2JLLA

Crystal structure of ncam2 igiv-fn3ii
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
389
structure length
381
Chain Sequence
b'QPHIIQLKNETTYENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEKSLDGRIEVKGQHGSSSLHIKDVKLSDSGRYDCEAASRIGGHQKSMYLDIEYAPKFISNQTIYYSWEGNPINISCDVKSNPPASIHWRRDKLVLPAKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNHIGTRFQEYILALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASEIWKIVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPILEYIVKYRSQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANLGYSEPTVYEFSMPPKPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEURAL CELL ADHESION MOLECULE 2
molecule tags Cell adhesion
source organism Homo sapiens
publication title Structural Model and Trans-Interaction of the Entire Ectodomain of the Olfactory Cell Adhesion Molecule.
pubmed doi rcsb
total genus 67
structure length 381
sequence length 389
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
A PF07679 I-set Immunoglobulin I-set domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jllA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jllA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jllA03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jllA04
1UJ3C 1MI5D 4K9EC 2A83A 2DQFB 5F9WC 3UTTD 4AH2A 5CBAB 4GRLD 1HCVA 5KVFL 1BX2A 1MF2L 1ZT7B 3LMJL 1CZ8L 4X80L 1JPTH 5T1DH 2VDRL 3T2QA 1JGVL 2ZCHL 1JWMA 5TGBA 1G7MB 3CMOH 2I5YL 3O11B 2FYYB 4X5XA 1JNNL 2R0LL 3Q6GL 4R2GD 3KYMB 4NDMB 4H8WC 5A2KH 2I9TA 3QO0B 3RDTC 4JHAL 4K8RH 1XH3A 3BP7A 3C6LC 2IANE 4GRMA 2PYEA 3ARZA 5ESAB 3HE7D 2GKIA 3G6DH 2JJTC 4E41E 1C08A 4F7EB 3ALPA 4Y2OA 3LKRA 4IBLT 4PRAB 1KCSH 4OM1H 1TNMA 2C4FT 3EYOA 4JG0H 3CGTA 3MV8B 4XWGH 3AAZB 2HTKD 5D7LA 2D31A 5CJOL 3RJQB 2R69L 4F7CA 3QNYA 1K2DA 3T0BA 4GQ9L 3IETA 3VXSA 5DXWA 3CXDL 3SDXE 5IBTL 1YQVH 2HH0L 1IAMA 4W70A 3ZKNC 5CCKH 4OQ1A 4CU7A 3MLTB 2A6DA 1MRDL 2OXHA 4D8PB 3T3PE 3V0WH 4JPWL 5DC9B 1SJXA 2HVJA 4QRQB 5INDB 4HQQL 4KAQH 2OL3L 3L3HB 3BP5A 4M7LT 2YS4A 5M94B 3U1SH 1RJYA 1CD0A 3D3VD 2A0LC 4YHMH 2XKNB 1T89C 2HA1A 1GAFL 1H5BA 5IVZA 2IAND 2VJXA 2NR6D 2A38A 2GY7B 4JLRB 4JO4L 4E5XB 3ZO0A 3VXSD 1NMAH 5LGJB 5D7SL 1U36A 4H1LB 2AJUL 3KPPB 4RQQA 4HAGA 1BQHB 2HH0H 3TO4A 2ZG3A 1BPVA 3J8F7 1NCAH 3U0WH 4NKOA 2AXFB 5KVDH 1PZ5A 3TBTA 4ELMF 2WBJB 1I7RA 4OQTA 1VPOH 2MWCA 4FQ2L 4OF3A 1X3DA 1F2XK 3QDJB 2VXUH 1AO7D 3IKCA 5C9KA 4Z78A 2G60L 1ZSDA 4N1HB 3L9RB 3SKOB 4OFDA 4CKVX 2ZOKA 2E6PA 3M8OH 4MCYB 3QNYB 3R06A 2C1PA 4PJ5E 4M43H 4KQ4H 4XPGH 3NH7H 3MRQB 5J9PB 2HFGL 4RMRA 4UNUA 3TFKD 3EYOB 3EZ8A 4KI5C 1LK2A 1QRNE 2VZUA 3LPGA 4HZLA 4TYUA 4CRPA 5HBBA 3LRHA 2NY0B 4ODUA 5L88L 2V2WA 1QVOA 3FQUA 3TZVA 5EH1A 4X5WB 4X80H 4N0UA 2ZJSH 2EZ0D 4W6WB 4S0SD 3F58H 1T20B 5J0BA 4NQVA 1QFWH 4X7EC 5EN2A 3VGGA 5C0DB 3QDJE 5TGBB 4XH2B 4RMSA 2VXVL 3NACL 4LIQH 2J12B 3D18A 4YHOL 2DWEB 3P73B 2JB6A 2F53D 3D85A 3L5XH 4ZOCA 5EBWB 1TJHL 5ID1A 2VDMH 4DTGH 2GJZA 3T65B 1YY8A 1MFEL 3QH3A 5DK3A 2FH8A 3ARFB 1NLDH 5ALCH 2VDNH 1DDHB 4HJGB 3BZEA 2DS4A 3VXUD 1K9TA 2E9WA 1C1EL 5FYKH 3GNML 4JPKH 3HNVH 5I1KH 4HXAH 4NRXA 4NNYB 1HDMB 5HDQH 1I85A 4PPTA 3IFNH 4KV5E 2O5XL 2Q20A 3B9KD 4NO0D 4XX1G 1FZOA 5KSUB 3GMRB 4N8VB 5B3NA 1DEDA 4F57L 2OK0L 1HSAB 2VLLA 3OXRA 5I15L 3THMH 1JHTB 4DGYL 1S7QA 3WLBA 5A1AA 1T5XA 4JN1H 2XTJB 1U8QA 3EO0A 1AHWC 4XP4H 2VLJD 4YGVA 4J3SA 5KG9A 2Y9RT 4OD1H 4LNRA 1FFRA 2YUZA 3EDFA 4DKFH 3NPZB 4NSKA 1LMKA 2IFFH 3GEWB 4H5SA 3RTQA 2Z93B 4PJ8C 3MOBL 2QADD 3K7UA 5E99L 5H2BA 2YMXL 4HGWB 4O2EA 1JCKA 1I9EA 1A7OH 3C8KB 4JFXB 5DMKB 3DVGB 4UV4H 2O5YH 4FG6D 1MHEB 4P9HH 4YHZL 2G2RB 4FFWD 5D7IE 2YD2A 3VE0A 1Q8MA 3C2SA 5KJRL 4F58H 2BJML 2A6KB 3RVWC 4CVXA 3BIAX 3MLWL 4OKVA 1CFNA 1B0RA 2ICWA 4GAFB 5FXCH 4QTHA 1T4KB 4H20H 1CT8A 2XICA 1JPSL 4G8IB 5CD5C 1KIPB 3IDIA 2NXYB 3HE6D 4QF1B 4R2GB 5DJDB 4JDTL 2QHLA 1KXVC 4OUUB 4NNPH 5GGSY 1I9JL 2B2XH 4M5YH 4RGOH 5L6YL 4KI5D 4LHJB 3JTSA 3BKCL 3AMKA 3P9MA 1IKFL 2WUBH 2N7AA 3P9LB 4JFFA 4XNYH 3LKOB 3SE9H 1MCPL 1R3JB 3QDGA 3HRPA 5DJ0B 1UQSB 2NY0D 3NFNB 5AZ2H 3FQXB 2XY2A 1CK0L 4OJFL 5BZDA 1V5JA 1YMME 1AO7E 4PP1D 5B4MC 2AKRA 3KDMB 5DRNB 2AAVA 3E6HB 5MI0B 2R23B 3ZL4H 1RFDH 1NBVL 1KCLA 5CMAB 5D6DA 1S7XB 2B20A 1HI6A 3D39A 3O2VL 1U8KA 3QFJE 1FSKB 5JOFA 3QUML 5HPOA 4PGBA 3BOVA 4K3JH 4HV8B 5D6CA 5D7IF 1ACYH 1JN6B 3O2WH 3Q5OA 1J18A 3O2WL 4U1KA 1OP9A 2F5BL 4PJBA 4PGCA 2VSCA 1AGEB 1CTNA 5IESH 3NZHL 4L3EE 2IADB 2NR6C 3W9DA 5D1XA 5ECJE 4N0FB 3IF1A 3VA6A 2OR9H 4NZDA 4LSQH 4OD3H 5F72S 5FDWB 2XA8L 5DVNA 4HK0B 4WW2C 5F3HB 5C71A 3UYRH 3S35H 5DO2D 3ZE0F 1YMHB 4LHUD 3H9SD 1U8OA 4G8EA 1KIRB 3EJYC 3D39E 4U6TA 3F7VB 4RIRA 1KB5A 1MFCH 4N9OB 4YWGL 4LHUA 2DTSA 5IHUH 4OB5L 5MEOB 4XBGA 2GAZA 4POZC 5DSCB 3ZKND 5FYJD 2DLHA 5H35B 2AS5M 4M5YL 4RGOL 5DTFA 5DJCB 4ZAKB 3X11A 3EO1B 3RI5K 3INUL 2IEPA 2XY1A 1OF2A 1RVFH 4WU7A 5T3ZH 4JKPL 1KJMA 2VITB 5K59F 1R0AH 3DXAB 3ZHLA 4NZTH 4U6VL 1NL0L 3D5OF 3S37X 5C07A 4E41A 4X6DB 5KJRH 5CZXC 3VXMD 1CDBA 4ZO8A 3GI9L 2DQEH 1KB9J 3D39D 1NAKH 3O6FB 2EE3A 5F7HA 1EDQA 1J0IA 1L9NA 3BWUC 5FYJE 4W4NA 4BZYA 4BFIB 1K3IA 1ONQA 4KJQD 2AJSH 2BXZA 2F58H 4N5UA 2VQUA 3LN9A 1QP1A 