2JLLA

Crystal structure of ncam2 igiv-fn3ii
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
389
structure length
381
Chain Sequence
QPHIIQLKNETTYENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEKSLDGRIEVKGQHGSSSLHIKDVKLSDSGRYDCEAASRIGGHQKSMYLDIEYAPKFISNQTIYYSWEGNPINISCDVKSNPPASIHWRRDKLVLPAKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNHIGTRFQEYILALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASEIWKIVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPILEYIVKYRSQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANLGYSEPTVYEFSMPPKPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Model and Trans-Interaction of the Entire Ectodomain of the Olfactory Cell Adhesion Molecule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords NEURAL CELL ADHESION MOLECULE 2
total genus 67
structure length 381
sequence length 389
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
A PF07679 I-set Immunoglobulin I-set domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jllA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jllA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jllA03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jllA04
4J6RH 2QSTA 2J88H 2A6DB 3EDDA 3VXUD 2GJ6D 3GSWA 1QACA 1EEQA 2D7PA 5T1DH 5JORA 2X4OB 4MNHB 1F58H 4YDVB 3L3OB 3LEVL 2ZCKH 4XPBH 1NLDL 3LEYH 3IDYB 4P2RD 4I0PB 4KHXH 5IHUH 5D71L 5EUOF 1U8HA 3TBTA 4AM0B 1UM5H 5IB5B 3OJ2C 2FJFA 1ND0A 4YZFF 5ECJE 3QG7H 5DMYA 3QDGB 3VXPB 3MV9A 1K8DA 5D2NB 4IRZH 4PY7A 4NQEA 1I85C 4K94L 1CGTA 5IB1B 3QQ9D 4OZGA 2PKDA 4X9HA 3VG9C 1UM6L 1MREL 2JJTA 5DMJB 1QHPA 4R2GB 3VRJA 3OR7A 3KYKH 1N6UA 1MVUA 2Q3ZA 1T1XB 5I75C 1IJ9A 4IRJC 1X7QB 4PJAB 1OAKH 3ARFB 1A6UL 5IQ7H 1BQUA 1BD2A 3NTCH 4P0DA 4XAKD 5DO2D 3GMMA 5H94A 4MCYB 4YXHL 4P23D 4S1QL 3HTLX 2X4PB 4QRQA 1EAPB 4PTUA 3SE3C 4QOKA 5DO2C 2HAZA 5HYQB 4PGEB 5IMOA 3CH1A 1JGVH 1X5ZA 3FTGB 1OP5H 4TNVF 2DJ4A 2Z35A 3W9EA 4AM0A 2UWEF 3V4UL 1HIMH 1JGEA 4NRXA 4BFGA 3MRLB 3H7BB 3BDBA 3RBSA 5IQ9A 4XBPA 2P5EA 4FQJH 3L3KA 3BDYL 5D2LF 5HGBA 3GHBL 2Q8BL 4RSVA 4MNGE 4I18A 5DURD 2OP4L 4HXBL 4P49A 3O6FD 4N8VG 1NMBL 1ONQB 1FCCA 2GK0B 2VLKA 4J12A 4D0DA 2ED8A 2P5WB 3LZFL 5DMIH 3DO7B 1FFNB 2WIIA 4G9DB 2PUQT 4PJEF 1YEEL 5GS0H 1BIHA 2X9YA 1PJ9A 3N0PB 3DO3A 4JFFE 5H94B 3V4PL 2JCCF 4CVZB 1GHFL 2ZUXA 2FX9L 1MHPH 2HFGL 2PYEB 4HFWA 3LEXB 3SGKA 1BGXH 4PRDB 1A1OB 2X9XA 1I7RA 3P4OA 5HYSG 3L7FB 2KKQA 2IEPA 4C83B 2C3WA 3O3EB 4Q0XL 5DGRA 2DQDL 2BC4B 3STBA 2XI9A 2NX5A 2JCCE 4I48B 1YNKH 2JKXA 1NL0H 5CINL 3V5HA 1YECL 5TJWK 2NTFA 3TFKD 1KNOB 1MVFA 1XGPA 4GG6B 3QQ3A 5DD1H 4QTHB 4XCEB 2W0LA 3AREB 2R0WL 4G7VH 1QEWA 3S36L 3WHE0 5IIEA 4FMFA 1ND0B 3RTQC 1G9MC 2ATPA 5AG9A 5J1SC 1QZ1A 3MLZL 1SJEA 3WUWB 2NMSA 3O4LD 4Q6IA 4X4ZA 5H2BA 3O0RH 3CIQA 3D18B 1ZHLA 3MRNA 1Z5LA 4OZHF 4OLWL 4CMMA 5JZ7C 1QO3A 1FRGL 3DV6B 5TGBB 2X4QB 5J6GA 3WS6A 5E8OB 2Q76A 2GT9B 2JK5A 3VD7A 3ULVE 4PJCA 1OSPH 4PJHA 2A6JA 2CIKB 3C8KB 1QSFB 4IRSD 1YNLL 3IFNL 3S96A 3FB6B 2A6IA 5C3TA 4A6YA 1Z9OA 4UQ2B 5SX4I 5CSBA 4OV5A 1FYTB 4HSQA 3WLWC 2W9LA 1DQDL 1QEWB 4Z0BL 4LMQI 4TSAL 3OF6A 1XF2A 3MBEB 2XZAH 1XCQA 4HIHA 5D2LE 3QJFB 1T1ZB 2F53D 2X4UA 2VAJA 2X6MA 1N2RB 4HPYL 4OD2A 5I74B 2X89D 2DM2A 1JRHH 3U9UA 4U1GB 3EOYG 3QJFA 3FQUB 4LLQA 1MJ7L 5CD5C 3LZFH 1Q8MA 2XQBL 1BM3H 4JREB 4NM8H 3WSQL 5ICXA 3AM8C 3P11H 3VWJD 5DMGD 4NN5C 5C92A 3O3DB 1ZHKB 5EOCL 4MQSB 4UB0H 3MV11 5ENWA 3TT1L 2C1OA 1FG9C 3VXSD 3BDXA 4TVPL 1Q94A 1QSZA 1JL8A 3I3DA 5HGGS 4PJAF 2YOCA 4OLEA 4PJHB 1DVFB 1OT1A 5IR1B 3Q1SH 4PP1C 4TRPL 2DQHL 3BZDA 4NRYA 3KNBB 3ROLA 2ID5A 3OXRB 3DV6A 4UDTB 1RK1B 3UO1L 4H1LH 4ZXBB 2DQGL 2VLLB 2F8VA 3TVMC 5HHMD 2P5WD 3QXWA 3TN0A 4MZ2A 2R4RL 5J9PA 1JNHB 3PWNA 2WBJC 3FOLB 5CIPH 4J3XA 3ZKNC 3G5ZB 4NDMB 4I77L 4IM8A 4IS6A 5IMMA 3GNML 2IC2A 5JA8B 3RDTD 5K9QI 4S1DD 3T0DA 2LFGA 3W9EB 4WNQB 4NQSB 3F7VA 4WFGD 5HI4C 1M05A 5FF6B 1IQWL 3U7AA 3MV7D 5L2KB 4RZCA 1XH3B 1A9BA 3K1KC 4PFEA 1MLCA 1UWEH 1X3DA 3VG0H 3EFFB 1A1MB 1UH2A 3KYMB 3RZCD 3O2WL 3MACH 5BO1L 5HDLA 2V2XA 1KCUH 5DDHB 3TPKA 3CLEL 4MDJA 5FIEA 4WGVB 2HWZL 4YBLB 2ADIB 2IAND 4RGOH 4YFDB 5MEQA 1Y18A 4LP5A 3HRZA 5BZWA 3RWDB 1A8JH 3UPRB 4XPGH 4J1UA 4F33A 5FKAA 1A6WH 5D2LA 3QAZC 2F54A 5KSBA 4P48A 3ARDC 3F7PC 1UWXK 5EFIB 3NPSC 4KJPC 4HUKB 3D39D 3QDMD 1H3WM 4DAGH 1GGBL 3UZEA 3ALXA 5D1ZA 3WJLA 5EIIA 1F11B 1GIGL 3FRPA 3L5HA 3V0VA 1N7MH 2HFEA 4FABH 3E3QE 3OX8B 3V4PH 3O45B 3DSFH 2J5LB 3ARDD 3GMQA 3QI9C 4PRPE 1NC4D 2GSIB 3TIEB 3BD3A 4QHNA 1C08A 4PBWD 5EUKB 3F7VB 3OKYA 3EYQC 1DANT 4TPRH 3QXAA 2HVKA 3HE6C 4X4YB 2VKXA 2VXQH 1FVEB 3BFOA 1AC6A 1XF3B 5HPOA 1MF2L 4WO4A 5GHWL 1LEGB 2XY2A 2X70B 1RK0B 5IBUB 1XGUB 2F8XC 5F7EL 2DQDH 4X5XA 3VXOB 1KLFA 5LKNA 1CFTB 3RGVD 4YHIB 1UVQA 4N0CC 1J0YA 4ZO9A 4LMQE 