7L 3QCTL 4HJ0D 4P3DA 4OZFA 1C08A 2VSCA 4MA7L 4OSUL 2CRMA 1NDGB 1BJ1H 2FHCA 3QUMA 3D2UA 3RWDA 1I9RH 1SY6H 1VPOH 2AQ1A 2YD7A 3NFSL 2A9NL 4QRPA 2ADJA 1KGCE 5J12C 1BBJA 1FH5H 3T8XB 1CXIA 4KQ4L 1CDYA 1DN2A 4M1CC 4MCYB 5D1ZC 1FYTB 3MLXL 4L4VB 4PJDA 1E6JL 2MPAH 3S98A 3CXHK 3CFEA 2ZZUT 3MPCA 3BDYL 3V4PH 5JDJA 2JK5B 4Z7VE 1HH9A 5JIHA 3P0GB 4JY4A 5D72H 1NBQA 1OW0C 2DQEL 5AG9A 1S7UA 4LBEA 2A9ML 1A0QH 4D3CL 4LQ1A 3SDAC 1F02I 5JMOC 1VGEH 4ZFFA 3SKNB 3EO9L 5D9SA 2F15A 3U30B 2ESVA 4MQXC 5SWZA 1SBSL 2OP4H 1DANT 4D9RE 1O0VA 4WFFE 3T2OA 4AQOA 2FX8L 4OV5B 3MLUH 3QXWA 2R15A 3BD4A 1NFIB 3UX9B 4I0PC 3L7EA 3VFVA 1CICA 4NKOA 3V5HA 5ICZB 4M5ZH 4Q9QH 4N5UA 1A5FL 1C5DB 4FQQA 4LLMB 4Y4FD 3QJHB 3H7LA 1ZS8A 4QTIH 3WXVH 4ZQKA 5GGVH 1AY1H 3FT2B 3EFFA 2VDLH 3ILPA 3FN0L 1TPXC 5DTFA 1IQWL 1JK8A 1U95A 5HHXL