5L9DL 2IFFL 2PXYB 4F7PB 4NQSB 3WS6A 2OX5A 2DQDH 5EZLB 2DD8H 4OD1L 3V5HB 1QO3B 2C3VB 1AFVL 3FZUD 3AU1A 1CLZL 1RQ5A 5B38B 3MO1A 5HHOE 3X3GL 1JPGB 4HPOL 3QO1A 4OBRA 5JUEL 4LVHC 1FG2A 3HUJF 3QCUH 2J7LA 3U4BH 1QNZL 2D7OA 5IFJA 4XBEL 5EUOB 2Y5TB 2RCSL 4PG2A 1J8KA 2W0KA 1U58A 5B8CC 5E9DA 3LCYA 1T1ZA 4XB7A 3ULUC 4NJ9L 1EFXD 3BZFA 1JGUL 2FEEI 4BZ2L 3L3JA 1A6TA 3IDGB 1MI5E 5HDQL 5CP7B 1K4DA 5FM5M 2L4OA 1TXKA 2FO4A 3HNVL 2W9EL 5TFSH 1U8MA 4HUUB 1A9EA 1JRHL 1L4IA 3I50H 3MA7A 5I1AA 2UZXB 1JGEB 2DQIH 4V2BA 2YRZA 4I5BA 1YY9D 2E9IA 3SJVE 1VFAB 5F7YC 2KL6A 3AY4A 4NUJB 4NNXA 5BO1H 4P5MA 5D2NC 3WIHA 3H7BB 2CMRL 3DO3A 3IDJA 4LU5L 5SWZD 1YC8A 5I1EL 4X6BB 4OZIA 2GJ6B 5E6IC 1S7UA 1KG0A 3WKNA 4E41D 2CRYA 4DKEH 3GMMA 3VFMA 2B4CH 4APQB 1D3CA 1DBBH 5FKPA 2DQUL 3UTSD 1BFSA 1S78D 4QXUL 4FA8A 3I6GA 1ZS8A 4X6DF 3DUSB 3WFHA 15C8L 1P4LA 1EFQA 3BD3A 5F6IC 3QEGH 2CIIA 1GOHA 2I26N 3K2UH 3HB3D 5ILTH 3IDYC 4PJ8A 5I1HL 1TZGL 5I1LB 2Y72A 3HRZA 3VFTA 4RZCB 3PP4H 5I18H 1QFHA 3H7LA 2EIBA 3G5YB 3S98A 1G6RL 5L2JB 1XR8B 3HI1B 5HHME 2VO5A 2NNAA 5ETUB 4TQEL 4XPGL 2CKBB 4GRWH 5JLZB 5I8EB 5D1ZC 3LEVL 4PJDF 5CZVH 3RWJA 4JKKA 5GZNC 5C8JA 1R24B 2P24B 4CJ0A 4KK9D 1UM6L 1P84K 2GEEA 1NC4D 5F8RC 3UTQB 1QA9A 2VXUL 4FQXB 2H32H 4L4VB 4G43B 1QQDA 3PF2A 4C83B 4Y5VA 5D1QA 1F4YL 1RMFL 4JZOB 3V0AC 5IBLD 2HT3C 3MLYH 1H0DA 1YEKH 3EFDH 1F97A 1FL6B 2VYRE 1G6RH 2XQBL 3DX8A 4L8DA 4ZUTB 1KTRL 4HWEH 4G9DB 5T3XL 2VDLH 1P1ZB 1PX3A 3PWUA 5F7EL 4JCLA 5FV1L 6CGTA 5K9KA 2BFVL 4NKDA 5I19H 3GUTA 1NUFA 1OCWH 1QLEH 4ODHL 3IDNA 5HJ3B 5DA0B 4P2RD 1IC7H 4HH8A 1A14L 1BZ7A 4D0BB 5ICXB 4YHML 3BISA 4FZEL 3MCLL 2FBOJ 1FP5A 4UDUA 2X4PA 1C7SA 1MH5B 2E7MA 4KAQL 4DCQA 4JY6A 1J10A 3G5XA 5FA4A 1OGTB 1I1CA 3IFPB 4LU5H 5DEFA 4WDIA 4GKZB 4OLZH 5CCKL 2YBRA 4XPTL 4EUPH 1YQVL 4M1DH 43CAB 1S7WB 3CLFL 1MFDH 4R3SB 1IAOB 1J86A 3S3JA 2BSRA 2JF1A 2DQIL 1W72H 3OAZH 3IXTB 1U93A 4CBPA 4OM1L 2ITDA 4GAGL 2PW2B 5EC2A 5DS8A 1HYSC 1AXTH 2NY5L 4B7IA 1I8IB 3MLSL 5JQ6H 5HHNA 1OAKH 1OAXL 2C3XA 1AC0A 1FFPA 5DK2B 3ARED 3LN5A 3MNVB 1E6OL 4PJ7A 2OJZH 4X6EA 5FGBC 4N0CD 3SGDI 3DX9A 5TDOB 1AQDB 4Y2DB 3O3BB 4NKMB 3TA3B 3Q6GH 4LOUD 5KTEL 3DUUB 4IJ3C 4P23B 1P7KB 2VRAA 2YKLH 1RURH 4N5ED 1T1YA 2HLFC 3MLXH 4F33A 1MH5A 1TZHB 4PTUA 3BGMA 1A0QL 2ZSWA 4UDUB 3ARBB 1CZ8H 4MWFB 4P4KD 5DJYB 3GRWA 4PJEE 3EYVB 3IXAA 1AFVH 4U1JB 5HYQB 1BZ7B 4D0BA 4I48A 5F1NB 5IROA 1ZA6A 4AIZB 1FYHB 2ESVE 1K3ZA 3FAXA 1K4CB 4JRYA 1X5JA 3PWUB 5HDBF 4XVSH 2X4RB 4OLVL 1P1ZA 1JYWA 4KROC 4OFPA 4FFYH 2CJUH 4PJIF 3QEUA 1KJ2B 1B3JA 1OTTC 2CDGA 2XKSA 2HMID 2I9LA 4K7PY 4UB0H 4L4TB 1R0AL 1XF5B 3MGOA 1KEGL 3OKKA 3MJ9L 1CLYH 4X4XB 1HHKA 1Z9SA 2NY3B 5TF1L 2VN4A 5JR1L 3QHZL 4LDOB 4FQHB 5I0ZA 3ILQC 4JM4H 1XR8A 3QEHB 4DGIH 3MNZB 3PDOA 3TZVD 1L7TL 3V52H 1JNHB 3BP6A 3ZDXF 3S35L 1DLFL 1G6RA 4OGYL 5EIQA 2OR9L 4KFZC 4NPYA 5GJTH 1T1WB 2CK0L 3AS3A 1UH3A 3TT1L 4KHTH 3JVGC 3KJ6H 2P44B 4PJXB 1CF8L 2DMBA 3QUZB 5CILL 3SDAB 4EIGB 1AXIB 3SQBA 4HUKB 5ISZD 3P0VH 3QISA 3BRFA 4ZNEE 5DMGC 5FEBA 4GMSL 2I07B 1OAUL 1TQBB 5TE7H 3IDJB 1RUAH 4GW5B 3GHEH 4JHBA 1SYVA 4Y5VC 2OR8A 1NBVH 4BK5A 2JJTA 4ZPVB 1VFAA 4XXCA 1W8NA 4UZGA 3QPQC 1C12A 2W0FA 4PJFA 3MRHB 2Q7YA 4LGSB 1DQMH 4WV1C 5FA3B 5GZND 1Z9MA 3KXFD 5DZOA 3R1GH 5FA3A 3DJ9A 2X1OA 1HHHB 2R29H 4N0YH 4XWOC 1CDYA 1P6FA 4ERSH 3B2UC 1Q9OB 2WUBL 1FFNA 1LDPH 5EOQL 4PJIB 5ICYB 5IEHB 3PGFL 2QHRH 5MERA 3S96B 4FXKB 2BNRA 4XC1H 2JK5B 3R1GL 1LO3H 4BH8B 1DQML 1T1XA 1YEHH 1DN0B 5HVGB 1J0KA 3Q0HA 4JFQA 2YK1L 4NKIL 5F9DC 3O8XB 5DD3H 1MCWM 2WLYA 4Z7VA 4M8VA 3QEQA 5DJAA 4P3WA 3S5LA 3T09A 3S4SG 1BAFH 3PNWB 3DGCR 1UH2A 3DWTA 2O93L 3CVHH 4OV5B 3MFGB 4JY5L 3P4OA 4FABL 4Q9RH 1WTLA 4LHQB 1PQZA 3V6OE 4P57B 1QUNA 3BI9X 4IRSB 1CIUA 3HTLX 4QOKE 2VLJE 2V2XA 2NQCA 5HYJA 1IBGL 3C5ZD 5HDOA 4A6YH 1RULL 1MIMH 3ZE1E 5ERWB 4EQ2A 3OKMA 2XZQH 5EORL 1JHKL 3WXVH 4HX1A 1A3RH 3BUYB 1XGPA 1MCNA 2F8OA 4X8XA 1OWWA 1DBML 5SWSD 1EV2E 5C0IA 4OGYH 3TH2T 3U36A 5CEYA 2VL4A 2FD6H 3W9EA 4WUUB 2D0HA 1R3KA 3ULVL 3D2UA 4GXVH 4DGYH 5IKCA 4D3CH 1NAMH 5D9SB 5F21B 3JVGA 1CL7L 3AS0A 1EJOL 1XGQB 3LEXA 3C08H 5CLTA 2VQ1B 5BVPH 1MJUL 4NQDE 1AI1H 4Y19A 3TJEL 1A6AB 4NQCB 4IIQC 4JZJC 2DQJL 4LCUA 4O9HL 1BWMA 2I9LB 3W2DH 2VLKE 3MRLB 3QULA 2WLZA 4PJFE 4R7NA 1NCWL 4G7YH 4JFEA 2DM4A 1RUKH 1U3JA 4ZFOB 3P77B 4LEXL 4W4OC 5FYLL 3VFGL 3MXWL 1RIHH 4UB0L 1YUHA 5DJ6A 1A1OA 3BKMH 5GRJH 5JW4Q 3GIVB 2YXMA 3ES6B 3A6BL 3MODL 5F7WC 3DXAE 4OLWH 3GSVB 2C5DC 4LBEA 3EYVA 3IXAB 2D0GA 1K5NA 3ZTJH 5CEXA 3AS1A 2XACC 5AAMA 4XVSL 3NPSC 5HGBB 3T1FA 1KT2B 3RWGA 2X1XR 4RGNB 5T3XE 1FH5L 2IBZX 3QUYB 4DGVH 5EU7E 3F65A 3D69B 4EI5A 2ZG1A 1B2WL 2ZPKL 2BNUB 5KOMC 5IB3A 3D39B 3O6FD 1R3LA 2YK1H 4MQXC 3SE8L 4ZSOA 2CQVA 4K3DL 3P77A 5HYSA 4ZUVB 1RURL 3HE7B 5DRNA 3MYZA 1QSZA 2A77L 4P3DA 4Z7UA 1D5IH 3FQXA 3T8XA 5BZDB 4KJYA 5EOQH 5DJ0A 3IXTA 1RU9L 3LSOA 1TZIB 5JHLH 1OAKL 4POZD 4UT7H 3LD8C 4GRLB 1AIFA 4PGEA 3BAEL 1XGQA 2YXFA 3BH9B 1XF3B 1MRCL 1MHCB 3FB8A 3TPUB 3W39A 3G6JB 1RK0A 3BH8A 5AEAA 1ZA3A 3IDIB 2K1MA 3QUXD 4Y16C 3IFPA 1HCFX 4FFVC 5DEFB 2UWEB 5IW1A 2AJZA 4JY6B 1RZ8A 1UACL 4U1SA 3W5NA 3UBXA 5TE7L 4M1DL 5FYLD 3B6SB 3FB5B 4LRIA 1P5VA 4GKNA 3FCTB 3IS1X 5E6IA 3LN4A 