4OZHB 3MRKA 3F6IA 3WNMA 3C6LA 1QRNB 2NY2D 1YN7A 3RKDD 1Z5LB 2HTLD 3UTSE 4J3SA 3V7AE 4X0KB 5E2UL 3U30C 4MSWA 4L8CA 2EDTA 3UO1H 2HKFL 4PJFB 3P2TA 5KVDL 1HHKA 1QLRA 3LAFA 1PY9A 5D6CA 2I5YL 3WLBB 4FQ1L 1OAUH 1D9KA 1RVFL 4NQEE 1RMFH 4GKNA 5E03A 3SQOL 1AGCA 4PRHA 3PIQA 4UQ3A 1Z0MA 3HNVH 1C08B 3GM0A 1EXUA 4C58B 1T0MB 2FR4B 1CLYH 2H41A 1RURL 2Q20A 1VA9A 4R4BB 3NABL 5C07A 2COQA 5L8LB 2XNAA 2Q86A 3AROA 1FZKB 4BFIB 5E1HB 3ARPA 4TNWF 5DJDB 5I1CH 5B21A 4PD4J 4IRZL 3KPQA 2F9BT 4P2OB 4CKVX 5DFVD 5CZVL 3KS0H 2JB6A 4C55A 1OWWA 2BVEA 2FJGB 3QEQA 2KQNA 4ZO7A 3TJEL 3QWQB 4QXUL 4MDJB 2P7TA 1VKXB 3ZYIA 5INDA 1DQDH 4LSDA 3JWDH 4FNLL 4NZTH 1IT9L 3RY6C 1ZLSH 3UTOA 2DLFL 4JANA 4X6BA 2AKRA 2DMKA 4D0DB 4J3WA 1U36A 2DOCA 5T3XL 3TVMD 5I1LA 2Q7YA 3VGHA 1QO3B 5LG1A 4YE4H 2LAAA 4LCCC 5HHVH 5DD6B 1MOEA 3BHBA 3KPMA 1H3UA 1RIUL 1QQDA 5T3ZE 3H9HA 2EC9T 1A22B 3AS3A 4MYWB 4PB0H 4DGYH 4QRSB 3S4SG 4EEEA 5DQDL 5CP3A 4OUUA 3P73B 1YJDC 4OLXL 1RY7B 4IMLA 4RISL 1T0NA 5C0AD 4ZXBA 5HDBF 4DW2H 5BVJA 3FTGA 4GRWH 3H9SA 5JZ7D 3B9EA 4XP6H 2IBBA 3CMOH 2VLJA 4LF3A 1LEKA 1QLEL 1UYWL 4JM2A 1KNOA 5C0BE 2ZNXA 5I6XC 1Y6MR 1UJTA 1EGJH 5JA9A 1A7NL 1JZ6A 3U0WH 4P46B 4JDTH 3HS0B 1IZJA 4ZSOE 2P1YA 4Y1AB 1J1PL 4GRLD 3MC0A 4YXKH 5EU4B 3I6GB 3QEQB 3DVNB 4X5WB 4U7KA 3GSRB 4PG2C 5CZXD 2VJXA 3ZE2F 4NNXA 4PV9B 1VADA 3KPQB 4P2OA 1RUPL 3FO2A 4RGOL 3VXRA 4NO0B 1A1NB 2G2RA 4GAJL 2I9LA 1G7IB 2E8YA 1ZEAL 3H8NA 5D93B 2BNUA 5I8EA 5FUZL 3KXFD 4ODSL 3X3FL 3MRCA 4OFVA 1BZQK 3ET9F 3BWUC 1FZJB 1KCLA 2IQ9H 1J8KA 4O02H 3MJ8B 5BZDA 2GY5A 2EDQA 1AXTH 2BRRH 5E8DH 4EI5C 4NBZB 1PKOA 1TCMA 3HNVL 4MQ7B 4EVNB 5KVFH 4UILL 5E7FA 4PRHB 3BT2H 4I8DA 4NCC2 1EJOL 1U58B 4R6UA 3RKDC 4CAGA 1MRDH 4AMKH 4ERSH 2H6PA 2A83A 4HWEL 3MRGA 3P77B 3O3AB 4Z7VE 5JORB 3CFEB 4LPTA 4L8BA 2CDFB 4F7CA 1XIWC 3EOBB 3W5NA 2AP2A 1Z2KA 4FQHB 2OQJA 1NAMA 4ORGA 5GRXG 5I1GL 3AS0A 4P23B 2NXYC 2VDOH 4JE4B 4QRRA 5C0RH 3H42H 4HK3N 1XF4B 2YC1A 2J4WL 1RQ5A 3V6OA 4ZUSA 3BSZH 3KR3L 4QCIB 3PABA 1GC1H 4NHCL 1LO5A 3T0VA 5ACZB 4LSVH 3RVUD 1NEZG 3BE1H 4RAVA 5EBGA 4JPVH 1U93A 1AI1H 3CK0H 3QPQD 5KSBE 1S7SB 5DJXB 5JLZB 3O2DA 1IAMA 4C56A 1FN4A 5EU7E 1CYGA 1G7LB 5E99L 4OGZA 1KACB 1EUUA 4KTEL 4JLRB 2G60H 5C0EB 1NGXA 4Y8DC 1TZHA 5MEND 1EZVY 2HT4D 4JFDE 5C2UB 1R3HB 3VFPA 4M61A 1Q72H 4HIIB 2AEPL 4ZNEE 2VR4A 5F9JB 2NZ9D 3QP3A 5HJ3A 3ZDXF 1AXIB 1CDUA 5BW7C 3DTXB 4FFYL 4W6XB 4UQ2A 3QQ4A 1YECH 1GOGA 4OF0A 5I1EL 4FTVB 5HHVL 2FJHB 3AAZA 3NIGF 1HQRB 5D1QA 2V7NA 2R69L 3MRIB 4YHNB 4QCIA 3QI9A 1QA9B 1I9JL 2NY6D 4Z7WE 5ID0A 4YXKL 3S7GA 3QH3B 4RZCB 3D85D 3HZKA 3G5YA 4Z76A 4YC2B 3ILPB 4G8GD 1CBVH 1NSNL 3DLQR 2F5AH 2EDHA 1XGUA 4NJ9L 3ECBA 2PO6C 4WGWB 4G8GB 4R7NA 1I3UA 2XWBA 2G60L 4MJIB 1MCWW 1B2WL 3ILQD 4HF5H 4QOKD 4XHQA 3NAAH 3T4AB 1KIRA 2FO4A 1YYLL 1I7UB 4Z5RB 2BSED 5FECB 3T0EE 3X13B 1IL1A 3LSOA 3KJ4C 1NCDL 2X1WL 1HDMA 2DQFB 5D96C 3ZZ1A 4MA3B 2PR4H 5M7QA 3ZE0E 5IR1A 1EEUA 2HFEB 1MCNA 1NMCC 3AS1A 4MLIA 4RMWA 3UZVB 2QQNL 2ICWI 5CBAA 3I2CL 4Y8AA 1V5JA 2OLDA 2YZ1A 2H2PD 1J10A 1J5OH 2E6QA 2WV3A 3GB7B 3LN5B 3SKOB 2AJUH 1FSKC 4F57H 4QXUH 1RUKH 1FP5A 5DZOA 3TBWA 3I6GA 3GUTB 1F6AB 3KYNA 3H3BC 5DUPH 3KR3H 4NO3B 3U1SL 2YMXH 3UTZA 3A0OA 1CTOA 1A9BB 3GJFK 3ARGA 1N59B 3V5DB 4U7SA 4MXWH 4XBEL 35C8H 5JO5A 3AVEA 1P1ZA 2Z91A 2Q87A 1YY8A 5ID1A 2P45B 3DMMD 4LSTH 3OKEA 4FMKA 4U0RB 3B2VH 4AL8L 5F3HB 4X4XB 1OP5K 3IDIA 1KB9J 2VKWA 4MHHI 4PJ9A 4G6JH 4UV7L 4Y19E 2SEBA 4K94H 2F8OA 1BX2B 3RY4A 4G8EA 4MVBC 4NT6A 4R8WL 3SO3B 2IANA 4YDLB 5J11C 3FO0H 3Q5TA 3CVIH 4M1GH 3P0VL 3QT2A 1KG0A 3JWNC 4HLJA 1OGTA 4HMEA 3HI6H 5DQ9B 3UTTE 2FH6A 1WWBX 1R0AH 4YH6A 5T3ZD 4PR5B 4RRPA 3H3KA 4Y4KB 7FABL 1JPFB 2VZ1A 4PJFE 1B90A 5FUZH 1LEIA 4JPIB 1UYWH 1WJ3A 4NQDA 1YC8A 4NP4L 3DX8A 2PTTA 3GKZA 1SJEB 3UJIH 2NXYD 1OW0C 3HI1B 2Q6WA 4HWUA 2DI7A 4G43A 4O00A 1MFEH 2ED7A 3G6DH 1MY5A 1A4JA 3U0TA 2C7UA 5JPMA 2I9TB 1QLEH 4PTTA 1IC7H 4WO4D 5L0QB 5IM7B 4HHAA 3AMLA 1NC2A 5EORH 3BVNB 4IMKC 5DQJA 5E99H 3CX5J 3JXAA 3TO4B 4FRWA 4PJDB 1XR8B 1PKQE 2XZQL 3C60C 2JLLA 3GKWL 4XMPL 3P4NB 1F45A 4X6DA 3E2HC 4IDJH 2E5EA 3CVHA 4O4YH 1YMMD 1LEIB 1YEEH 1FL3B 4QEGA 3GSWB 4PJ8D 2QHRL 3WEXA 1E0OB 4BQ8A 3U7WH 3CFDB 3L5XL 2PO6B 2VDQH 3G5VB 3OKLA 3O9WC 1T2JA 3NACH 4IIQB 1LMKA 3WEXB 2A9MH 2X70A 3C2SA 4XPAL 1ZA3A 3KAAA 4YHNA 2DKMA 3I9GL 4TVSa 5FYKU 4POZC 2P5EB 4KY1H 2HJFB 3MV9D 3U1SH 1NGWB 4LU5L 1YZZA 3GRWH 4HS3B 2AK1L 4YHPA 5SX5K 4GT7A 5F1OB 2XWJA 1H8OA 2ZG1A 2H45A 2XXCB 3VXQB 5EIVA 3PP3K 5EB9A 3SGDI 4P2QB 1F90L 3B2VL 3RUGE 2OP4H 4HXBH 3VFWB 4Z0BH 4XZUB 4H8WH 1VEOA 4QXGH 5MHSE 1NCAL 1C5DB 2B20A 3STLB 2WUCH 1BBJA 5GSRA 3DYOA 4DFHA 5I18H 4HXAL 4Y16A 3MRPB 4I4WB 3ARFA 2G5RA 3P4OB 1KT2A 2LU3A 2RHEA 5CEZE 4HUVB 3QIWC 2UWEE 1A1OA 1X5XA 5TPWL 3REVA 5CBEB 2PXYD 2P8MA 3QWOA 1I3GH 2X05A 3V52H 2XQYK 2XPGB 