1CF8H 4U3CA 4YBLB 1ZLVH 4HIHB 5T5FH 1DR9A 2D7QA 5K9KB 3FHQA 4S0TD 2NYYD 4YE4H 3WLWC 3O81A 3TJHD 3P4OB 2VISA 2X4TB 5EOTA 4BQ9A 4PB0H 4JFED 3NCFB 3MRJA 1K6QL 5C0AE 3PHOB 1WZ1H 3X12A 1KCRL 3SGDH 2BY3A 1L7TH 1NCTA 4PP1C 5J8OA 4PY8I 5C09E 4RRPG 1G7HA 1UGNA 4HGMA 3VGAB 3LB6C 5EZJA 5HHVH 1MRDH 4ONHB 5IT2H 4J3VA 4OZFH 4Y1AA 1U8LB 1XZ0B 2P45B 4GQPH 3MLUH 5C8JB 2DMKA 3DYMA 4FQXC 1NGWB 5CIPH 5LXGH 3EYSH 3IFOB 5FCUH 4U1HB 2R69H 3IJSB 4PRNA 5FYKD 5GRWA 3DBXB 2BSTA 4XWGL 2NY2D 2JJVA 3RRQA 2BNQD 3QEQE 5ITBL 1MFBH 4U1NA 3FT2B 2NY1D 5EOCL 2CR3A 3BXNB 4G6ML 5JXEA 4E42B 4M6AA 4S1DC 5CEZL 4K8RL 3VFVA 4ZUUB 3F5WA 1JI1A 4S1SL 2HFEB 3SDYL 3IJHB 5I16A 2FECI 4MD5B 1TZGH 4R0LA 2APWA 1KG0B 4MJIE 3KYOB 4YIQB 4FNLH 2UVEA 5CJXA 4BSJA 3RPKA 4OZFG 4NQVB 2BOCA 1T20A 3BN9C 5C0CA 1S9XB 2YKLL 4WEMB 4PD4J 2R1YA 5F7MC 1ZLSL 3KAAA 1MUJA 4M1CC 5D7JD 2VKWA 1DN2A 1EO8H 5HYFA 4QYOB 1Q72H 3TZVB 1U8IA 5HYJE 2JJSA 3WNMA 2MNUA 4I5BB 3QEHA 3I6KA 1LP9E 4KTEL 4HT1H 2MKLC 5FB8A 3FO0L 4R90H 3L5WA 2HG5A 3CSBA 4FRWA 1NFDF 1JTOA 4P99A 2A9ML 5D1ZA 1R5IA 2FBJL 2EXWD 2XTLA 4H88L 1TQBC 2AK1L 5EO1A 3V6FB 4YO0B 1GC1L 1DFBL 4PV8A 4ETQB 2NY3D 4ZG1A 1KENH 4L4TA 2HJKA 5DEGA 3BQUD 1Q0XL 4Z78B 1H3PL 3UTOA 4JFZL 3RI5F 5IIEB 3RVXD 1H8SA 3PP3H 2CDGB 3KPRD 1VKXB 3FO0H 1I4FB 3IAGC 4KTEH 2G75A 3O9WD 2R39A 1HH6A 3MRDB 1BQHA 4KTDL 2DBJA 1BREA 1A6WH 1BLNB 4J4PA 2PO6A 4MAUL 3VGBA 5HHQB 2DI8A 3GSQA 3FAWA 1YEFH 2IC2A 2LU7A 5CINL 1RY7B 5IM7A 5I19L 3NGBB 1FC1A 2Z0BA 4MWFA 3CSPA 3AREB 3M45A 4KROB 4KDVA 3N50A 3WSQH 4GLRH 3KG5A 1A7PH 3KPRB 4M62H 4HMEA 4P23A 1P7HL 3WIHH 1EEYA 4O51B 3PXJA 3OG4B 1FV1A 3EFDL 4UILL 1ZV5A 4KJWC 4MB4A 5FCSH 4ZDHA 3O4LB 2LTQB 3EOYG 1BVKA 5D2LB 3PABA 2F5AH 4Q6IA 2E3VA 3PWPB 1ZHLB 2X9YA 4LSRL 3JUZA 3OMZA 4JKLA 4NZTL 1YEDA 4FXGA 3LV3A 1OGAE 4X9HA 1X5IA 2FHCA 1A7NH 1DTUA 2D31B 4NM4H 3RGVD 4L4JA 3QT2A 1KULA 4HXBL 1F3JB 2ITCB 4ZXBD 4WU5A 2MCPL 1VGKB 1G7JB 2X70A 3QYCA 1JP5A 4J1UA 2WBJD 4JRYD 5LGHH 4U1GC 1C08B 4F7EA 3PUCA 2YBRB 4JGMA 1P6AB 4PJ9D 2X9XA 1H15A 5IW6B 5D1XB 2ZUYA 1TCRB 4ZFZB 4G80B 5LQBL 3WFBH 1A7QL 4OTXH 5E8EA 5GSRB 3TA3C 4PG9A 3K2UL 5ILTL 4JQXC 4I3SL 1U8JB 4TTDD 5M7QA 2V17L 4LCCC 4UIKH 3SDXB 3WD5H 2QSCH 4YDVA 4TVPL 1OAZL 1DBBL 1MEXH 4PGBB 1MAKA 4XCYB 1J1OL 3LS5L 2GIYA 3UPCA 1RIUH 3F7RA 3VD7A 5KS9B 3ARDB 5ENWB 2DWDA 3MBXL 4GO6B 1I3GL 3TVMC 1J88A 5CSZA 1RZFH 2Z4QB 3MFFB 3QDGB 4X9GA 1TENA 5F7FA 3W11D 4H0GA 1WWCA 3P9LA 1OPGL 5C2BH 1KIUA 1NCDH 3IJYA 3CVHA 4L4VA 5FDYA 1S9KC 2B5IB 3O4LD 5JPNA 4X7TB 4LLUA 8FABB 1V3JA 2HMIC 1R24A 2AEQL 1OTTD 2XN9A 4G8IA 2ZKHL 1HWGB 4XGZA 2V5TA 3QA3A 4KMQA 4TULL 2XN9E 3HE7C 3IKKA 5CP3A 1UZ8B 3NAAL 5MHSE 1RZIA 1XF4B 5JZ7C 4KZEL 3TIDA 1ZE3C 1X9QA 1W0WA 1DEEA 1KELH 3ARFC 2IMMA 4JJHA 2NLJB 2H2PD 2VH5H 5GS3A 2YSSB 4DKDC 1CGSL 3LPFA 4HGWA 4P4KC 4DW2H 2CIIB 5IOPB 1B2WH 3O3EB 4F2MB 1ZVHA 2BJMH 2EYRB 3N1GC 1P4LB 1RJLB 1U3HB 3MJ6A 4F2MA 4H5SB 3VMOA 4JM2C 4LNRB 1WAAF 3SY0B 3IDMB 1JPST 5C2UB 4ZFFA 5F3BB 4APQD 3AM8C 5GGVY 4XHJC 2RIKA 4CN1A 1B4JL 4ZTOH 1Y18A 1DLHB 3HI6L 1FHGA 4YHIA 1DL7H 4Y4HB 3FKUS 1D7FA 2JTDA 5HHXH 1RHFA 3NOIA 3A6BH 1HYSD 4PJAE 1T2XA 1X5FA 1OB1B 2YA0A 1LO4H 1A6UL 5EU6E 3HG1A 4ISVA 4U6VH 1T0MB 2D2OA 3EYFB 1DVFD 4S10A 4PGJA 3U2SA 4RA3A 1HQ4A 4WFEE 4XAWH 3HCVB 5DUBB 4L29B 4OCXL 1DBKL 3QQ4A 5DVKA 1JGEA 1FC2D 1FLRH 3P40A 2ERJC 4JGJA 4WV1B 4R97B 1SVCP 2Q8BL 1TPXB 4L3EA 3OKOB 3LB6D 4XPBH 3H42H 4XMPL 1OTUC 3V6BR 1ZWIA 4X6FA 2GJ6E 1DVFC 3BN3B 2HN7A 1DQLH 3V4PL 5L0QB 2Y6SD 4NN7B 4RSVA 5JXAH 1KB5L 1ZHKA 3HC4L 1F11A 4CU8A 1P53A 1FO0L 1VFBB 3BPCB 3SJVB 4KKCC 3H9SE 3NCMA 3B5HA 1JPGA 1KPRB 4N1EA 5J13C 3P4LA 3BDBA 1E27B 1NFIB 3OR6A 4JE4B 4B7LA 4NO2A 4UQ2B 3T0AA 3OKNA 3N85H 4NZUH 1BZ9A 4DZBA 3N0PB 3SE3A 1RZKC 1CTOA 4ELMB 1ONQB 2VXVH 5ID0B 4LHUG 2Z91A 1P2CA 5DJZA 4XVUD 2W1NA 4QRSA 1A3QA 5C08B 1VGKA 4D9QD 2XI9A 1F58L 1Q9WB 1P9MC 4IRZL 5B8CB 2XPGB 2ZNXA 4Y1AD 4PRIB 1RHHA 3Q48A 3QXAB 1T3FA 2ATPB 4X4YB 1OF2B 4F15C 1IAIM 3D87B 2IQAA 1NLBL 3F6LA 4NQUA 5IMOA 2PNDA 5SWZB 2GT9A 5IMOB 1FNSL 1CFSA 3FJTA 3NTCH 5C08A 3QJFA 3VD3A 2YWYA 1HKLH 4QRSB 3IKCB 5SWZE 1CU4H 1YNLH 1XR9A 3UDWA 5SWQB 2GAZB 1E28B 1YJDC 1TFHA 1B9ZA 5E8PB 1U8PB 3PHSA 1F90L 2BVPB 1PZ5B 3QZWB 1OSPL 3K4DA 1DQJA 3F7VA 4O51A 4O5LH 5T1MB 5L2KA 4X9BA 5CP3H 4LMQE 1FCCA 5DMIL 4F58L 1X5GA 4FQPA 4RWYH 2DJSA 2GFBB 3TC9A 3GJFH 5GGUA 4HC1H 1NDGB 5ABDE 1MREH 2WNGA 4LLMA 4HF5H 2BRRH 4V1DD 4KK8C 2IADA 1JE6A 4X7SH 1CLOL 2X5PA 3QEQD 3ZYJA 4OCSH 3ARGA 1QLRB 1M05B 4LLWA 3KJ4B 3QUXB 2ADIB 1UT9A 3TH4T 3L3HA 4CUCA 1N5AB 4XP4L 1LNUA 4XP1L 4EN3C 3OKOA 3KNBA 1CXEA 4RFOL 6FABL 3U48A 1OGAD 2DLTA 2HYMA 2O5ZH 5I8KH 4QHLA 5LCVH 4DGIL 3KXFA 3MLVL 5E2VL 3BP4B 3MBEA 2PXYD 4ZXBC 1KPVA 1ZLUK 5F7NC 1R5IB 3NA4A 4L3EB 3V0WL 3U2SB 2NXYD 3HE6B 3KLHD 5C0RH 3QCTL 3OKDA 1MIEL 4ISVB 2W9DH 4WO4D 1JL8A 3ULUL 5K9JH 1DBJL 1EHAA 1F6AB 1NMCB 4M7JL 3CXDH 1UJTA 2VDPH 4KY1L 3V9FA 1CVRA 4HBCL 4ALAL 2LTQC 5EU4B 2NXZC 1Y18B 4UINL 1U8NA 5CGMA 3ULVF 4Z77B 1N59B 1OB1A 1I9IL 1B0RB 4P3CH 3GMPB 1QHOA 3H3BC 4NWTL 1QBBA 4JCMA 1BFOB 4KK8D 3VE0B 5JIKA 3TESA 4A6YA 5HHMD 1FZJB 3FQRB 4ORGA 3C6SA 4YHOH 3IJHA 5I16B 4KJQC 5DMKA 1CXFA 3BPLB 5ADPL 3ISWA 1OAYL 3MV8D 4QRPD 2R4SL 3QNXA 2EYRA 4QT5B 4YDJB 2GUOA 3B43A 3PP3K 5MEND 4P2OC 3U82B 3T0ED 4OGAC 4HSQA 4L8SA 2NLJA 5GJSH 4Z77A 1Y0LA 3BIKB 1IGML 1PYWB 2FX9H 4JB9H 2PW1A 4NYLB 1LILA 5EU7C 3U83A 1RZIB 1XF4A 5GGRA 1Q1JL 4MMXC 4JFFD 3S37H 1J1XH 4UV7L 3DBXA 5JPNB 1J12A 1GGIH 3Q6FB 1YJDH 5BZWB 4PJGB 1F6AA 1WTGT 2A2QT 5I1IH 2NY3C 3OKDB 2XN9B 4RGMB 4Z95H 1RIVH 4B50A 3R0NA 3HE6A 4M43L 4MJ5A 1QRND 5DF0A 1SEQL 5IJVB 1ND0A 4Q9QH 3K8KA 3EUUA 3ARPA 5IHBA 1GZPB 1TJIH 5E7BA 2V7HA 2YD8A 3BEVA 4J8RB 3WUWB 3GM8A 2IH1A 4TUOB 4YXLL 4FZ8L 1NBYB 3HS0B 4Q9BA 2XTJE 1JJUA 5A2LH 1OP3K 5EPMA 3GGWB 2JE8A 1CYGA 4V2CB 5D5MA 3TBWB 5D70H 1BEYH 1HK6A 4RMWA 4P4KA 2YN3A 2IANA 5DQDL 1M1SA 3SDAC 4U7KA 5D7SH 5FHBL 3A6CL 3V6ZA 1RD6A 1D5MA 1WCQA 2DWEA 3P73A 3FCTA 1XIWD 2DJ4A 4JHWL 3P11H 2B1HH 4JR9H 5CEZD 5BXFB 2FGWH 3IT8D 4WUKL 3SDXA 4S1RL 1MHHB 1UKSA 1CDJA 1AY1L 4AMKH 5DFVC 2ZUSA 2WIMA 5KOVC 2BK8A 3WFDH 4G80A 1A7RL 4YK4C 2BNQE 4OM0L 4NRZB 1OGAB 1V3MA 3U30B 4OLUH 1ZA3B 2X1QA 3SDDD 1FGVH 3ULUF 4QY8A 2NY1C 4HKBA 4MD4A 4FXGB 4ODUB 2MQCA 3BH9A 3LHPL 2XQBH 2J8UA 4YPGA 3ZDYF 2NY2C 1SJVA 3OX8A 4TVPE 3RWFA 1KJVB 3PABB 3MRQA 3CPLA 1FDLH 1GGYA 4QRPE 2VB5A 3MCG1 1PY4A 3OAYH 4UDTB 4PRIA 4LFHD 4M6OL 2XPGA 5T1KD 3RWIB 1GGBL 1ZHLA 4FXLA 3HE7A 2AQ3A 1ZSDB 3OB8A 1P5UA 3MYJA 5MEQB 4HJJL 4HIEB 3L5JA 5AD0A 3MV7D 4X7CC 1H3VA 4KXZH 4JRWA 3LKPA 3SGKA 2I24N 1F13A 3STZA 3BJ91 1ORSB 4LVNB 3G5ZA 4ZYKB 1N7ML 1ZHNB 2PO6B 4OIIL 3CVIL 1J87A 1IGYA 5MENA 2EEDA 1A6ZB 4NO2B 4LCYA 5TH2B 2VZSA 4L9LC 1MI5A 3SDAD 4XI5C 1JWUB 4IIQB 3GMOB 3RVUC 1YEEL 2B39A 3BPCA 1YUHB 5DJ6B 1CFBA 4JRXB 4X4MA 5EU5A 3HC0A 5FOBA 2GSIB 5DDHB 3AREC 1IC4H 4MNGE 4OBSA 1G7PA 3H3PL 3SGEH 4JO1L 4HUMB 1WBXB 5I1EH 2P43B 3AB0B 2NY1B 5INDA 1EZVX 2QQQA 2HVJB 3U4EA 4DKAA 4HZAA 4D8PA 3VRLF 2R2EA 3CD4A 5DEGB 5ACZB 3KPQB 3DARA 2XG5A 2DICA 2DRUA 4I9WD 3VWJB 1CFTB 4ZAKC 4MNQE 2XFXB 1AXSA 4ESKA 3HCVA 1X4XA 2AJ3A 4HS3A 4WUUA 3UPRA 3AMLA 2VXTL 2AK4A 3TO4D 2UV3A 1ZGLM 4J4PC 5DD5H 5JNYA 1ZTXH 2YPKB 5IQ7H 1WC7A 2IH3A 1JGUH 2P5WA 4MJIB 4HBQA 2VDKH 1AR2A 4HX1B 4LNVA 5FO9B 4DQOL 1DLHA 2NY4C 3CDFA 2FJFA 3I02A 4LARH 2PYFA 4J3WA 4MSWB 4QHKJ 4GRWE 5HYJB 2FRGP 4LPTA 3IDMA 5C0CB 5F3BA 3QCUL 3PWVB 1BOYA 1N7MH 2EDNA 4RGNC 5AAWA 1X4ZA 3KYKL 4X5XB 4YH6A 1SYSA 4NFCA 4WTWA 3TA3D 2Y1VA 5IOPA 4LP5A 3UC0H 2QR0A 4OZHE 4MD5A 1H3UA 2X40A 3FRPA 1S9YB 3QEQB 3CC5A 4UU9B 3PGDA 4HMDA 4YDLB 1NGPH 1YNKH 4Y16B 1T1XB 1VFOA 4XPFH 1RUPH 4QNPF 3S96A 4IDLA 3IFOA 2YEZB 1XGRB 2EYTB 3E0GA 5D7LD 4M5ZH 1P7QB 5JW4R 4LQFH 2AV7A 4Y1AB 1F4XH 4XMLH 4FQLH 1EFXA 4X7TA 2E7BA 2VR5A 12E8L 2ED8A 4P4RB 1N5YH 4P2RB 4ZMAT 5C08D 4MA3A 5C09B 2VNCA 3D3VB 1CGVA 5BW7C 1KFAH 3FFCA 3N1FC 5C0AB 3T4YA 4CL7A 5HD8D 2NPLX 5CSGA 1F45A 3MFFA 4X6CF 4C56E 1LEGA 1D5XB 1SYVB 3PHOA 5D7JB 3O41B 4PRPA 2B1HL 5GIRA 1CQKA 4P2OA 5TE6H 1GGTA 4RAUA 3NFSH 2UWEF 3QXUA 5D7LE 5DQDH 4IEFB 4HUXA 3QQ9D 4JFPA 2HJFA 3QIWA 2IQ9H 2WIIB 3ZSTA 3B6SA 2AXHA 3RQ3A 2X4QB 3KVQA 4P46D 5D72L 3UBXI 3MRFA 1PKOA 3LDBB 1JUFB 1RZ8B 3GKZA 1DE4A 3NZHH 4FZ8H 3I75B 4PJEF 4XZUB 3FO9B 4EI5C 1G6RB 4Z18A 2KDGA 3MNZA 3PDOB 1NUGA 3G6JA 5EZOH 4LVOB 3UAJC 4J6RH 5IK3B 4KH2A 1YY9C 3QUMH 1FVDA 4MQTB 1Z3GL 5LWYL 4OCRL 2V5RA 3MR9A 3VWKC 1F3JA 2ITCA 3RZCC 3ZHDA 1XGYL 3C5JA 1JTTA 3DO7B 2C7UA 4CJ1A 2R2HB 3GJFA 3LV3B 1J9CT 2AJYH 3VU2A 3B2UD 1AIFB 3G6JE 2C26A 4L3ED 1HXMB 1CK0H 4OJFH 5DYOB 3U6RA 2FATL 4XAKE 5ANMB 1HXYA 3ULUD 3T2NH 1BVLA 4PUBH 4ZSOB 5M95B 4R7DA 2ARJA 1BVKB 3GRWH 4YR6B 1IGJB 2ADFL 4HWZA 3GI8H 3UZVB 3ZKXB 2IALA 4M1CD 1IVLA 4FTVD 3SEPA 3C6LD 4Y89A 3UJIL 1FV1B 1DVFA 4H1LH 1OD7A 3QUMA 3EYUL 5D1XD 4OCYH 1OARH 3NVQA 1NC2A 3T3PF 1W0VB 2E9JA 4U31A 4WI8A 1UG9A 4UNTA 2OJEA 5BRZA 5DC0A 3RWGB 3HMWL 4LASH 5D8JH 2BNUA 1M7DA 3MRBA 5IM7B 5DMGD 1M7DB 3MRBB 4HKJB 4PTUB 4D2NA 4EXKA 1G6VK 4K3HA 3FQTB 1LGVA 2O5YL 4XTRC 4S1DD 2VAAA 1MCFA 1G84A 4LVHB 1BD2E 1ZHBB 5TDOA 3MRLA 4X6EB 4PJ7F 1ZANL 4YUEH 5EC1B 4YR6A 3RAJL 5H94B 5FECB 5DHXB 2AJXH 2HRPL 3RWHA 3WIFB 4Y19B 2YRLA 1OW0C 4MQ7B 3U0PB 1GSMA 4LPVA 3CU1A 4R8WL 4ODTH 4I77H 1WT5C 1R3KB 4PJCF 5E5RB 5FO8A 1CDGA 4XP1H 3LEXB 3HA0A 1L7IL 1T89A 2CXGA 3ARDD 2L7JA 4H25B 4YHLH 3SDCA 4EDWH 4KKLD 3HAEA 2HWZH 3EOAA 2G9HB 3B3IA 3KPSB 3D2UB 4ODVL 3OKMB 5F88A 4C56B 5TDPB 4WFFD 3SGEI 2AJVL 3FO9A 4OCWH 2LE9A 2R1YB 4OZGF 5KBNC 1J1PL 2VIRB 3K46A 4LKXB 4ZUWB 1F2QA 2BRRL 1WFOA 3DYPA 4NHUB 5FYJU 3HZKB 1MHPH 4IRSA 4P2RE 4XPHH 3RUGB 5D93B 4Y1AE 1S9WB 1VADA 1W0YT 5IGXH 3ULSA 5FGCE 3IRPX 4S2SA 4L3CB 5L7XL 2AGJH 3HNSL 3QDAA 4P2OB 3MRNA 1MWAA 3JV6A 1DN0A 4QOKB 1FL5B 4BH8A 4OFYA 3O41A 4PRPB 3QUXC 4NUGH 4PJIE 4U6YB 3TBSB 4O58H 3BHBB 3NTCL 3PWJB 4LOUC 1B90A 1UJ3B 3FT2A 2ZJSL 4JZOA 1CCZA 2NW2B 3QIBB 1Q9OA 5KW9H 4WFGE 1N3NB 2P5WD 4MA3B 3C6LA 3IJSA 4PRNB 2D9QB 4QCIA 3X13B 5GPRA 4FXKA 4M3JA 1ZEAH 5MERB 3RIAK 4XVJL 4QTIH 2DL9A 2H8PA 5C0CE 4ZXBA 2H8PB 4ZXBB 4KDWA 4BSWB 1WAAA 4UQ3B 1T6VN 1WT5A 1UB6B 4U49A 2N1KA 4YDIH 1MWAH 3DUHA 5KSAD 1BJMA 1ZXQA 1QFWM 2LU4A 1NUDA 2EIDA 4U1MA 4BFBD 3OAUL 5GQBA 3HG1D 5JHDA 3HRZB 5KSBB 1S9YA 3BHBA 3PWJA 2FDBP 4NZRL 5DQJB 1HILA 1FIGH 2EIZB 4EUPG 4XPHL 1BIIB 3TWCH 4GW5A 1YYMH 4JO3H 5E4EC 3FMGH 2XRAH 3OZ9L 4U4BA 5EDXA 