3L5JA 1J1PH 3UBXG 1J86A 1FRGH 1D6VH 1RZKL 1HHJB 3CPLB 4Y4KA 3IU3B 1KB5H 1I9RL 5JW4Q 4U0RC 1B2WH 5GRJL 5JHDE 4Z7NF 2X40A 4HPOL 4JFDA 3OGCA 2FB4L 1HE7A 3BWAB 4Y2DB 4OD3H 1PD6A 1JNLL 4QXTA 4WEMB 3ZDYE 2M26A 3IJSA 2IQ9L 4M1DL 2HFFA 4U1HA 5DUBA 1SVZA 2CKBH 3H9HB 5F93C 2X5PA 4HUWB 3P30L 4LHUD 3U6RA 5FCUL 1D6EB 2VYRE 2ERJC 1CZ8H 1DN2A 4JQVC 2GTWA 5IVXE 4MA7L 1AP2A 3I3BA 1U3HA 4MDIA 4DVBA 4F37K 3NVQA 1ZGLP 1DVFA 1I7ZB 2VZVA 3LRSB 2E7HA 3D0VB 3KPTA 4OF7A 3ZDYF 1VPOL 2DQUL 1KJMA 4GRMA 3WL9B 4NKMA 1LK2B 1PFCA 1J18A 3SCMB 3HC3L 3ARTA 3WMSA 1J0HA 5GRZA 3UC0L 3ZKMC 3SOBL 5E6IA 3DROB 2WQ8A 2P5WE 4V1DD 5EU4A 1NAML 3M45A 4WW2B 1I1FA 3HR6A 4HK0B 3ALWA 3MUGA 4MJID 3PV7A 3S5LA 4LCCA 2XG4A 2EDLA 1M7IB 3L3GA 1DBJL 1YEGL 1QG3A 5L2KA 3O8XB 1T04B 5E5RB 1G7LA 1NFDB 5DJAB 4BA8A 4ODBD 4QYOB 1U6AL 5D7IF 1RJLB 3DOSA 4P5TC 5JIKA 1D3CA 3H42L 4R2GD 1ODAA 1INDH 2CO6B 4JKPL 7FABH 4RA3A 4KHTH 4PRIA 3DVIA 3UBXI 3I3EA 3BQUA 3CLFH 3KYAA 3ZE2E 2OL3B 3WNOA 2AXGA 2FHBA 2X4SB 4ZUWB 3N1FC 3GJEA 3ROLB 4ZUUA 1N0LA 1BF2A 4Z7QF 1OP3H 5LCVL 4OF3A 4G5ZH 2LAGB 4ZAKA 5GGSB 5DVOA 1NANH 4KROC 4WJ5A 1FZOB 1INQA 3BKMH 2AEQL 3NZHH 1HSAB 2G9HA 5DJ8A 1XGQA 3U4BH 2VIRA 3D0LA 4JRYE 2EIDA 4PJGE 1MEXH 3NCBB 4K7PH 3MLWL 4KV5F 4NOBA 1CE6A 2VLRB 3NFSH 5FYKH 5DEZA 5BV7C 4LNRB 4LARH 5A1AA 1FVDA 4KJPD 4WWKC 3PP4L 3V6FB 1XGPB 1IAKA 1JNNH 3L1OH 1A7QH 1XZ0A 4DK6A 5C0DB 3W81A 5T1LD 5I15H 4KGLA 3RUGA 1CDIA 4XPAH 4L8SA 3QULA 5CJOH 1HN1A 5D2LB 4XP1H 4PY8J 4ODUB 1T89C 4ONGH 5TQ0H 3S4SB 2XFXA 1QNZL 3SDCC 4X6DE 3DBXB 1HHKB 1J1OH 3Q6FB 5DZLA 4GRMB 4KUCF 2BVUA 4GAGL 4XI5D 5HHOA 5L7XH 1MFDH 3SGDH 1A7PH 2FLRT 5GGSA 2EZ0D 3M1BB 4P3CL 3E6FA 1MCQA 3CLEH 5JOEA 5B38B 3DX6A 4EBQH 5BJTB 2Q76B 4Z0XA 3SDCD 5DMGC 1FGNH 1FLRL 3GJEB 1KN4L 3AUVA 1MHCA 2X1XR 2H2PC 2QADC 3CFKB 3UXFA 1J11A 4YNYA 5FO9A 1MWAL 4EDXB 2UVEA 4XBPB 5JW5B 3BEWA 1T22A 3NCJH 5C09B 5F96L 4MHHG 5DURB 2WP3T 5FO8B 1OAQH 3Q48A 1U8NA 2E27L 1QR4A 5D7KE 4QYOA 3WIIL 1YEFH 4OCMC 1NCTA 3R0MA 4TUKH 3IFOB 4P46D 5CKGA 2R2EA 2YPLA 1S7WB 3FB7A 3FO9A 3QNYA 4I5BA 3NPZB 2VDPH 5ESVA 1NLBL 4PJEA 4YGVA 5C70A 1JF5A 3ARQA 1C5BH 3QUXC 3CXHJ 3WCYA 3ARYA 1JZ8A 1MCFA 5TE4H 3DXAB 2XTJC 4PJ8B 5D1XA 4CUCA 1AR1C 5KTEH 1TITA 1IT9H 5ALCL 3TT1H 4PJAA 4WW2C 4YR6A 4LHQB 2EDEA 3GIVB 5MENB 1WFNA 3B9KA 3T4YB 4YHZH 1CI5A 3RP1A 1GVIA 5EPMA 2CKBB 2P46B 4N0FB 2DJUA 2NW3A 4HT1H 4DTGL 1BFTA 4ZOCA 1K5NB 3D87B 2ATKB 1AI1L 2LQRA 4O2CA 4KRPB 1SQ2N 3GHBH 5CEZD 3QBTB 4HQQL 5EUOE 2BRQA 4HJGA 5IWLC 4OCXL 1F4WL 5F3BA 5TH2A 1S9WB 3ZE0F 5JW5A 1JJUA 3RIFK 4KTYA 4OZFA 2JB5H 5CEYA 1ZHBA 4ZMAT 1KIPA 5A16A 2I5YH 1YN7B 2VDRH 3FONB 3E0GA 4WUUE 1FQ9C 2GY7B 2BSSA 4I0PD 4OZHA 2R29L 4WFFD 4OFKA 3KPPB 1SEQL 3VFTA 2NY3D 1EVUA 1U8LB 3OKKB 5LQBH 4BZ2H 2V2TB 1DEDA 2UYLA 5K59E 1HWHB 1Q94B 2NXZB 2MOVA 1WAAA 4DKAA 2GCYB 4PRHE 1BD2B 2A1WL 4RAHA 3DV4B 1N6QL 3PE9A 4UT7L 4HUVA 5SX4H 2W60B 3VWKD 1KGCD 1RIVH 3V6OC 1MJ8L 5ERWA 1FAIL 5J1AB 4QTHA 4LSUL 4EQ2A 1LNUB 2C3HA 1C7SA 1KPRB 4XAWH 3QHZH 4UAOB 4XX1G 3RGVB 5CAYB 4LCYA 3DUUA 1U0QA 3MUGB 2F15A 4MNGA 3QRFM 4DEPC 1XMWA 1A3LH 2DIAA 1FLTX 1NANI 1OAZH 4DN3L 4YXLL 3S5LG 1EPFA 2IALB 3OR6A 2CIIB 5I71B 4ZFGL 4JZOB 3TNMA 1Q38A 1MFBL 5F9DC 4L4VA 1KIUA 5BZWB 2R56H 3GSXA 3VFMB 2DDQH 4K23L 3CMGA 5IJVA 1F58L 4YDJA 3CFBB 2VDNH 1YPZB 4PRPA 5IFJA 4UOW0 1CD0A 2ZOLB 3U2SB 4PJCB 4XC1L 5T1KD 2Y5EA 2XZZA 5EBWB 3JV6B 5HI5D 3BO8B 3BP5A 4LCWB 1KG0B 4OCRH 1NGYB 5D5MB 1D5MA 3QCTH 4UU9B 4OI7A 3RGHA 3AY4C 1QP1A 1N6VA 3LKSA 4ZUVB 4QRSA 3BSZL 5F9WB 3FOLA 5E9DD 3L3IB 4MJ4A 1EUTA 4ZDHB 4E42A 3PG2A 5D1ZD 3QNXB 3CFKA 5GZNC 4S11A 5DEFB 1CDGA 3HMXA 4PGEA 3RZCB 5BQ7A 2XTJB 5CD3B 3MOAH 5BRZE 3FAXA 5C8JA 1RZJC 1C5CL 2FX9H 4KV5E 4KVCL 3U4EB 3S6CA 1TVBA 4LVHB 4JGUA 3DIFB 3JTSA 2E7LA 3IYLW 3LB6C 4PJEE 4G8GE 5CJBA 2EECA 5GISH 3AXLA 1BVKA 3VFVA 3MA7B 2OX5A 1MHEB 3UPRA 1KJ2B 3DUSA 3QULB 4QXGL 1QFOA 5D1XB 5ICZA 2ICWJ 5F1KC 4XCFL 5IT2L 4KQ3H 5I66B 5EO9B 3LS5L 5FO7A 4FQJL 5DJCB 4G6FB 3TESA 4MA3A 4Z7WA 5LCVH 1S7VB 3L95B 4LHUA 1Y6KR 3X17A 5FFLA 4KZDL 2VLRD 3GJFH 4JRYD 3QNXA 3OJDB 3DX7B 3MRQB 4ZPVB 1XGRB 2VZOA 1G7QA 3N1PC 5IWLA 1BIIB 3HUJF 3CLFL 5JR1L 1XGTB 2OJEB 4GAFB 4EIZC 4LRNH 2DM7A 3DETC 1YEDA 1LWRA 1NCUA 3U7YH 43CAB 1JNHA 4MNHA 4I1NB 3T3PF 3OB0H 3DHMA 4WI7A 2OTUB 4JRXD 1S8DB 5EA0L 4M48H 1CCZA 3RVVC 3BI9X 3G5YB 5ITBL 3VW3H 2AKRB 3EYVB 1AD9A 2FL5B 4XCCL 5H35A 3U2SA 4PJBB 1NFIA 3IAQA 5DGQA 3FQNB 4Y4FD 5HYSB 2YKLL 2BNQB 5DJ2B 3CDYA 3S4SA 4HEME 4NPYA 4NIKB 3WJJC 3TO4A 2YR3A 5MI0C 1A6TA 4RX4D 3OSKA 5SWSA 1WIPA 2QQLH 4FXGB 1F4YL 2YK1L 5F9JA 1ZLUH 5IVXF 3VXSE 4LLYA 1CD8A 4GSDL 1NDGB 5FV2A 5IHUL 4FFZL 2HTKD 4HIXL 3KLDA 4HV8A 1SY6A 4OF5A 4OZ4B 4ZFGH 1WWWX 2DN7A 2VERN 1U3ZA 2IWGA 4XXCC 5JIIA 2VLRA 1P7KA 3BP4B 1N5YH 2YA2A 5IG7A 3EOTL 2ITCA 1KULA 4MB3A 3S35L 