1NEZB 3QP3A 3HLAA 4BFEA 2X6MA 1TVHA 4JFFE 2P47B 3SKNB 2BSSA 4OZFA 3VFSA 3VRJB 3VG0H 4FP8L 1VADB 4APQA 4DFHA 1QBLH 4KRPD 3ARRA 3GBMH 3QDME 4FQQB 3SDAA 2AJUH 2FJFB 1YEIH 4XCEA 3L3IB 4GKNB 4AG4L 2BNRE 4X6BA 4OZIB 2DMCA 4EIZC 3D0LB 2X10A 3CFBA 3FQWA 4QO1A 1CDUA 2P5EB 4YBQC 3GHBH 2UWEA 3H9HB 3LKQA 1UM5L 2F19H 4JRXE 5TDPA 5GS1B 5JW5A 1INDL 4ZQKB 2AJ3B 4PTTA 1J7VR 1T0NA 2Z31A 3PL6A 4G3YH 4HQQH 4YNYA 1S3KL 3TV3H 4FN0A 4ZO9A 5E56A 2OTUA 3E8UH 3UTSB 5F1KC 2H2SC 1NBZB 3Q1SL 2XN9D 4JPIB 1EMTL 4LSTH 3QDMA 3AS2A 3IDGA 1IQWH 5HHXL 3JV0A 3JZ7A 2KBGA 1G7IA 3GSRB 5D1ZD 5DD1L 1CBVH 3BZ4A 1R3IL 4MQ7A 3U0PA 3LVEA 5HYSG 1Q0YH 4QHKI 5DDHA 2HFFB 1PAMA 5H94A 2VDOH 1I8MA 2R9HD 2EDLA 1NMBL 3EHBC 4G8FB 4RDQG 3SDDA 2VZTA 4HH9B 2XNAA 1AGBA 2FB4H 4QRPB 2X4RA 1FAIH 2Z35B 3EFFA 3QIUA 1F02I 4R96A 5GGQL 4POYA 4AIZA 1G0YR 4CVZA 3B2VL 5I30L 1P9MA 3RWCB 3MBEC 3MOAH 1JNNH 2R0LH 3CFKB 5BVJA 3TA3A 5IVXA 1CVSC 3WFCH 1MCQA 4UNVA 2X89D 2ADFH 1JGVH 2DIBA 1UWEH 2ZCHH 3WEXA 1BZQK 2ZKHH 1H3XA 4RA0C 1MLCA 4I8DA 2FATH 1MF2H 1Q9KB 3MX0A 4NO0B 3T04D 1CXIA 3H8NA 3RWIA 1AQDA 4Y2DA 3QULB 4MVBD 4PJ9A 2IALB 3TFKC 4NCC2 3DI3B 1CIDA 4QHNA 4Z7NF 5TPWH 3TYFB 4Z7WF 3RGVB 3FT3A 1LE5A 4U2ZA 4YBHA 4X0KA 3H0TA 5I9QB 5H37H 3PHQB 2VQ1A 1VEOA 3WNLA 3RGVA 2FX8H 3V4UL 3ZDYE 1I1YB 4Q6IC 5D9SA 4HFUH 4YEEA 2C7UB 1KLUB 5T33H 4YLQT 5F96H 3BYTA 3U36B 4R3SA 5J1SC 3TVMB 4DVBA 2GTZA 2DDQL 3ZYIA 1CDIA 5D72H 4AEEA 4CVWA 4TVPH 4G42A 5GZOD 4AM0A 2R2BB 1YN7A 3Q5TA 3N1PC 3QFJD 4G7VL 2HT4C 5JW4N 1OGTA 4LCWB 3ARXA 4C55A 1LK3H 1OW0A 4R96B 3NFSL 4MJ6B 2GQHA 1LO0L 5ISZE 3DIFA 4YHKL 5A3IC 2A9NL 4P4KB 5F93C 2EC9U 2KZ1B 7FABL 1BQLH 2V9TA 4QRPA 3WKMH 2ADJB 4LCIH 1YPZA 2A0LD 4LSVL 3LEYL 3S5LB 4TNWK 1H3TA 3MRCB 1HZHH 4GKSB 1EK3A 2DAVA 4U2YA 1B0GB 2J4WH 5F97E 5C6TH 1OL0A 3QG7H 4K3EL 4G43A 2BNRB 4OZIE 2RBLA 2A74A 1J0HA 1F4XL 2R15A 2BCKB 4XCFL 4FQCH 1IEBB 3I9GH 3QDMB 3MJ7B 4JFDD 2ESVA 1G1CA 4KUZL 4DFIA 3QUZD 4JFFB 3WIIL 4QXWA 4C83A 1QQDB 4LRIC 3C2AL 3IGAB 1KBGH 4PRID 4PTTB 4XCFH 3LHPH 3AGVA 5JOPE 2AV7B 4ZQKA 1V8HA 4QF1A 5I71B 4WEBL 4ZPVA 3T4AB 4X83A 1CT8B 4PRHE 4P9MH 4LCWD 3WO4C 1EGJH 1A7RH 5DK0B 3DLQR 1EUTA 1WJ3A 4OKVB 2F74A 1A21A 5AWNL 4DOHE 3GKWL 4XVTH 4RMTA 1BOGA 2BVTA 2V5YA 4HPYH 3VRIB 5BMFH 2BSSB 1FZJA 3FQRA 4OZFB 1KLGA 2QR0B 1YDPB 4YPJA 1LK3L 1PLGL 2Z93A 3O6MH 1T1WA 1EHLH 4JFOB 1KOAA 4KRMB 5DD5L 2QSTA 4RMVA 1MOEA 3RP1A 5FKPB 3E2HB 4K9EH 1FNGA 5IHLB 3GJEB 1U8QB 4D9RE 3BMVA 1S7UB 5J3HC 2V5MA 3QBTB 3WLBB 4XRCA 2X05A 4RNRA 3RBSA 3VGAC 1A9EB 3DTXB 1XF2B 3OXRB 5FGCB 2VLLB 2N7BA 1PGRB 4BSWA 3QZWG 2GY5A 3SCMD 3VW3H 4PRHD 3KR3L 4LPXA 3RUGE 2E7LA 1OTSC 2EE6A 5C0BB 5BW7A 1M6OB 1C5DB 3H3PH 5E4IA 1VESA 1U58B 4Y19D 1NSNL 5EULV 1K4DB 4L3AA 3RHWF 1J11A 3U4EB 4GAYB 4JFHD 2YZ8A 5CD5D 4FNLL 2WWKT 3RU8L 1FL5A 1UWEL 1T2JA 1A5FH 2C1OB 5EUOA 3AU1B 3D25B 1U92B 2E7HA 1QLRA 4L3CA 5HYIA 4WTZG 1S8DB 3P0YH 2CUHA 1EHNA 4M7LH 1M4KA 1UCBH 3ZT6A 2VN7A 1QHPA 4XP5L 1KYOK 2NTFB 5E95B 4XH2A 3UTTA 3BPOB 3QB7C 2VXSL 1JHLL 1X5ZA 3DVNA 4G6MH 3MUGB 4Y19E 3V5HA 1ZVSA 2QADC 3BVNB 3NA9L 2VIRA 4XCNB 1OQOA 1ZHNA 3KJ4C 5C07B 2BVPA 4BA8A 5L8KB 2HT3D 3WBDA 4TUKH 3RFZC 4OFIA 4MA7L 5KS9F 3GO1L 3RUGF 4WU7B 3K0WA 3MYJB 5MEQA 3KLAB 3N9GL 1LWRA 2V2TA 2P7TB 4GS7C 5DJXB 4JN2A 4X6DA 4XC3H 4XNXH 5I1DA 2IQAB 3DXAA 1AGFA 2CSPA 2EDEA 3GSNA 2VITA 4UDTA 1U42A 1HSBB 3WDHA 3V6OA 3UX9B 2DQCL 3E1F1 1JZ4A 1YEGH 4KZDL 4EDXB 3EO1A 3X3FL 3GBNL 5AYUH 3QQNA 1LVEA 2Z8RA 3A67L 1WGOA 1YMHA 1S7WA 3O8XD 4MA1B 3QDJA 1GIGL 4H0IA 3U7YH 3ZT7A 4MD4B 4DZ8B 1IM9D 4X9IA 3CZFB 3HMXL 5ID0A 1KACB 2GHWB 4RIRB 1OGAA 2JLLA 3QCVL 3REWA 3A6CH 1E4WL 1KN2L 3OKNB 3SE4A 3FQTA 4AT6B 1RJCA 4OLXH 5EBMB 1ZGLA 2IGFH 3CFEB 4P2YA 5ANME 2M2DA 1ZT1A 2UZIH 4EI5D 4HV8A 4YBLC 5D6CB 1A9BA 3HC3L 1EHXA 2DQHL 3UYPA 1H5BB 4C4KT 3VD5A 1WCBB 5C0FA 3GM0A 4PGCB 4YXLH 1F11B 2MFNA 3H3KA 3NCYP 3L95A 1QYGH 3MROB 4L5FH 3RTQC 4L8DB 3BAEH 1FL6A 3DX8B 5E5UB 3QI9D 5HPMA 1F90H 4PLJD 4X6FB 5EPMB 5JOFB 4R4ND 3LZFH 5KSVA 1YZZA 5IF0A 1U6AL 5CJXC 5T5NG 2X4NB 1N8ZB 2Z8WC 1I3RA 4Y4FA 1FNSH 3V4VL 1A1MA 3VXSB 1GZPA 4UIMB 3JTSB 2E7CA 3DMMD 1ND0B 4LLVB 3X3FH 3B9KB 3AAZA 5D7LB 2DQCH 1GZQA 2ADGA 5BV7B 1J05B 4OGXL 4JRYE 5E00B 5DURB 3B4NA 4XP6H 3ESUF 4U6XA 4X7FC 4BUHA 3HMXA 4IJ3B 4P23C 2BHYA 2R8SL 4MA7H 4K71B 1T7YA 25C8H 2D7MA 3O2DH 4NQTA 3ARBD 1RJLA 1U3HA 2X4QA 3QNXB 3HFMH 1G7MA 2HRLA 4NSKB 4OKDA 4LEOA 1I75A 4JHZA 4F9LC 4QHMB 2YSSA 1KXQE 1MHPL 1UYWL 5HYJD 2P8PB 3SBWC 1PD6A 5D7IB 4Y2DD 5H2BB 4HDIB 1HNFA 3L3GA 5CAYB 2DQFA 4WHYG 5JXAL 3LQAH 3P0YL 3TYGH 1JHTA 1R5WB 1CE1L 5C0RL 5FF6A 2A6JA 3RVVD 4XMPH 5C0AA 3T4YB 4F37K 4C4KO 4IMLA 4IRJA 3LPWA 4OSUH 1X4YA 3PV6B 4AQOA 3QXWA 1IGTA 4P5TA 1QKZL 3MUJA 5JDSA 4KRPB 1CR9H 1JYNA 3AXLA 2NY6B 5A40E 5GSVA 5IFAL 1DBKH 2AEWA 2VKXA 1DJSA 3VH8G 1QSFE 1XGRA 1G9MH 5CP7A 1J8HD 3GSXB 3V8CA 2AI0H 5KVGL 4M48H 4WIQA 3S3SA 5MI0C 1JWSA 1D5BA 4Z7QF 3UP1A 3VDBA 1WITA 4HEME 4X8JB 4P48A 4I2XA 5JXEC 3VGFA 4IHOA 2MJWA 4Z0BH 1NBQA 5EBWA 5I76A 1ETZA 1FGNL 5FIEA 4Q9RL 1MREL 4CU6A 4Y2DC 5DUML 1TQCC 4MYWB 3QNZA 2EXYD 1NCNA 3UDWC 4HW6A 2E7LC 3LOWA 4NM8H 4R0LC 5DMIH 3B8YA 5E4EB 5ID1B 1KTDB 4Q0XH 5A2IH 2OP4L 1SJHB 1EEUA 1MAMH 