4NQDB 4HFUL 2LTQB 2R4SH 5FYJU 1P4BH 2NNAB 5F21B 3L3OA 5IBTL 2P49B 5K9OB 3G6AB 1NFIB 3GEWB 2ZG3A 2Q8AH 3SY0A 4AENA 5DJ6A 2NPLX 4A6YH 1CK0L 4M7KH 3SJVD 2Y06L 4JAMB 5CUSH 1MAML 1AQKH 3H0TB 1YPZF 2YRLA 1W8OA 3MXVL 5D1ZC 4OGYL 1S7RB 4N0YH 1H8NA 1O7VA 1RZKC 3SQOH 3EO1B 2QADD 1JYVA 4NKDB 5BS0E 1ZHLB 1V3JA 3N1QC 5K9KB 3V5KB 5E8PB 1E6JL 1NKRA 4U1HB 5DUBB 3W0WE 2FZ3A 4N0RA 3EKCA 1RUKL 4TTDC 4YK4C 3WDJA 4U6VH 4B5EA 1P4LB 4ZD3H 3VDBA 2BJMH 3VXNA 3QXDA 1XCTB 4BJLA 5IEKB 4W68A 3D2UB 3S37X 4X98B 2FD6H 4L4TD 3OAZK 4I0PC 1RFDL 3IS1X 4MD0B 5EO0B 3CXHK 4KRPD 4WW2F 1BAFL 1YNLH 3IFNH 3LOWA 4FQXD 5J6HB 3GMQB 4G6FD 3D39E 1SEBB 2ADJB 3N1GC 3QDME 4U1KA 5D9SB 4TVPH 1MI5D 2A77H 4PTUB 1HHJA 1Z6JT 3CPLA 1JGVL 1FG2A 2F74B 3H9SE 3ILQC 4R26H 5TDOA 3TT3L 1MELA 1S5IH 1X5HA 4GS7B 1BOGA 4XVJL 3IVKA 4XVUC 3O3EA 4UNUA 5K93A 3HC0B 3UTQB 5DRXB 5IUSA 1VSCA 4HUXB 1ZWIB 4JFEA 4U1MB 5JMOC 3I75A 5SWQB 3FN0L 2ZUWA 4K9EH 5C0CD 1T03H 4JG0H 3BH9B 3C09B 4EZMA 3BMWA 3DMMA 5IOPA 4R90L 1P7QA 1S7XB 5J7CC 3TGXA 2A9ML 3GSNL 3RNQB 4F9PA 4KROD 2RJMA 1XF5A 3RX8A 3UJTH 4LAQL 4EUPA 2V17L 3BH8B 3RVTC 5JXED 4G8EB 4IMLB 4NT6B 2AQ2A 2WZPD 1S78D 2M1KA 1U8QB 3G6JE 1INQB 1R5WB 2EC9U 2HLAA 2Q3AA 3T8XA 4F7EA 1K3IA 4D3CL 1XGRA 2OYPA 2VSCA 3ELAT 4ODXB 1BGXL 4WI2A 5HVWA 5EU6A 2J6EA 3GMNA 3MODL 1JIBA 2DI9A 5F1IA 5CCKL 4NSKA 3IU3A 4U3XA 2EIBA 3DGGB 1EIBA 5IB2A 3HC4L 4XX1E 2PNDA 3BISA 5DFTA 4H0GA 3MACL 4JN2A 1IKFH 5TF0A 5BO1H 4WHDA 2ADGB 3V0AC 4KZEL 1I8KB 4X5WA 5M95B 4L8SB 1K8IA 1JHKH 2FEDD 3Q1SL 4O2EA 4LOUC 1K2DB 1OAXH 4RBPK 4ZAKD 4MXVE 4DQOL 1IM9B 3OAYH 3ZKMD 3VFSB 3VFWA 4LKCB 4G3YL 2ICWA 5DEGB 1UH3A 4WI3A 1PW3A 2HT3C 1JN6B 1FIGH 2EYSA 2D31A 2IANE 5JHDA 5E9DE 4HG4J 5D7SH 3X13A 4GXUN 4RIRA 1EHXA 2OL3L 2B1AH 1QSEA 5GS0C 2DB8A 3MLXL 4S1RH 1AR1D 2QQKH 2EH8L 3BKJH 4UTBL 2JJWA 4R8WH 2AK4A 5I1JL 3MRRB 3LQZA 4PJIF 4NKMB 3LHPH 3CDGA 5AZEH 5CEZL 1MIMH 4N9GA 3R8BB 3QUKB 1F6FB 3TT3H 2YC1B 1M6OB 4KDTA 3MUZ1 2H26A 1IQDA 3HZKB 1ETZB 4YK4B 2DIJA 2F5BL 2GKIA 3WSQH 5GJSL 3QI9B 4WO4B 4GAJH 2AABL 2HFFB 2XXMB 3K8LA 4ZOEA 1OOAA 1MCIA 4JZJA 3SE9H 3BGFC 5CJ5A 2Z93B 4R3SB 3EO9L 4QT5B 2DQJL 5C9KA 5ICYA 4N0YL 3MFGB 3RWCB 4RGND 3RNQA 2AERT 3DI2B 4JDTL 3SO5A 2D31B 2KBGA 5DR5H 5T1LB 1R3KA 2WNGA 5AZ2L 1ZVYA 4GH7B 1T2XA 4Z77A 3PWLA 2XKUA 3WUWG 2EDYA 1PSKH 4OKDA 3BZEB 4L29A 3IJHA 4HS6A 2A9NH 4OQTH 1BVLA 3MZTA 1ED3B 3DV4A 1N26A 3C09C 4U7MA 1JVKA 5D7LB 3MLRH 5F9AC 4WFEE 5ANME 3BZEA 1T7VA 1RZ8A 5HGHB 4U31A 4NFBA 2H2SC 3JZ7A 4U6HB 5BV7H 1RIUH 3IVKB 4NN5B 3B9AA 2DWDA 1F4XH 2YUZA 4CVXA 4B50A 1HHIB 2R9HC 4IRJD 1JFQH 1Y0LB 5D1XD 5FA3B 3RHWK 2J8UF 3VXTA 4X80L 4RISH 2YPLB 4NZTL 2PCPA 4V2BA 5AYUH 3RWIB 2IPTH 3BZFA 2D0FA 3S8WA 4ZO6A 1WAAE 4P9HL 3MLVL 4OF6A 1T3FA 2HTLC 5DRWB 2YKLH 1KIRB 4JFZL 2B0SH 1YNTB 3JWDC 2NY3C 1I9IL 2NR6C 2BNRE 2MHAB 3CFIC 4P2OC 1BWMA 4OLUH 5F9OH 3NCFB 1CXIA 2MQ3A 5I1CL 3D9AL 2EKJA 3MRBA 5IFHH 4YAQB 3KPMB 1TJIL 5ELIA 3DRTA 4GW5B 3OKNA 4AEHL 2MKWA 2FGWH 4WU7A 1BQHG 3IKKA 5IKCB 4WVRA 12E8H 4F2MA 4LSSH 2CKBA 1LO0H 4FZEH 4C56E 1PG7W 5CZVH 5HHQA 1WZKA 4WWID 2ITCB 4MD4A 1DCLA 3UROR 4HZLB 3SJVE 2HVJB 1T7ZA 1SVCP 2N7BA 1Z9MA 3DVNA 4I3GA 2EEBA 3CU7A 4JO4L 5AG8A 4JFFB 3MLWH 1HINL 5DD3H 5C6TL 2X4RB 4R4ND 5FKPB 3H9SD 4JO2H 1M7XA 3KPSB 2BOBA 3ORJA 1RIHH 4MCZB 3W0WD 3NPSB 1WZMA 3QFDA 3MLUL 1JUFA 4O2EB 1DQJB 4S0SD 2R1WB 1QFHA 2ESVB 5SWSB 1MIEH 1Q0YL 3D85B 5MEPB 4PLOB 1FNSH 1NBZB 4IOIA 1OP3K 1ES0B 3GMLA 1PDKA 2QQKL 4K3HA 4RAUA 4GG6E 3KXFE 1AXSB 5E8PA 2AV1B 1H3XA 1MRDL 4AMKL 4MWFB 1WZ1H 2A6JB 4PJIB 1X9QA 2QLVB 4J3UA 3KPNA 4KDTC 1DN0A 4M7LL 3PL6A 2FGZA 3MMEA 4QRUA 4ZUUB 3WFBH 3ROOB 4BK5A 5EZJA 1S78C 1YJDH 5FOBB 1OAXL 1TVDA 5IHBA 4KHXL 1HXYB 4C4KO 1CD9B 4FQLH 3T0EA 4RMUA 4GRWE 2CQVA 4KZEH 4E41D 5T5FH 1XGTA 2OJEA 3BZ4B 5GZOD 5KBNC 3QXAB 5FDYA 4ZFOL 1TJGL 2IPUG 4XMLH 2X7LA 2IBGA 1CIUA 1OTTD 3O8XA 2UVFA 4HHAB 3QQ3B 3C08H 2VXSH 1DL7L 1Z9LA 3HFML 3NCMA 3HB3C 4FFVC 4AQ1B 1MAJA 3HE7C 2NXYB 3ES6A 2DDQL 4K23H 4OM1L 1CK0H 5ISZE 4FXGA 1RZGB 4PJFF 1MFNA 2Y25A 4KRNA 3UDWC 2D9QB 1CF8L 5D6DC 1AO7A 1JWUB 4CN6A 1TNNA 3L5WA 3IDMB 1CICC 4PRDA 4G9FA 2P8PB 3MRHA 1BP3B 2PYEA 3C6SA 4PRNB 4EN3C 4JO3L 2DQGH 3O41B 1DBKH 3MRMA 3QDJB 3LRSA 1QR1A 3S88H 1CICD 1SEBA 2ADJA 2HH0H 3FQWB 4U1KB 5D9SA 6CGTA 2C3VA 4M93C 4ODTH 1YNKL 2VLJB 2A9NL 4LF3B 3RWJB 1B6DA 4P2CG 4AH2B 2O61A 3BPNB 1NAMB 1M05B 4FP8L 2J8OA 1E4WH 3WXVL 4X80H 3OG4B 4L8BB 5CEXB 1BPVA 5EBMA 1UQSB 1VGKA 1YEDB 5FO8A 1WBXB 2EYRB 1F4XL 5AZ2H 4U3HA 1XR9A 1BFSA 3IJSB 3DARA 4V1DA 4U1NB 3QIUB 5HI3D 2OTWA 2WWKT 4X83A 1WITA 2ZP0T 3C5SB 4OZFG 1G6RB 1NGZA 4PGDA 2QSVA 4G8IB 4PJCE 5C2BL 4S1DC 5I8KL 3V95A 5A2KH 1ZSDA 1KPVB 1MCKA 2L7JA 3PQYB 4NC0B 5A2LH 4HS8L 4XPTL 3VRIB 4LSPL 2XZAL 3PWUB 1M7DB 2VNCA 5CSZB 5IVXA 3O41A 3TPUA 2F19L 3TWCH 5ENWB 