3ARBC 4HHAB 5CUSH 3I02B 3HMWH 5IW6A 1EAJA 3WE6A 2J8HA 2PO6D 3C60B 1V7NH 3GK8H 1CICB 5J12C 4MNGB 3P2TA 3PGFH 2L7UA 5EA0H 3ZE1F 1LDPL 4HIJA 1DBAH 5IQ9B 4N0CC 3OJVC 1QPPA 5EWIH 2NY0C 3QZWA 4HG4K 4QLRA 3SE3C 4MCYA 2CIKA 4IRZH 5E1HB 3MPCA 3CX5K 4POUB 4LL9A 4I3GA 1LK2B 1IAKB 2GT9B 4JDVB 1NGQL 2FR4A 3QFJA 5H35A 5GS2H 4J2XA 1CE6B 1PEWA 3O4LA 4HD9A 1F00I 1WBXA 1RZFL 2ZOKB 3BYYA 5LBSL 1BGXH 4PJ5B 5DR5L 4LSSL 4PLJC 1F8TL 2P8LA 5KANG 1KNOA 1WF5A 4PJFF 4Z0XA 4EVNA 4DN4L 4JZJA 2DKMA 5GJTL 4N0FA 1Q9LB 4NKQB 5C3TA 3SKJH 2QSCL 3MLZL 5FO7A 5C0CD 4PJ8D 5J13B 4NWUL 1D6VL 2Y06L 1IM3B 1XIWC 1FJ1B 1KB5H 5C09D 1EO7A 1NFIA 1PDKA 1E4XI 5F9OL 5A16A 3NCCB 2BC4A 1LP9B 1VDGA 1G0DA 3BQUB 4QRQA 5JORB 1VFBA 3X17A 5IVNA 4OFYD 3OXSA 2X89A 2R23A 3U9PH 5J4MA 2Y23A 3EYQD 3O9WB 2IPUK 4PJ5A 3WJLA 4F9PA 5JPMB 1E0OB 1SY6A 1GHFH 3KS0H 4PV8B 1SQ2N 1CE6A 3MRGA 3QIUD 3BKJH 3CPLB 4TRPL 5T33L 1VEMA 1KJVA 5DJ2B 2ZSVB 3T2OA 2FLRT 3PL6C 4HWBH 4JDVA 3VDCA 5HY9B 3LRSB 2CDFB 4U7SA 5D4QA 2X7LB 5I71C 4M03A 1K2DB 1U3HC 3MV01 4P59L 5DJDA 4OUOA 4N8PA 1T0MA 2ICEB 5ESAA 2PYEB 4UOJA 1J0JA 3T77B 4O2FA 1S9XA 1SBSH 4WWKC 1YYLL 4KDTC 1FNAA 4YHIB 4FTVB 4GMTH 4DW2L 3GMQA 3O6FC 3LKNA 4L8SC 3UC0L 2Y07L 3PWLA 4HHAA 3AB0C 3S4SB 3RKPA 1QEWA 1KELL 3C8KA 4JFXA 1I1FB 1BX2B 4ZUUA 2IANB 1V7NL 4GG8B 1IC5L 3O11A 5F1SA 4TULH 2AERT 1OAXH 3NN8B 1YEJL 5E0QA 5E6ID 5IQ7L 4PJDA 1BFVL 2NY5H 4EZMA 5IHZA 1C7TA 1KC5L 3FN0L 4QRRD 4TUOA 1KSRA 1UZ6F 3VCLA 1QACA 5IV2A 3UTPD 2P5WE 1SBSL 1JPFB 1IT9L 5DD6B 3GMNA 1CD9B 1DFBH 4Z5RB 4MJ5B 5KSUA 1H5BC 3EJJX 1YECL 5DT1H 2BDNH 4JREC 3ZLQC 2P46B 4WO4C 3FFDA 1F6FB 1FCGA 4ODSL 4ZS6C 3DURB 4KHXH 3MV11 1N26A 3DURA 5EZJB 4JPVH 4X98A 3RWDA 3R8QA 3VCLB 5FM4A 1NCBL 5BJTA 3CH1A 1RIUL 1FYTB 2J88H 1TITA 4Z5RA 1NAMB 1N0XL 1TDQA 2ZCLL 1JF5A 1EEZA 1GHFL 4AY0A 3IYLW 1KGCD 5F9JA 1SM3L 3WV0A 1FPTH 2GUOB 1T7ZA 1DQDL 4NQED 1G7LB 5D2NB 4KKBC 1UH4A 1OCWL 1JZ2A 1PSKL 2GJZB 3FTGB 2BFVH 4UI2A 2VZ3A 1I1FA 4IOIB 3UYOD 3HN3A 4BFGA 3D18B 4ORGB 4G5ZH 1G7QB 3GSUB 4BZ1L 4HMCA 2Y06H 1FQ9C 2F15A 1HKFA 4PG9B 5CEZH 3UZQA 3MACL 3QWOA 32C2A 1N59A 4RAHA 5LGKA 2FL5B 5JOPD 2ICEA 3SDCC 3HI5L 4O4YL 5FYKE 1FIGL 3V5KB 3TN0C 1GGBH 1UZ6E 3ZE0E 4K7PH 5JXED 2DN7A 1FRGH 4UMGA 5ICZB 3K80A 3O6LH 2F5AL 1SY6H 2XWJB 4G6KH 2H3NA 4PJXF 5IBUB 3LSOB 2BVQB 2C3GA 1VHPA 2VR4A 2GITB 2Y7QB 1KPVB 1BECA 4Z7UB 2X7LA 4UILH 1UB5A 3L3DB 1A1MB 3P4MA 4XP6L 1KUMA 3WIHL 5I1JH 4CMMB 1E4XL 4X4ME 5DJ2A 1JZ6A 1HH9B 4OM0H 4Y4FC 3SDCD 1ERNA 5CINH 3O3UN 4G6JH 2K9UA 2QLVB 3RVVC 3CCHB 3RPIB 2XWBB 4MAUH 5EIIA 5JPMA 5DO2C 3RNQA 1EEYB 1RPQA 4PB0L 3WN5A 5HHPA 3GSWB 3P11L 1QBAA 3GK8L 2CKBL 2OQJA 4NQCE 2E27H 2W91A 1MVFA 4KK6D 5C0JA 1J0ZA 5DUPH 5LGJA 2Y36L 3GSQB 2CMRH 2DI9A 3QUYD 4LBEB 5E6YA 3HPJB 1QD0A 2VLRB 4U1LB 3VWJD 4KKBD 1KTKE 3LD8B 4GRLC 3ILPB 4IMKC 3VFOB 3NABH 3VFNA 3ELAT 1C16A 1B6UA 5C08E 3QI9A 2D03L 3MRDA 4MNQA 3S36H 1KENL 4MX7A 2JKXA 1I7UB 2AEPL 2CH8A 1GC1H 2LFGA 3CZFA 4YJZL 1IFHL 3HUJE 4PFEA 5HYEA 4OCWL 4Z0XB 1MRCH 1CD8A 1OAQH 2ARJQ 3CMGA 3QJFB 5I75C 3ILQD 4MZ2A 4YAQB 5LKNA 1LDSA 4Q9QL 4QNPE 5DGRA 1T0PB 2YPLE 1BQUA 3ORJA 1ZLVK 3LQZA 1RHHB 5J06A 4J3OC 3U7YL 2A1WL 5IFAH 3SDXF 3A67H 2FR4B 4I77L 2HG5B 1S5IH 1H3GA 4K3DH 5F71A 4IRJC 1IGMH 5DJZB 1A02N 1A3LL 3CFDA 4J23A 2FLBT 4EUPA 2Q76B 3OPZH 1LQSR 3WE6B 2IPKB 4MXQD 1TTFA 4WUUD 2D7TL 3BDYH 1DUZA 5L8JB 4IDJL 2EC8A 1I3VA 2W65A 5L9DH 3N9GH 3GSOB 3UPAA 3K8MA 3I2CH 3CDYA 3C87A 2ZUVA 1JMZA 1JV5B 1MQ8A 3GO1H 3O4OB 3Q2CA 4RBPH 5T1KB 1MJJB 4YIQA 3ET9F 2KPNA 3D9AL 4HUNB 3ZE2E 3D85D 1MLBA 4XX1E 2HFEA 5EU6B 5FGSA 4ONGH 1RIHL 1BBJB 5AZEH 4WWKD 3MXWH 2EDXA 4I2XB 2YN5A 4I13B 3OJDA 1BF8A 1XEDA 4I0PB 4N5EC 1ETZB 3WL9B 4M7JH 4UTAH 3DX7A 3OGCA 1OOAA 2JIXA 5IT2L 1DUYB 1HHIB 4AK1A 1MJUH 4RGMC 5ITFB 3RL1A 3C08L 1JWSB 4PUBL 4AZ8A 3WS3A 4KMTL 5DUBA 4HKXA 1CFVL 1EAPA 1F3DH 2O26U 1NGWA 4LLDA 1RAMA 4K8RD 1S5IL 4J3UA 5HGDB 3OTTA 3ULVH 3HG1B 3MJ8A 3F7QA 1L9MA 2A1WH 4RNRB 3P30H 1MFNA 3ESVF 5D6DC 5ISZB 2Q8AL 4TOYH 3PV6A 1BMGA 2XIDA 4LMQI 4R4BB 3RIFK 3CDGA 5E2WH 3GJEA 5D7IA 1RULH 4KJPC 2BVOB 4ZFFB 3SO3B 2BXYA 4YC2C 4JFOA 3JV4A 1C8PA 4Q6YA 4AIOA 3O0RL 2MCG1 3S8WA 5ACMA 4WTZA 3S36L 1A2YA 4PYGA 3HC3H 4H26B 1MNUH 1RK1B 4K9EL 3QDGE 2BOBA 4RWYL 1Q38A 4NRYA 5DRXB 3F7YB 2UZIL 3O6ML 2FZ3B 4L8BB 4G6FB 1YEHL 3QG6A 1SMAA 1LO3L 5EOCJ 1MVUB 5KS9E 1MCSA 3HPLA 4XNYL 5JW3L 5KN5B 4O2CA 2WBJC 1E4KC 2FJGB 4I9WE 3SGKC 4LAJH 1S5HB 4UIMA 5E00A 5C7XL 3OAZK 4TUJA 2GSGA 2HT2D 3RGVC 2DQTL 2DTMH 5KAQF 4ONFH 3L7FB 1MCHA 1V3LA 2VLRD 3DRTB 1D5ZB 2H32B 3OHXA 3B9KA 5I1GH 3A0OA 4KJYB 1R5VA 2A74B 3CUPB 2IAMC 3QEUB 4JJ5B 3STLA 1KBGL 3ZYOA 4AENB 4P5TC 3GHEL 1I3RB 2XWTA 4TSBL 3VXPA 4DVRH 3MROA 3PGCB 1K4CA 4MJ2A 5KS9A 1FZMA 4KUZH 1R3LB 3ALXA 3MRCA 1SY6L 2GCYA 5CD3B 1FRGL 2GI7A 4XCYA 1ZA6B 3G04B 3N1QC 3PQYD 4MGXA 5C6TL 2MPAL 3KJ6L 3PWPE 4O4YH 4JFDA 5AYQA 4Y5XB 3TT1H 3VFGH 2FEDC 4XXDB 5DGQA 5CEXB 4ZFZA 1BJ1H 3MUHL 3UJTH 3ZKSD 1NCWH 4G7YL 5GXBB 2H6PB 3O3BA 4WFED 4KK5C 4AM0B 4HLZH 4PJ7B 4S1QH 4MD0B 2PF6A 4NQDA 4MXQC 2OS7A 2OK0H 3O9WC 3DV4B 3KPRE 5HHNB 5LG1A 3EJZC 4AYFA 4KI5E 1RZKH 4DUWA 4WVRA 1T6WA 4KMTH 3RVXC 4M3KB 4G7VH 4C58B 5C86A 4MJ4A 3CH8A 4DZ8A 5DA4A 4G9FA 4P2CG 2EDQA 3GSNB 2YHGA 1SBBA 1AGFB 2ZCLH 3CFJB 4JN2B 3GBLA 5DRWB 1X7QB 5D2LA 1HSBA 1XAUA 4PJEA 3KR3H 3OR7A 1FAKT 4JPVL 4AEHL 2XZQL 4PJHA 4QRUA 4Z7OF 1BBDL 3FRUA 5F6HI 2E9BA 2CJUL 1LEIB 4GBXA 4QXTB 4IOFD 5F9AC 4U0QB 3E3QC 2ICES 5JDJA 5DJ8B 2HJLB 2QQNL 2R0KH 2ZOLB 4XTRD 4M9PA 5DI8A 3C09C 3ZHKA 3VGEA 1EA9C 5KSBE 1S7TB 2VE6A 1OQXA 1PG7X 1QSVA 1IMHC 3OB0K 4Y8AA 1ZVSB 4RWHA 1RZ7H 5A3ID 2C1OA 5FHAL 2G75B 3PNWA 2AXGB 2W0PA 3CIQA 1KEMH 4NN6C 1I8MB 1H0DB 3RL2B 2BERA 1F6LL 2D7PA 3WNPA 3D25A 5GZOC 1LO5A 4XNQB 4HK3N 3EO9L 4Y5VB 2FB4L 3ARGD 5GGTL 4HJJH 5E9DE 4WEBH 4F15B 1DQTA 4BQ8A 3DMMC 2CK2A 5I0DA 1QR1A 3IU3A 4LSUH 4DAGL 4ZNEA 1JGDB 3CK0L 1ED3A 3WYRA 1UADC 4FQXD 1CBVL 3CLFH 3O45A 1CGTA 3VXOA 3WIIH 4F7TA 1VB9A 1AHWA 1OAUH 3S97C 4RRPA 3G5YA 3SPVA 2Z31C 1OT2A 2X1WL 4HWBL 4PIRF 5KSBF 3MNWA 2UYLA 4XHQA 3FO1B 1AE6L 5HGGS 2IBGA 4TSAH 1UWXH 3TV3L 2VTFA 3B5TA 2CK0H 3ULVE 2Z92B 3VXTB 3WFDL 5C9JB 4P46C 5J1AB 2E27L 4KK5D 1UXSB 3V0VA 4ZFGL 3S35X 3MV9B 3TJHC 3VD9A 2OL3A 1BOGB 3VFMB 4KXZI 2NYYC 1TVHB 4OTXL 4JM4L 5C0AD 1NEZA 4PS4H 5EBLA 2L0DA 1LO0H 1V7MH 3B5GA 3P4NB 2RFXA 3BJLA 5EUOE 3JWOC 3BXNA 2HVKB 1QBLL 2EH8L 4G8GB 1E4XH 5D70L 3VG0L 1JNHA 3BP6B 5JHDE 2B0SL 2EH7L 1CLYL 5ADOH 3EDEA 1GCFA 5KZCD 1QOKA 1M7IB 3DGGA 5HHOA 1U8MB 4HUUA 1QR1B 3T4AA 1U3HD 5C07D 4Q74A 3VXUE 4ZS6D 1KN4L 4UTBL 1U8LA 1XZ0A 4HFUL 4HJ0D 4LSSH 3NBNA 3TNNA 2OYPA 5D7KD 3VXOB 1JNLL 4QCIB 2H2SD 2E8YA 2CXKA 2R1XB 5JHDD 2HT2C 1MWAL 3VI4E 4Y8DC 2Y25A 4JGUA 1GGIL 1UJ3A 3EYQC 3S37L 4S11A 1NGZA 4NBZB 2EH8H 4XVJH 1OP3H 4OD2B 1ZEAL 2PKDA 5I1HH 4MA8L 5EOTB 5B38A 2FX9L 4JB9L 3W0WA 3V7MA 5DHVA 1SEBA 1JGLL 5KVFH 2PXYA 4F7PA 5EA0L 3C8DA 4AL8L 1VFUA 2V6HA 3PXHA 2UUDK 3BD4A 1TNNA 3NIFF 4NUGL 3IDXH 1DQDH 3DROB 4HUVB 2AW2A 1OT1A 1FNFA 1Y6KR 2XZAH 4D0CB 1I7ZB 2AXJA 5HSFA 3BGMB 3UBXB 3BE1H 3MRIA 3TVMA 3ALWA 4DVBB 4GBXB 5F88B 2VLKA 3LKSA 3TO4C 2R2BA 3SDCB 1KJMB 1FFPB 4HWBA 5DK2A 4MS8C 5D71L 1Q0YL 1WZMA 5FYJH 5DRWA 4RGNE 4H88H 4ZTPH 3HR5B 3PHQA 3VXMB 5DS8B 5BOZG 3NIDF 4HJ0C 5EC2B 2CR6A 3TYFA 1I1YA 1EMTH 5MEOA 2RGSA 1MIEH 3QIUC 3CAFA 4LHUB 4NJ9H 4K23H 3CSGA 3RKDD 3WUZA 4HLJA 2OM5A 4CGTA 1T21B 3B9EA 2YC1A 1MLCB 2VZVA 1Z0MA 3C60C 4G3YL 1BQSA 5GGSB 4LF3B 4ODWA 1MCOL 2OTPA 3DSFH 5IB3B 1ZLSH 3G5VB 3L6FA 2OMBA 4PJ9B 1WFNA 1ZHBA 3IDXL 2VLKB 2X44D 2C4XA 1WUNT 2F8XC 3BD5A 3RVUD 4Y0GA 2VLMD 5DRZB 4L4VD 1AGEA 3JWOH 3T1FB 4NQDB 3ZTNL 1N6VA 2EDYA 3EW3B 1PEZA 1CE1H 2Y07H 4PJBB 4AG4H 4GMTL 1K5NB 1L0XA 3TM6A 3QHFL 3GBML 1X5AA 1AD0B 3CX5J 3G04A 5F6HJ 3SDDB 3GIVA 3UZEA 3TNMA 4I18A 2R0KL 2E6QA 3D3VE 4HF5L 4YQXL 1S7XA 1F4YH 1P69B 2OJEB 5BRZB 3NIGF 4DN3H 5BRZE 4JO3L 3CLEL 4PBXA 2XWTB 5EOCH 1NC2B 2IJ0C 4P59H 3TWCL 3FOMB 4G9DA 4Y5YB 3BZ4B 3KDMA 4HIIA 3VFWA 1FE8H 1HN1A 1NL0H 5IMMB 4UTBH 4JQVC 4X99B 3MCKB 2ARJB 1OSPH 5ACLA 1BVLB 1OLZA 5LXGL 3INUH 3MGTB 3I84A 4OCYL 5HI3C 3CUPA 4YDIL 3V5DB 2WBWB 4OZHA 2ZZUT 4HS8L 4WGWB 4OGXH 5JW5B 3GB7B 5IMKB 1Z9LA 4ENED 1NBZA 2DOCA 1T4KA 3L7FA 3T2NL 4QTHB 5I8EA 1FVDB 1M7IA 4K7PX 4L8BA 4XNUH 1H9VA 5F9OH 5C1MB 2NMSA 4WCYH 4GRWB 4NRYB 4G8GA 3VFTB 2IAMA 2H26A 1X5LA 2P5EA 2EEAA 1VFMA 4H26A 3FQWB 5BOPA 3SKNA 4NFDA 5EZIL 3SCMA 3MRFB 3D0LA 1JBJA 1QLFA 2PTUA 3MRRB 4J6RL 5DHVH 4W81A 5GRYA 1I3UA 4ZUSB 2XOTA 3N85L 4K2UH 1AE6H 4XCEB 3FHAA 2YPLD 3VWJC 3V95A 1JK8A 2F53A 4NC2B 4YGVB 5KG9B 3W5MA 3V0VB 5KSBA 5J1AA 2B8OT 3CDGB 1EIBA 4U05A 3MRKB 4HKZA 1RFDL 2Q3ZA 3ZL4L 1BIIA 3WDIA 2AJVH 2OZ4A 2D9CA 1LEGB 1FORH 4NNXB 2IGFL 1ITCA 1NJ9A 4GT7A 4KU1A 4PJIA 3SPVB 4GG6F 4YHLL 4KRNA 2CDEB 1LE9B 4PJXE 4F7TB 2RQ8A 1T66D 4M4RA 4P4RA 3FRPG 3UO1L 3X13A 4L9LA 3T0EB 1NFDE 2Q8BH 3WHXB 4UQ3A 3QDHA 1P7QA 3ROLB 1EERB 2NW2A 3MQIA 2FJHB 3WJJC 4MVBC 5HI3D 5TJWK 5JW3H 4IS6A 3U4AA 3ARVA 1DDHA 2FIRT 1JZ8A 5KVEL 2M1KA 4CDHA 2NZ9D 3CFCL 4JM2F 1MWAB 3JV6B 3MRNB 4XMLL 3P0GB 4M5ZL 3TCLB 4MCZB 4YFLF 1FG2B 3ULSB 3TBSA 1FH5H 5HTSA 4Q58C 4I0PA 4GBXD 3QUZA 4LLAA 1PBYA 4ZTOL 2ESVD 3MO1B 3E6FA 2Q6WA 1MJJA 3VFRA 5E99H 1BQHG 4Q97A 1QO3A 2C3VA 2VL5A 5H37G 4QXGH 1NDMB 1EH9A 4Q7DA 4FMKA 4MSWA 3MMEB 2VOTA 3WO4B 2ZOLA 5DI8B 4JZNB 4LIQE 1NGXA 1BFTA 4Q2ZB 5IW3A 4E0RB 3W2DL 2AK4B 2MOVA 1REIA 5HGHB 4C56A 3QRGL 4RMQA 4PJ5D 4WHCA 3KHQA 4HS3B 4YX2L 3TJEH 1AI1L 4B5EA 3KPOB 4NQDD 2VDKL 2LAGB 4PJEB 4YWGH 1RZKL 1XIWB 3DETD 1IL1B 1NCCH 1I1AC 1URLA 5I1KL 3CFJA 4ETYA 2AJYL 4LPUA 1W72B 4XAKD 3PDGA 4UTAL 1NCDL 4Z7UF 1DBMH 3TBTB 4EN3D 2AK4D 2QJDA 4MS8D 1RJZB 4NFBA 3OF6A 2CRIA 3RWHB 2VDQH 4A6YL 1WWBX 4HK0A 5F3HA 43C9A 3QPXH 4PJBF 2OLDA 2H6PA 1I7UA 1UA6H 5I8OH 5T1LD 4BUGA 5FK9B 4GUPA 3CVHL 1MEXL 1EVTC 4U3XA 2OQJB 1FVEB 1G1YA 1E4KA 3DSNA 3ILPA 5EO9B 4FHBD 1JN6A 2VLRA 5IWLA 1EHLL 3BP5B 4NKMA 3AFLA 3KLDA 1T03H 1IGIL 3LKPB 1FVCB 5AZ2L 2SEBA 1IGJA 4HWZB 3MZTA 1A3LH 3VI3E 2A6DB 3DOSA 5K33A 4C56D 4ONFL 5IMLA 4N90E 4OF6A 1IKFH 3QUMB 2D3VA 3AROA 4JJ5A 3STLB 5LGHL 5IBLC 5L8LB 2ITDB 1EEQA 5MEPA 2P1YA 3NFNA 2Y7QA 3QAZB 4F7CB 3DO7A 1JPSH 5J11C 1U3YA 2EYSB 2BY0A 3RWFB 1LHZA 3O2DA 4NC1C 3V2AR 4JY4A 1I1AA 5HDLA 1S5HA 4P5KA 3VXQB 3JWDC 3PDDA 4L5FL 3S3PA 4W4OA 1UKTA 4WDIB 2XWJA 1S7RA 1UM4H 2X41A 2FL5A 4M93C 5K59E 2OSLA 32C2B 5ICZA 2D03H 4Z7OE 2GK2A 5CWSA 2I9TB 3FQNA 