3LH2H 3DMMC 3LMJL 4M7ZC 3B43A 2QKIA 3QQNA 1RD6A 2YD9A 2C9AA 1EA9C 2OK0L 4ZYKA 1OCWH 4RGNE 4HFWB 1LDSA 5DJDA 1I85A 1CFNB 1MSPA 3LD8C 2Z4QA 3L7EA 5DD0H 1AGEB 2KZWA 3KHQA 1D5IL 4F7MB 5A2JH 3DHJA 3K0WA 1FG2B 2F74A 4ZPTA 2BY3A 1NCWL 3DNKA 1NC4B 2WM0A 4K71C 3KJ4B 3QCVL 3BQUC 4YEEA 4MB4A 2HJKB 3CDFA 1QOKA 3D25B 4I18B 1G6RH 3E8UH 4ODVH 1U8IB 2VDMH 1JWMA 5BRZD 5L8KB 5F7EH 3EJYD 4HWBL 3RRQA 1K6QL 3ULVL 1NGWA 3D5OF 3HI5L 1UEYA 4MLSA 2PETA 4V2CB 1MPAL 5HYIA 1LO5B 5GRWA 4Y4HC 4L8CB 5IGXL 2CH8A 3WKML 1F6LL 3S36H 2RCSL 4OI9A 1U8LA 4XC3H 5L6YL 1A7OH 4BH8A 3MNWA 1I7TB 4JZNA 4NO2B 3FCTB 4MXQC 2NZIA 2X4SA 4M9OA 5C86A 1WVZA 4Z0XB 3UZQA 1XIWB 1DBAL 5C0BA 3WN5A 3O3AA 3VWKA 3DURA 1MJJB 1W0WA 1CGVA 3EAKA 4FP8H 4WHCA 4OQTA 2MKLC 2BNRD 3IFPA 4JY6A 2IAMC 4PBVC 1W0YT 5FA4A 4FTVD 3CFCH 3N9GL 1MCDA 1NCNA 3MGTB 3JVGA 3DTXA 3MNVB 2AJ3B 1JGDB 1W72A 2BVQA 5DRZB 1MI5B 3HRPA 3ARBB 3ESVF 4YHML 3OWEA 4TOYL 4KK6C 2HWZH 3IKCB 2GJZA 2YUWA 1QLFA 4C56D 2NY1C 5FKPA 4NN6B 4NQEB 5F9OL 5HI3C 2HFTA 4GBXD 4HK0A 1DLHB 2G75A 2DQIH 4G43B 1CICB 1UWEL 4GO6B 5C0IB 3VG0L 5HGAA 4Y2OA 1LO4H 4LNRA 2G2RB 2VITA 2J8UB 1IQWH 1H0DB 4JVWA 4YFEA 2R2HB 4FQLL 1MHEA 2YS4A 2CMRH 4NNXB 1R0AL 4NQDD 2Z93A 4ODHH 3SDAC 5HYSA 4GG8B 1SY6L 2EXWD 3BEVB 4M93B 3P0VH 3QEGL 1WTLA 3DRQA 1UG9A 5KG9B 3O6FA 3ARGC 3U83A 4L3EB 1AD0A 1FFNA 2J12B 2WIIB 4NNYB 1AGFB 4URTB 2P5WA 1H3PH 5F8RC 2OBGA 5IKCA 4KTDL 3IJYA 2D7OA 3OKNB 2EH7L 3RA7L 3MYJA 1A6AB 4WENB 2D0GA 1A3QA 1A6ZB 1DN0B 4ODXA 5CILL 1SBSH 4KQ3L 5CIPA 2P4AB 4Z78A 1KTDB 3VXME 5HXMA 3LKSB 4K3JL 5IB3A 4EDXA 3H7BA 3N85L 4OLVL 3EDKA 1PKQB 5DUPL 3D25A 3H7LA 4WV1A 4V1DE 3GSOB 2XKNA 3VMOA 4GG6A 3BMVA 4JRWA 3KPRE 1BMGA 1MJ7H 3KLAA 3V4VL 1FL5B 3DWTA 3QUZC 4NO3A 3DMMB 1WISA 3EO9H 1RI8A 1I3RA 5INDB 3KPOA 5FGBA 3ULUH 1MIEL 2BNUB 5HVHC 1LP9E 3SGEI 1G7IA 1MCJA 4GG8A 4Y5VC 1OCWL 1JTPA 1EFXB 1ZANL 3I6LE 3D3VB 3O11B 4YWGH 3TWCL 5MEQB 5KSUA 1J87A 2QSCH 2CSPA 3E1F1 2IGFL 3QIBA 1P4IH 4NZUL 1ZTXL 4QLRA 5F6HJ 4OZHE 2VXUL 4I9WD 3RBGA 1NJ9A 1HSBA 1UWGH 5LGKA 1HDMB 1OGTB 5SWSE 4YUEL 1H3TA 3QUXA 3H9SB 3QUZA 1AJ7L 3ABZA 4UOJA 4G42A 4NUGL 4E42B 2VIRB 3D0LB 2VTFA 5FYLD 2R8SL 2FX7H 1FORH 4F9PC 43C9B 4YNYB 4JG1L 3QIWB 4B41A 3BYTA 1MCPL 4ONFH 4P2QD 1BLNA 3W39B 4OLZL 5ID1B 5JHDD 5E2TH 2FHCA 5B8CA 3MOBL 4M6MH 4D94A 1ACYL 4Z76B 3SO3C 4YDLC 1NFKA 5C3LD 1UB5B 2IAMD 5CEYB 2ZUYA 4XNYL 2C4XA 2AV1A 4M1CC 4W6YB 5H2BB 1MCEA 5KN5B 3Q6FA 3P4NA 1F3JB 3OPZH 4P2YA 1A3RH 2CK0H 2CDGB 2WINB 3FT2B 2PW1B 4EXPX 4Z7WF 1AKJB 1A14L 2FIKA 2NY1B 4X8JB 1EZVX 1IGJA 2CD0A 3T1WA 5IV2A 2QTEA 2XNAB 2C1PA 3DUUB 1FZMB 2H32H 3B3IB 2IFFH 3OX8A 4OZFH 1GSMA 4JRXB 3SE4A 4J4PC 1I4FB 1FPTL 3QEHA 4XHJC 1I1FB 1FCGA 4OLVH 2Q6WB 2GITB 3K8KA 2R23A 4LCIL 4NYLA 4LARL 3K2UL 5L0QC 4DKEL 3UJTL 1ZLUK 3SCMC 4XP1L 1R3IH 1NCAH 4E5XA 4PLKD 3LV3B 1GYAA 4MSWB 2DL2A 3MV7A 4E41A 4HUMB 3RL2A 4YGVB 4UTAH 1OLZA 3OKKA 3KLSA 3E2HB 1D5IH 4MGXA 4I3SH 2GFBB 5D7IB 4WEBH 3MNWB 5FHAH 3MLSH 1VESA 5I1HH 5E2JA 4Q7DA 5I1DB 4WIQA 4DOHB 4OGYH 4TQEL 4IOFC 2VE6B 1FVCA 3AMKA 4S1QH 1FNGA 2FBJH 4QRPD 4RWYH 2XWTA 4O02L 5GXBB 4CJ1A 1CG9A 4LBEB 4P5TB 4EOWH 5DT1H 2FLBT 4Q74A 1D5XB 4KHTL 2WWMC 4K3JH 1GCFA 1CGSL 3WXVH 3QUZB 1JTTA 4M62H 2GTZA 4G5ZL 2V5MA 2OXGA 4LLUA 1MHCB 5EZIL 2ATKA 2QSQA 2ICCA 2XN9B 1NC4A 1LK3H 1HILB 4Y5VB 4UTBH 2R15A 3V5HB 3DXAE 1FH5L 2HLFC 1QVOB 1QSFD 4IRSB 3HR5A 3KWWA 4JFED 5E8NB 1DBKL 2ARJA 3B2UD 4JFFA 5KSVA 1D9KC 2AEWA 5E4EB 4FQ2H 2YBRB 2DMBA 4Q9RL 4IOSD 5SWQA 4LDEB 4OBSA 2V2WB 3KXFA 1FV1B 4XVSH 4KROB 5TE6H 2MFNA 3RWDA 3ZDZE 1E4WL 1A64A 2BNQA 1Z0NA 4Z7VB 5DJ2A 5C0JB 4LIQL 2F53B 1CLZH 2RFXA 3ZHLA 5FYLH 3ARFD 3OKMA 1FYTE 2AXFB 4XNYH 4LVOB 3Q3GA 15C8H 1E27B 5HBBA 3PWVA 1I1AB 2GK0A 5EDXA 4PGDB 2GTWB 4APQD 5GIRB 4F58L 4ZTPH 5IFHL 4Y4FA 3GMRB 4MA7H 3EZ8A 3D2UA 2VO5A 1R24A 3CFJB 3VXMA 4DZ8B 1A6VH 2VABA 1F42A 4LLMA 5HGDB 2ZSVB 3CH8A 4ONGL 4Z78B 2B0SL 1T20A 1Q9OA 4XB7A 2D2OA 1U58A 4CRPA 5E9DA 3H3PH 1HCFX 3X12B 2BZDA 4GW1B 4KKBC 4W81A 4NC2B 3WFDL 5KSAD 5KZCD 5C07D 1KGCE 3GBML 4NCC1 3CH1B 5DFVC 4WFED 4AH2A 4CADA 1T83A 4PB9H 2G5BA 3ULUL 4AIOA 3EO0B 5ILTL 3KLHC 2CRMA 4N5ED 2I26N 3GIZL 1MCOH 2A0LC 4U6YB 3AU1A 4AG4L 1JF1B 4NFCA 5FAAA 3VFMA 4XHJD 2QADB 4U6XA 4YX2H 2IMNA 1NUGA 3PL6D 4TRPH 1ZHKA 1PQZB 4BFBD 4ZOBA 4JHWH 1BQSA 4XBEH 3CD4A 1KTLB 1K6QH 3ULVH 3OTTA 4YZFE 1T2QH 5DEGA 1TTUA 3LPFA 3BKYH 3V7AG 4OCLC 5CJXA 3R06A 4M7JL 3VXUB 4TVPD 3LSOB 1AKJA 4QOKE 32C2B 3I6LD 4R96A 3UBXB 3L7FA 3O6MH 2W60A 3KPLB 1D5XA 3FQXA 3EIFA 1Q9KB 3CAFA 4MS8D 5ACMA 1U8HB 4MJ5B 4P99A 1OGAD 4PJ8C 4BSJA 3SCMA 1U92A 2OR9H 5E94A 1JYNA 3EOAA 3HPLB 3SGEH 1OTSD 3WFCL 4K3EH 1QYGL 1LO0L 3MR9A 4R7DB 4RQQA 4XWGL 2P5EE 4LCWE 4OAWA 3RNKA 1KXVC 2NLJB 4LRIA 1FO0H 3VFRB 4ODWB 3SDXB 2OTUA 5B3JE 3TM6A 3TN0D 2VDQL 5HGBB 2MSPA 4HF5L 3K1DA 