4PB9H 3ZZ1A 1UENA 2KQNA 1W2KT 4DKFL 2WIIA 1A7PL 2R1WA 2G2RA 4OLUL 1AKJD 4OLYL 4WO4B 3FFCE 5E7FA 3QWOB 2A6IA 1T22B 1D5MB 5DFTA 4O2EB 3QAZC 4RAUB 2VZ1A 3NFPB 4WHDA 5FV2A 4AH2B 1P7QD 4HAFA 1I85C 2CKBH 2WK2A 4AMKL 3DHJA 5CBAA 4S1RH 3TBWA 3CX2A 3BZDA 1HWHB 4JR9L 4JFPB 3VDAA 1GIGH 5D7JA 2WINA 3KHOA 4JHWH 4LARL 1TTUA 5CBEB 4KC3B 3TN0A 5DD0L 3VGHA 1FYTA 4JPWH 1T5XB 1CFVH 3IFNL 3UXFA 1TCMA 3D3VA 5D1QB 3KPLB 4NHCH 1XCQB 3V6OC 4PJAF 1S7QB 2B4CC 3F12A 5IBTH 1EEZB 1Q0XH 3FFDB 4KQ3L 2V9RA 5A2JH 3RA7L 4NO5A 2WZPD 4CADB 3JUYA 2YD6A 1RZGA 2EYTA 1LP9F 2ATKB 1ODAA 5CJOH 1OM3H 5JO5A 4G6KL 4HS6A 2H9GA 3E3QE 4TUKL 5B3JE 4NRXB 1MFEH 4D9RD 4Y16A 4LRNL 1WV7T 4QGYA 4LPCA 1G9NC 4FFYL 2C3HA 3EGSB 3PGDB 3CC5B 3HI5H 2YEZA 3IU4L 1AD9A 3PIQA 2P5ED 4DK3A 4PG2C 1H3WM 2BX5A 3NACH 4LIQL 5DD6A 4K55A 2AABH 5IV2B 4BH7B 1BWWA 3WFHB 1FO0A 2F54E 2PR4L 5E08H 1MLBB 4Q9CA 3BDYL 3C6SB 5GRVL 1K8DB 1IAII 1HE7A 1OHQA 1KIQB 2GJ6A 1SYSB 5E1AA 3WFCL 5EFIB 1JV5A 4P5MB 2PR4H 2YPKA 5E08L 4Z6AT 1E6OH 3BO8A 1DUZB 2OZ4L 4F7MB 4X5WA 1U95B 2VWEE 4B0MM 2AABL 3FQUB 4PRIE 3DPBA 2J88L 2QL1A 1EXUA 5AUMB 4YHYB 3QXVA 1CL7I 5CZXD 3LRSA 5DWUL 4GLRI 3VW3L 4L8CB 3MSPA 4HCRH 2DYPA 3U9UA 4XP9H 4P2QD 4WRLA 3QQ3A 1IFHH 1R3IH 4ZTPL 3BZFB 1SJEB 3L3OA 2BHZA 3VWJA 1T1ZB 4UBDD 3U0WL 2JB5L 5E03A 4NT6B 3UAJD 1G9MC 3KPNA 3OXSB 3QCTH 1N64H 3RNKB 1XCTB 3U79A 3RIAF 4NHCL 5JORA 4CVUA 4IIQA 4NBXB 3H9SB 1U2CA 3L1OL 4WW1B 1OD9A 5LCVL 1ZGLP 5HVFB 3MCLH 4FZEH 1RZJC 1F4WL 3QI9B 5TH2A 5IB2A 4HPYL 5JA9A 3MBED 4NQSA 1QLEL 1NCUA 1XGUA 1JWUA 2C4FU 2X4OA 4URTB 5A16B 1Q9LA 4G6JL 4JLRA 3M1BA 5CKAA 4H8WH 1IM3A 2NY7L 3BFOA 3WN5C 3GFUA 4HFWB 4PRBA 8CGTA 1YEIL 3O6FA 5L2KE 4HIEA 1YYLH 5IB2B 4FP8H 4TPRL 2P8LB 5K9OB 4N8VG 1R3HB 1DQJB 1RMFH 4HK3J 1MCWW 4WFGD 2ED9A 3BW9B 3FMGL 4JQVA 3VFPA 1LD9A 1GXEA 5SWQA 4JKMA 1JNLH 3QRFM 3VMPA 1X44A 4OT1H 1CFSB 4PJAB 3O6LL 2ZUTA 3WXWH 1UM6H 2BVYA 1INQB 4NT6A 1KN4H 4ELKB 3NZ8B 4M6ML 4O5LL 3LEVH 5CZVL 1SJEA 1QFUH 3IDUA 3QG7L 4MB5A 2OR7A 1CU4L 1YNLL 2BVQA 4I4WA 3QFJB 1CICC 1NMCC 4GSDL 5J7CC 5L2KD 2DYPB 4JHAH 1KIRA 4G8EB 4HIXH 1DANU 2B0SH 2KUTA 1A22B 4LSVH 2CIKB 2ZCKL 1F4AA 3V5KA 2OMNA 3CMOL 4G8GD 1I8KA 4U6HA 1YMMB 2VDRH 4NRZA 5DZNA 3RVWD 2EDDA 3QI9C 4PS4L 5IQ9A 2I27N 3T0DA 1PSKH 3V6ZB 1U3ZA 1D6VH 4GRWF 4UQ2A 5LJYH 4RGND 5EFIA 5F7UA 3IAQA 2FYYA 3BMWA 2QTEA 1SM3H 3KPMA 4FQIL 2NY4D 2AGJL 5I76B 1I8LC 5CEZE 1KTDA 1IKNA 2HTLC 3FTGA 1HI6B 2CRMA 3GSNL 3HS0A 4HEPG 1UA6L 3EHBD 2XQYK 1DQQA 2R9HC 4P3CL 5BS0E 3TCXA 3QPXL 5E70A 2OXGA 5GS0H 4Y4KA 2WP3T 5SV3A 2IG2L 2CLRB 1QSFA 4LVNC 4UAOB 4Y88A 3P9WB 3WMSA 4QRRA 2K7QA 4ZAKD 4WV1A 3BEVB 4J8RA 3PWPD 4LQ1A 1UKQA 3MREB 1U2HA 2APXA 4L29A 3M17B 1IE5A 1FG9C 4N9GB 5IJVA 2NX5A 2YA2A 1QFOA 4C59B 4CADA 4Y4HC 3EO9H 1YEJH 4PGZA 1VACB 3GMNB 3F12B 2BNRD 4YX2H 2R56L 3JWDL 2HP4A 1IGTB 4P5TB 4YBQD 4HWNA 1YPZE 5CGYD 4Z7WA 5I30H 1HINH 2PW1B 2A6JB 4PJDB 1CLZH 3L3KB 5JQHC 3T1WA 1MY5A 4F8TA 2FECL 3SY0A 3RAJH 1RZ7L 2OP4H 3TT3L 4Q0XL 4YDKH 4QT5A 2PETA 2CD0A 1UEMA 4FQJL 4F3FB 4HDIA 1NMBH 2EIEA 4AIXA 3GMPA 3BSZL 2A6IB 1CDCA 4QHMA 3HNTL 1NAKL 5IROC 1U8NB 2M26A 4JY5H 3LKNB 3RDTA 2YPVL 2PTVA 2ZUQB 1HYRC 3KWWA 4U0RC 1IQWL 3LAFA 5CWSB 3LH2H 3T77A 1VACA 2OSLB 4NKIH 1J05A 4LASL 1ADQA 4OGZA 1GZQB 2H1PL 3T0VA 4U6XB 3O4LE 1FZOB 1G9ML 4KZEH 4Y5XC 5D2NE 2CDFA 2JCCE 3VXRB 3CVHB 1TETL 3GRWL 2ADGB 1FNEB 4NQXA 1QKZH 1N8ZA 2ZSVA 1OTSD 3GHBL 3VJ6B 1E4JA 4YDLC 2Z4QA 2CLRA 2OI9B 3HUJA 4OIBA 4QHLB 3ARFA 4G9FE 3LQAL 3TYGL 5D1QD 1KCKA 1GH7A 3W0WD 5IMLB 2DWDB 2EDKA 5INCA 2XTJC 1QRNB 1X6NA 5C0FB 5KSVB 3UJTL 4OCRH 4NO3A 1WBZB 1A47A 1FVCA 2JB6B 3V79C 1A9BB 3KPMB 3ZKMC 3K8LA 1WZLA 4DN4H 1K85A 3P0VL 1NDGA 1S7VB 4NGHH 1DZBA 1NPUA 4A2LA 1P4IL 2GFBA 1WCBA 1ZLUH 1QSEB 4AT6A 4KGLA 3QUYC 3BWAA 4XXCC 3LQMA 1KTLA 4N0UB 5DR5H 1TCRA 4KHTL 5B39G 3RWEA 3LDBC 3Q5YA 5T1MA 2FHBA 3BRDA 3QIBD 1QVOB 4RCAA 2V2WB 4EVNB 4G9FD 3PQYE 4UIKL 1XR9B 5HHOD 5BCAA 2EEBA 4Z7NE 3MV7E 4XNMB 5I8CB 5GS0C 5E8PA 3H42L 1T3FB 2ATPA 3R06B 3QR2A 2HKHL 4FTVE 2MHAB 4PV9B 5DJXA 2P7TA 5SWZA 4JDTH 7CGTA 4PJAA 1A7BA 2NW3A 5DHYA 5F44A 2MHAA 4GSDH 1YC7A 4PV9A 3K3QA 2PYEE 5SX5H 4NM4L 4XAWL 4KV5F 1LD9B 2FSEA 4ZDHB 2OI9C 2IPTL 2WMPA 1T7XA 2H1PH 2WBJA 5ESVB 4WWID 4OGAD 4NKOB 2RB8A 5CUSL 4M6MH 2V2TB 3K4AA 3LH2L 3KLAA 4RQQB 1KJ3H 2VSDA 1FE8L 4MNGA 4P9HL 1A1NB 3C5SA 1DL7L 4PRBB 4YHZH 5E2JA 4OZGE 3CLEH 3ZMRA 3RVTC 4DN3L 4TN9A 1KPRA 1BZ9B 1WEJH 3RWEB 3MOBH 2RR3A 3LQAC 2B1AL 1SJHA 3MV8E 3KLSA 3BWAB 4XCNA 5F1OB 1UFUA 1QSEA 5GGTA 1T7VA 5E9DD 1J8HA 3QHFH 3DVNB 3PWNA 1JNJA 3UTTB 3QNZB 1ZAGA 4JO2L 3L5HA 1L7IH 1I4FA 2IBZY 4YXKL 5F6IB 1S9VB 4RFEB 2QEJA 4P23D 4GW4B 3VI3F 4NO3B 3MV7B 3RNKA 4OZIF 1HINL 2AK4E 1U92A 1U0QA 3NAAH 1ZHKB 3KXFE 2PTTA 2GK0A 5J6GA 5AYUL 4LDLB 2D7NA 4ETQA 2PCPB 4BKLB 1ZTXL 3OBAA 3BPLC 5J89A 5D1ZB 2F53E 1N64L 3BGFC 1XF2A 4LLQA 3DV6A 1ZKAA 1W72L 5C0BA 3RZCD 3VXRD 4M1GL 4W6XB 5CIPB 3VWKD 3CSYB 5JDSB 4GXUN 1A6VL 2CDEA 1MCJA 1NEZG 1FNLA 2CUIA 1U95A 2VUYA 5FF6B 5GISL 2JJWA 2DM2A 3DTXA 4OI7A 1I3GH 2ENSA 2BOCB 5L0QC 3HFML 4QWWD 1UC6A 3KYNB 4HKZB 5E1AB 2IFGA 2H41A 2UWEE 1FNGB 2AVGA 2B7DT 5ESQA 1ZT7A 5I6XB 1FFOA 5E8NA 1W0WB 1A14H 1FO0B 3TPKA 4ZUSA