1T6WA 4GMSH 4PRPB 4ZTPL 2FX8H 5FYLE 3FMGH 1WF5A 1DP0A 4OZGF 3C87A 5INCB 4XMPH 1MCCA 4HC1A 1T4KA 2OL3H 4ZFFB 3LKNB 3LCYA 5IBLC 2Y72A 4WFFE 3S3JA 5C0FA 5F89A 5SWSD 4NGHL 4NZDA 5GIRA 2IH3A 4JJ5A 1BJ8A 4WWKA 5BZDB 1RUQH 4RMQA 5F1NA 3G5XA 5HSFA 1J05B 5EPMB 2YPVL 5ITFB 5HYJA 1HI6A 3MROB 3GMMB 4FZ8H 1IRAY 4OFPA 1I1AD 3VFGL 4TTDD 4OZGE 1IZKA 3P30H 1KCUL 5I19H 1FGNL 5J57B 5IB4A 5FYLL 2GYSA 2BK8A 3MLVH 1JMXA 1JHLL 5DA4A 2YWYA 4MVBD 1JF1A 5KSVB 2AJZB 3WFBL 4NNPL 2Z31C 2CDEA 1OF2A 3MRKB 5TQ0L 1CDHA 3WIFB 2W9DL 1WSST 2XKNB 1CFTA 2EDKA 3U7YL 2HN7A 4BZ2L 1NGZB 4MMZC 5B8CB 1D6EA 5FECA 5JR1H 3FZUC 1LD9A 1ZMYA 2NYYC 1HYSD 3KLHD 1QPPA 5E2VH 4JGMA 4XP4H 1ZK9A 1CGSH 1A3LL 1IC1A 2PW2B 5GSVB 4Z7OF 5CIPB 1JV5A 1Q9LB 5T5FL 4KAQH 1VFUA 4Y4FB 4XAWL 4YO0B 2BOCB 2APFA 1HYRC 4GQ9H 4YX2L 5DMKB 4DN4L 4XNMB 4KKAC 2X1OA 4UB0L 4F9LA 2PO6A 1HSBB 4KK9C 1MCOL 1CFQB 2CRIA 5CJQH 4N0FA 4RQQB 1EHNA 1T03L 3L5IA 3RI5K 1EO7A 5GISL 1UB6A 3BYYA 4K7FA 5CWSB 4DJMA 5C71A 3QPXH 4BM7A 5I0DA 1JRHL 3CGTA 4F80A 1K4DB 5JNYB 3NN8A 1L6ZA 5F7UA 2R2HA 2ESVD 3RWFA 2J8UA 1TIUA 3UTPD 3DIFA 4NKOA 3QXTA 3TZVA 3SDDB 2B5IC 5DJZA 4WRLA 3PHSA 2V2XB 1RJYB 1U8JA 1N8ZA 3BN9D 3KYMA 3ZSSA 1IM9A 2WAHA 4P2QA 5C0EA 5HHPA 1RZJL 5KVMC 1RJCA 3HZMB 4UT9H 1B0WA 1DEEA 4Z7QE 3MLTA 4Q9QL 3OGOE 4HW6A 1DE4B 4IDJL 4N0UB 3VFGH 1B0GB 4D2NA 3P73A 4M8VA 5HDQL 1L7IL 2BCKA 3CVHH 3WHXA 3RWEB 3NIDE 5IROC 1F3JA 2GCYA 1WT5A 3DVFA 1FNGB 4GSDH 2ZCHH 1CGUA 3R8QA 4JPIA 1A47A 5DD5L 4LPYA 2NY5C 4FS0A 1TCRA 4NQCA 4XT1C 5D6DA 1TVHB 1S9XA 1G1CA 2PTVA 3Q6GH 4M5YL 2PTUA 2JJVA 2O61B 4NWUL 1KJ2H 2C3VB 2CMRL 4JFQB 4M00A 4OM1H 2Y06H 5DVMA 2R56L 3CC5A 4CMHB 1MFEL 4WW1A 3C2AL 4HUUB 1J1XL 4OZFB 3LKPA 4JO3H 2V7NB 4MAUL 3GSXB 1OWRM 3B8SA 5J12C 4X4YA 4YFLF 5F1SA 1IAIL 4PD4K 4M62L 4DVRL 3NZ8B 4L4VB 3RI5F 2AJVH 3RIAF 1JP5A 3QXUA 3HE6A 15C8L 3DYMA 5HHPB 2EYSB 1NBYB 3ARGD 2ICWB 4Y4HD 4YLQT 3MJ7B 1IGCL 2CLRA 3T09A 4HIEA 1ZA6B 3Q3GB 4LFHD 5FO7B 1W72H 5CLTA 2I07A 2XOTA 5LAXA 2VXSL 3QNZA 4J3VA 4P5KB 5DD5H 1PEWA 2ZOKB 3RVTD 5HHMB 2GIYA 5EH1A 1PLGL 2WUBL 3TP4A 1P5UA 5EOQL 5BVPL 3NCEB 5C0GB 1L7TH 3GK8H 5FYJD 3TZVC 3MRJA 2AK4D 4LGSB 3CK0L 3HAEG 4UINL 2FYYB 3HNTL 3O6KH 4RFOH 4FTVE 4HKBA 3NIFF 1UM4L 5I76A 4D9QE 1KELH 5J56B 2XYCA 4JO1L 4XNUL 5FOBA 3LIZL 4J23A 2AEQH 3NZHL 3U36B 4H25A 5L9DL 4D9RD 1ZXQA 2G5BB 1WUNT 2FHFA 3FZUD 3NGBB 4HWBH 4I3RL 4Q2ZB 4U1IB 5FF6A 3VGFA 3EOBA 4WNQA 1X5KA 4KKLD 2VLMD 3BESR 1UKQA 5IHZA 1NCWH 3DI3B 1IGYA 1IGMH 3LKOB 2W9EL 1JGEB 4MJIE 2YN5A 4F15C 5DD0L 1EERB 4C59B 4OV6F 4NQDE 5F9WC 1B6UA 5CJQL 3AB0C 3U4AA 3JTTB 4TVPE 5DFWH 1ZVHA 2HG5A 3KNBA 1I3VA 3RIAK 1AQKL 3QO1B 2YD1A 5AAMA 4OCXH 2EXYD 1AGFA 5MENE 1OGAE 5D1ZB 1WCBA 2Q8AL 5F70A 1ITCA 3MQIA 4ONOA 1LQSR 4LSPH 3QWRA 1K4CA 2DD8L 1YMHB 3FN9A 2P8PA 1KC5L 4ZYKB 2I24N 1DSFL 2HVJA 5E2VL 3QEGH 4MD4B 4TOYH 1BEYL 1BFVL 3BT2L 2VDPL 1SYVA 3SOBH 3VXMD 4GXVL 3WS6C 2APXA 2Q86B 3HPJB 1EH9A 4JFZH 3N9GH 4PJ5D 1IAKB 5C08B 4WEUD 4X99B 2X4UB 4CW1A 3GSOA 1OAQL 2YWZA 1YQ2A 3IDJB 1EGJL 3VE0A 3IFOA 4OCWH 1KB9K 3QR2A 1N64H 1LP9A 5JLZA 1Q0XH 1YDPA 3B6SA 4GS7C 2BSTA 4YHMH 4G6KL 2XTLA 1QRNE 1DBJH 3BPOB 2BFVL 3A6CH 1CL7L 4P57B 3ZTJG 3O2DL 5CHNA 2EDNA 2Z8RA 4NKIL 4EKXA 4NWUH 3TBYB 4PRBA 2DF3A 1QKZL 5F8QC 1EEZA 3S34H 2RGSA 5C0CA 3ZKXB 4PREA 5IVZB 2PXYC 2IADB 3HI5H 1DDHA 4YFLI 1VCAA 2L7UA 3DX6B 3QUYB 4CN4A 4XP6L 3UTTB 4JVPA 3E6FB 4PGZA 2EE3A 3CFEA 3CUPB 1E4XI 3FT3A 2DQCL 2FJHA 3AAZB 4C4KT 2LU4A 1TDQA 2IQAA 4OLYL 1JPSL 3QRGH 3MXWL 3VFOB 4GKOA 5GS3A 1FC1A 3TJEH 4KQ4L 3SPVB 3BE1L 5KANG 4Q97A 1P7KB 4P3CH 3RWHB 4Y4KD 3IDNB 4XBGA 3JBG7 1CICA 3VH8B 3L3GB 5MI0B 5AEAA 5GGUB 5JHLH 4ZS7L 1BD2E 2GJZB 1W8NA 1A4JB 4RX4A 3U0TB 1TZGH 1R3IL 4YHLH 1E28A 4NKOB 4JR9L 1K2DA 3TZVB 2YPKA 4KAQL 2HJLA 1H5BC 1V3KA 3VXPA 3RWCA 2DM3A 3NH7L 4KTDH 3VA6A 1LDPH 5ICYB 4OM0L 3ARRA 3PIQB 3C8HA 5CP3H 2DL9A 4R0LA 5E0QA 3VA2C 3L1OL 1UADC 3C5JB 1V3MA 3PGCB 4ESKA 4QY8A 3WBDA 3ZHDA 4OGXH 1N4XH 5GJTL 5CSZA 1QSFA 5IVXB 1MH5B 1P2CB 3QUMH 2AS5M 2Y7QB 3MLXH 1XT5A 4L8SC 1XIWA 3WFZA 4JM2B 4JDVA 1DVFD 1DQQA 3TIDB 4QGYA 4FXLA 1KEGH 1Q9WB 2NTSP 3HE7A 3LKRA 3KHOA 4NN7C 4OUOA 4YO0A 3QXVA 5EUOA 3UTTD 1EFQA 4XP4L 1QFUH 3OPZL 4P5TD 4XGZA 3BP6A 4GRLB 4F15B 3T2PA 2ZKHL 1U9KA 1WBZA 1HHHB 2H3NB 1XR9B 1UM4H 2ORBL 2WLZA 3IAPA 5EU5A 3X11A 1SBSL 2PR4L 1KTDA 2O5ZH 1JGUH 4JO2L 4CNIA 3AB0B 1U8OA 1DQMH 4HJGB 3RA7H 4DUXA 3H6JA 4ZSOB 5D5ME 2Z35B 2ATPB 2B1AL 1F8TH 5EOQH 3VWJA 4RGMC 3OGCB 5JO5B 2Q7YB 2R1WA 1J5OL 2GUOB 5GGSY 4X4ME 5HYEA 2MJWA 2Y9RT 3C5ZA 1VACB 4G80A 4U0QB 2OZ4L 4RFEA 5IESL 3MV8B 1U8JB 3O0RL 5D7IE 1UA6H 1VGEH 3HG1E 5IFJB 2N56A 3MYZA 1G7PB 1NEUA 2VDNL 4NJ9H 1GGTA 5KSUB 4JDZA 4X7EC 2F54B 3PXHA 3V2AR 3GIVA 2H1PL 4KKCC 5KSAA 2RQ8A 3D3VA 1KT2B 4WUUD 4KH2A 3HRZB 3EYSH 2X09A 4YHOL 2X4NA 3NAAL 3P9LB 2VXUH 4QRPE 3TPUB 5HHOE 3VFNB 3ARZA 3PHQA 2VXTH 2FX7L 4JQIL 2QSCL 4EI5A 5D2NC 4X5LA 1FVDB 4X6CF 4NFDA 2XZQH 3F7YB 3MOQA 3LN9A 3SPVA 3PWPA 3WKNA 1PZ5B 2VISA 4I0PA 3FKUS 4XPGL 4N0CD 5GS0L 1MHHB 2VC2H 5IHZB 4M7LH 3SEPA 3MV9E 3TLRA 5I75B 5JW3H 1ZA3B 1T3FB 2V17H 4NQXA 4EUPB 2OMBA 4ODWA 1I1RA 3O2WH 2X42A 4YWGL 4TSBL 1N59A 1AHWC 2LVCA 2J6EH 4X5XB 1EHAA 2JJSC 5EZIH 1FE8L 3CSPA 4PRBB 3F58L 1PSKL 1FHGA 1F97A 4JFXA 1MFDL 2B39A 4PGBA 5CHNB 2ENYA 4KK9D 5KG9A 1H3VA 2VDLL 4RAUB 4X6DB 3O81A 2C4FU 2BCKB 3HHRB 3QQ4B 3OB0K 3FQXB 1BVLB 3G6JB 4LRNL 1QSEB 1DBML 4K3DL 4LLAA 4D0CB 4IEFB 3MV01 4XP9H 3RDTC 4HJJH 4TTGA 1MCLA 1I4FA 3QEHB 4XVTH 4IRSA 5GGVY 3SE9L 2XQBH 4OFYA 3T2NL 2UZXB 1HILA 2Z0BA 1F3DJ 1TJHL 4KRMB 4HKXB 2FIRT 1TNMA 4H5SA 4NQCD 4K7PY 1YEKL 3PDOA 3TCLA 4ETQB 5JPNB 5DHVB 1JI2A 1F4WH 3IGAA 5GGQL 2FD6L 3N50A 5DK3A 1S7SA 5DJXA 4KMTH 4K07A 4U1LB 4XCFH 4EJ1C 2VZ3A 1C8PA 5K9JL 1IC5L 5ACZA 1VDGA 3V5KA 1BM3L 5DDHA 1NAKL 4LEOB 4LOUD 3VRIA 5GGVH 3CXDH 3EYVA 2ZCLL 1CVSC 3U9PH 3GRWL 4GRLC 3KPPA 5D7IA 3JTTA 3UC0H 4GW5A 5ACLA 1UM5L 3HE6D 1EEYB 4XTRC 1EEZB 3KPNB 3W0WA 1TVHA 2IANB 1SJHA 3VXSA 2AJXL 1R3JB 1BX2A 3AREC 3C08L 2OXHA 1YUHB 2EE6A 1IC4H 3RWEA 2ZSVA 1RU9L 3I2CH 4BYHA 4MJ5A 5BOPA 2A74B 1OAZL 5J9PB 3ZT6A 3QHTC 5IG7B 3HZYB 4QGTA 3DX7A 4S0TD 4N90E 4QHNB 5DHVA 5IEHB 4GG6F 1TTFA 5I19L 2VLRE 4F8QA 3GKWH 1M7IA 4HX1B 1N5AB 3TA3D 1OF2B 5LGHL 4R97B 3B9KC 2AVGA 4ZG1A 4KKLC 1CL7I 1RUQL 3GSUA 3KYNB 5TE6L 2I9LB 3GHEL 1II4E 4MD5B 3C9NB 5F6HI 2D7QA 4M5ZL 4NO0A 2B1HL 5C0JA 2QJDA 4HPOH 1S7TA 4FN0A 4J1UB 3SDDD 3GSRA 1NBVH 3MSPA 3C9NA 4FNLH 4KJWD 2ZOKA 3C60A 2NY1D 2R4RH 5IW6A 2MMXA 4HMCA 4HCRL 5TDNA 5KVGL 3OZ9H 1AY1H 4QTIL 2FATL 5C08E 3VCLB 4WEBL 2W38A 3DO7A 1OAYL 5KAQG 3MBEC 4UUJA 1QFPA 2IH3B 3HMWL 2E9IA 3EYFA 1K9TA 5IP4A 5CFHA 3JV5A 5HD8D 1JE6A 1YYML 3P40A 5TF1H 4IJ3C 3X12A 4XXDB 3SQBA 1HHHA 2XICA 4L4JA 4YDVA 4P9ML 5LVEA 1DBBH 1HXYA 2VMFA 4GRLA 5CEXA 2CK2A 1AHWB 1YN6B 5SV4A 3PL6C 3BWAA 4Y2DA 2R2BB 2A6DA 2GSGB 1ORQB 4JFDB 3ILPA 2ZUUA 1JZ2A 1RUAL 5KVFL 2NLJA 4G6JL 2ZPKH 3FRUB 1O5DT 2YXFA 4LVNC 2GJ6B 3D18A 4N8VB 4XCYA 3BH9A 5I8EB 2YD2A 4LQ1A 3U4BL 5DK2A 3NA9H 3FT4B 3X3FH 3TEUA 2YD7A 2XFXB 2KL6A 1DQTA 5C2BH 4ODUA 5MEPA 1NH6A 1S7TB 1CDBA 3LRGA 4YQXH 3K74B 4NQVB 1VEMA 1OD7A 4RIRB 1HNGA 2YHGA 4ELMA 3C60D 3R06B 1FJ1B 5I1GH 2I07B 4HV8B 3QSKB 1W0VA 3HG1D 5C07B 5GS2D 2C1PB 1IEBB 4TNVK 4LLYB 2BC4A 1LEKB 1T0MA 2FR4A 3U0WL 3O2VH 4MD0A 5EO0A 4D0CA 3KVQA 1MUJA 3BGMA 1T0NB 3FFDA 3WO4B 1JBJA 5FYKE 2R0KL 4XCNA 1JHTB 3FO1A 4DCQA 1RUML 3L3IA 5LWYL 3MLPA 3VFOA 3IDUA 5GHWH 1XGQB 5IBUG 2XRAL 1F4AA 4M7KL 4L3EE 1A0QH 3T0EB 4MQXD 1EO8H 5F7WC 3W9DA 4XCYB 5BMFH 2H32B 3QJHA 4Y5XC 4ZUSB 5T33L 3QAZB 4MJ6A 5LGJA 1CTNA 4XCCH 4KJYA 1IAIH 3EOTH 1VFAA 4XMLL 5ADOH 4OZIA 1J0JA 5E08L 1CZ8L 4BZ1L 4WTZA 4GMTH 4PPTA 5DYOA 2J5LC 3OJVC 1BBDL 1IGFL 1RU9H 3BQUB 4GBXC 2VLKE 4YDJB 4LSUH 2F5AL 1ZLSL 1B0RB 5DWUH 4NUGH 1BFOB 2VABB 4OCNC 3NFPB 2D4FA 1CU4L 3WS3B 3OAZH 4GJTB 3UAJC 4ZPVA 1F4YH 2YK1H 4KMLB 1MHPL 5JTWA 4OD3L 3OMZA 5EUKA 1BWWA 1KENH 4GKSB 4BQ9A 4Y4HB 5DJYA 5EC2A 4BSVA 5GGVL 4LDOB 3V9FA 2E7CA 2ADFL 3NFNB 5JW4N 1L9NA 4Y89A 5IV2B 3RZWA 1CFVL 1GPOH 3QUYD 5BMFL 1PX3A 2R1XB 4PP1D 2A6KA 3F5WB 1JZ3A 3F62A 1X44A 4CU7A 2AEPH 3I75B 4GRWB 4JG0L 3PXJA 3LN5A 5IW1A 2J4WH 3UTQA 3DX8B 5T3ZL 2Z92B 4B7IA 2O93L 1NMAL 4KWUA 4Y16D 2GAZB 4FQQB 5F7KC 1MWAB 5K9QG 1FIEA 4OZGB 3EFDH 3K46A 4HD9A 4PJBA 2IBZX 1GGIH 1A1MA 4JQXA 4G9FD 1U91A 1RPQA 4LLWA 4NQCE 4MDIB 4DVBB 2DLTA 2BNRB 4IJ3B 2NCMA 5D7LE 5EC1B 1DBMH 2DI8A 3NA4A 4JFPA 4BH8B 3FO0L 4P4RA 5A16B 3V8CA 3PHOA 3MRBB 5MERB 1S9YA 2RBLA 1S5HA 3RAJH 5A3ID 5IMKB 4DQOH 6FABH 1CG9B 4OSUL 2E6JA 4L3AA 4LSSL 4CBPA 1AXTL 3FOMA 4GQ9L 2OR7A 4PJ5A 3AGVA 2X4OA 3VXSB 1NCDH 1PX4A 5EBLA 3GMRA 2KDGA 2MCPL 3HNTH 2VWEE 1HXMA 2J1KA 4NUJB 4LQFH 3QIUC 5HYQA 2X2YA 5E5MB 5TE4L 3SJVB 4X6EB 3ULUE 5ID0B 4ZPTB 4OIBA 5DK0A 1AKJD 1I9IH 2DWDB 4ZO8A 4EQ3A 4FQQA 1OARL 2AEIT 2VQUA 1MAMH 2Z8WC 1GIGH 4FABL 5C6WH 4G6ML 2NY0D 2W9DH 5L88H 4HJ0C 5IF0A 5F7DA 4EI6A 1VADB 4D9LH 3ARWA 1KTKE 1A7NH 3IGAB 5F96H 5TF1L 1I9JH 2BY2A 3EDFA 3NIGE 1EMTL 5JIPA 4PTTB 4BELD 1KYOK 3HMXH 3HMWH 1JHKL 3GSQA 1GGUA 5BV7L 4Y0GA 3WO4C 4HAFA 3LD8B 3V8OA 1CE1H 1U2HA 3G6DL 5HPMB 3QHZL 3R4DA 2FATH 4YHOH 1KTLA 1IL1B 1YYLH 1ACYH 4AT6A 2E9BA 1G6VK 3NOIA 5F97E 3T0EC 4Y5YC 3MNVA 1JPGA 1WFOA 5ESAA 3TA3C 2AW2A 2D0HA 4N90D 3S37L 5B39A 4OUUB 2A6IB 4I18C 4E9LA 2E8ZA 4QNPF 1WBZB 2H3NA 4IHOB 1MJJA 2V9RA 1R3JA 3ZE1E 3MCLL 3BP6B 5HDBE 3QG6B 1G9NL 4NBYB 3K3QA 2W0KA 1S3KL 4L9LA 4U1SB 2AV7B 1GGBH 3LKRB 5AWNL 4GBXB 2W65A 3PV6A 2AI0L 1MFBH 3RNKB 3QCUH 1JPST 2NR6D 3TBVA 2D9CA 1QA9A 3UMTA 3L3JA 1A7PL 4Q6YA 5DRNB 3T0AA 4TSCH 5IJVB 4GAYB 3EJZC 4YQXL 1QNZH 1XIWD 5C08D 2BSTB 3D85A 4HKZA 5DR5L 2EDDA 3G04A 4O58H 3OKEB 4P59H 4KPHL 5GGTL 4QWWC 1P1ZB 1J7VR 1MCRA 4Z6AT 1ZE3C 4TYUA 4FA8A 3DX9A 1JUFB 1KEML 3PWVB 2AGJL 4UI2A 4HWEH 4X6FB 3LQAC 3T1FB 4OSUH 2CLRB 3VCLA 1M71B 4OGXL 5TDNB 2F58L 2NZ9C 1IGJB 1AGEA 2VWEC 2C4FT 3O6LL 4Y19D 2WBWB 5EWIH 5LQBL 1CDJA 1N3NA 1NMBH 3TC9A 4NN6C 1LHZA 3LN4B 2VL5A 4TSAH 5J8OA 1Z3GH 2FECL 1JWSA 2NY6B 3HC0A 3GSVA 3BJLA 4LSRL 4JQVA 5KSAC 5CGYD 5CSGA 1MLCB 3PDGA 1N5AA 1P5VA 4FQ1H 1ONQA 3QISA 3VGEA 4KQ4H 4AEIL 1TQCC 1ROWA 4U49A 2IMMA 3GO1L 4HUWA 1KBGH 2FO4B 4F7TA 2V5SA 4PJ7F 4OCRL 2BVPA 1OQOA 2HRPL 3F12B 4G3YH 4PJHF 4PJ9B 5JOPE 4YHYB 5MP6H 3MCKB 1RZFL 1RJZA 2VLJE 3O3BA 3WD5H 4XNZB 9CGTA 1S9YB 1SJHB 3QFJB 5KS9A 1QQDB 2JELH 4XPHH 1A6ZA 4Q6IC 3HCVA 2XY1A 1QBBA 4JPWL 4F37F 3VXRE 4PBXA 1QBAA 1S7VA 3C8DA 4JDVB 1A4KB 1G7MA 2Y7QA 1UEMA 2ZJSL 1CL7H 5H37G 3BXNB 5JW4R 4F7MA 2YPLD 4YC2C 4PUBL 4GMTL 1CFNA 3HKFA 3GUTA 3HUJA 5DTFB 1OM3H 3HMXL 2CRZA 1YMME 2CR6A 5FCUH 2Y07H 2VL5B 4L1HA 5GS1B 4BSWB 3GSNH 5ICXB 2CGRH 4FQXB 2W92A 2H8PA 1KSRA 4D9LL 5FXCH 5C0IA 1YJDL 5JQ6L 3LDBC 3S9DB 2V7HA 5E8NA 3U4EA 3DXAD 3BW9B 4KKCD 3IKCA 3EFFA 5GGUA 1ADQL 3TA3B 2GUOA 1RZFH 3WD5L 4RGNB 1ZT7A 3GGWA 3QIBD 1NQBA 4H0IA 5DJ0B 3C5SA 3ETBF 2FJFB 4CDHA 4YHPB 3U6RB 4Z7UE 4HKZB 1VEPA 2DAVA 3QIUA 1MQ8A 1D9KB 1T1YB 4CVWA 2BXZA 1BFOA 1V8HA 3M17A 4RMTA 1FO0B 3FHAA 5IBLD 2VE6A 3VWKB 4FXKB 2QL1A 4O51B 1CLYL 4LLVB 2V2TA 2CIKA 2Y5TB 5D5MA 1MCWM 1EMTH 1GRWA 5I18L 5EZJB 2VZSA 3VG9B 1G6RL 4ODVL 1J8HD 3BIKA 1EHLH 3CCHA 4ZFOA 2YUXA 2OQJB 4ORGB 1M6OA 1DUZA 4J8RB 1OHQA 3QDJA 1I1AC 1MI5E 3QIWA 4K2UH 3MOAL 4MCYA 5EO1B 3P11L 2EC8A 4MMXC 2NNAA 2ZNWA 4M1GL 3QUML 2IJ0C 3ULSA 2ITDA 1FNHA 1EO5A 2CLVB 3VGBA 3O3DA 4CDGC 4G9FE 5ADPH 1BAFH 2VUYA 2A6KB 3F5WA 4KRLB 2ESVA 3PNWB 1QFUL 2OS7A 5DJ0A 3AY4A 3IDJA 2BX5A 2K1MA 4HEPG 4X99A 4MCZA 1RHHA 2ICEA 3I85A 3GBNL 3BW9A 4TSBH 4BH7A 4MA1C 5DJZB 1OW0A 1HKLH 5HVFB 2V5RA 3J8F7 4X9IA 2O5YL 3WFEH 1KJ2A 2HKHH 2GJJA 3DUSB 2F58H 2FNBA 4UQ3B 1T4KB 4ZFFA 5I73B 1G9MH 1I7RB 5KSAB 4O4YL 4Z95L 3QIUD 5D6CB 2AGJH 3FB6A 1N7ML 3QCUL 4X7TB 5HHQB 1NSNH 2QR0A 3KS0J 1KJMB 1I8MA 3DURB 4NM4L 4WJ5B 5I8CB 1KXTB 3BGAA 5B39G 3AM8A 4P2RA 3UTTA 1P7QD 1C16B 1DUZB 1P4BL 3NACL 2C26A 1CFQA 5KTEL 4YXHH 3SKJL 5DQ9A 2FWOB 2O26U 2VR5A 2Y07L 2NX5E 4CADB 4JQIH 3SBWA 2AV7A 2R2BA 4PJ9C 5JXEA 4DW2L 4YHYC 1U3YA 1ERNA 3UPCA 4KXZI 3MR9B 4X9FA 4XNZC 1KB5A 5DUML 3WIHH 1IGYB 3KPRB 1ZS8B 3A67H 5KVGH 3QZWA 5EU5B 3X11B 4Q6IB 4F8TA 1AE6L 1F5WA 3TYGH 1KB5B 4F7TB 2B4CL 2GEEA 5DJAA 5BXFA 4N9OB 3SKNA 4JFPB 1CLOH 3BZFB 4PYHA 2CR3A 2B8OT 1XEDA 3MJ8A 5SWZA 2C7UB 2WWKO 5ALBL 1AR2A 3O6FB 3QIBB 3O9WB 2HT2C 5FYJH 1F8TL 4XPFH 4IIQC 1I8LA 4R9HA 4X7TA 4OGAD 4FQXC 4H1LB 3GJFB 5ITBH 3VW3L 4JHAH 5TQ2H 3GZKA 4UT6L 3IF1B 4WCYL 5E4EC 5TFSH 3WDHA 1NAKH 3F8UB 3HUJB 1REIA 3QEQD 3MROA 4MA8H 3E6HB 4K7PL 4RGNC 1VFBA 3OKOB 2YD3A 5K9JH 1CXKA 1J0ZA 3NFNA 4NSKB 2MPAL 4HX1A 3F65A 1LNUA 4CU6A 1JNLH 2IPKA 3MBXH 2WSKA 1IILE 1MI5A 2DQJH 3RKPA 3B2UC 4LVOC 4F7PB 2JELL 4P3DA 1R3LB 4NQSA 5CEZH 4E0RB 1CN4A 1RVFH 3F7RA 2O5YH 3WFEL 4NRZB 5JIHA 4APQA 1I9RH 2KPNA 4MJIA 4KVNL 3KPRA 4XVTL 1EDQA 2OJZL 1A9EB 2XWBB 2BRRL 3D2UD 4LRIC 5MERA 1L0XA 4X0KA 2VSDA 4JGJA 1G7HA 4KMTL 3N85H 5E8OA 2JJUA 3GDBA 5TPWH 4U1GC 4DWHA 5FGBC 1INDL 2GFBA 4JZNB 4ZUWA 2BNRA 1P69B 1DFBH 1IAOB 4M6NL 2BSSB 2YMXL 1YEKH 2YA0A 4JM2D 3MRNB 4IDLA 4P2RB 4MZ3A 3M1BA 4O51A 1CGXA 5C7XH 1AXSA 2ILLA 3WYRA 5B8CC 4HQQH 3H9YA 2HLFD 4Y2DC 3W2DL 3WNNA 1JWSB 2MTPA 4OBRA 3ZYJA 4P2OD 4WY7H 1DVFC 5SWZE 2R1XA 3AREA 1EJOH 5GGRB 5KANI 3B5HA 4NZJA 3NCCB 4BFIA 2QQNH 5BW7A 1S7UB 5DS8B 4M8QB 5A2IH 1CLOL 4Y4FC 5EN2A 3S5LB 2ERJB 3MV8D 3TVMB 3TO2B 4A6YL 1FNEB 4PRAA 5D70H 1P84K 3MBEA 2WBJB 4D9RE 1F2QA 1ZGLB 1YY9D 4KK8D 1NLDH 2HP4A 1MREH 3P0YH 2W59A 2ESVE 3GMPB 4HS3A 3DYPA 2C3XA 1XCTA 2DS4A 3RVWD 4LCUB 5JW3L 3INUL 1TENA 1C5BL 4U6XB 5E08H 1B0RA 3KPRD 5E2TL 5TQ2L 5T1MB 5KJRL 4G9DA 2UUDK 4P5MA 4NKDA 3PWUA 4FFWC 3W0WB 3QUYA 1HOCA 3PQYA 3SCMD 1RV6X 1MRCH 4TN9A 5DMKA 4YDIL 3P3YA 1HXMB 2CGRL 3OHXA 3SDAD 3LEVH 1HOCB 3OF6D 1GHFH 3C6LC 4L9LB 4U1SA 4YAQA 1ACZA 1PBYA 3RWGA 3OG6B 4YXLH 1KLGB 3JV0A 3VJ6B 3O8XC 1A02N 1HQRA 3AS2A 3BD5A 3D3VD 3KG5A 4M3JA 2A83B 3G5ZA 4JY4A 1WBXA 2EYRA 3NFSL 2ZSWB 1LE5A 3BPCA 1BIIA 1Q9KA 4JCMA 4KMQA 4B0MM 4NYLB 5SV3A 1NEZA 4X7DC 4LPWA 2DQEH 1Q1JH 3F7YA 1U41A 2PCPB 3MJ9A 3PDOB 1FNEA 4PRAB 1QBLH 5SX5H 4F9LC 4MX7A 1PG7H 4AK1A 4MQXC 4LLWB 4HAGA 4ZTOL 3SDDA 1NGXB 2WBJD 4HK3J 3KYOB 3OJMB 5T1KA 5AYQA 3TFKC 4CMHC 1ZGLM 3T77B 5C9JB 1XF1A 4XNQB 2VLKD 4Y16B 4ORZC 5KN5A 3NBNA 1GC1L 1OLLA 4NHCH 3O9WA 5EWIL 3T65B 2DQHH 5EOTB 1TPXC 5LAXB 3T0BA 5TDOB 4EDWL 3BP7A 2Z31A 1A2YA 4X6FA 5BV7B 5DHYA 5A3IC 4WU7B 4WWKB 1MEXL 4Y4HA 1MF2H 2XZCL 2GTZB 4Z18A 5CMAB 2F53E 4X6CA 3SDAA 3HZYA 1UFUA 4MXWL 1AHWA 4KK6D 2NY7H 2KZ1B 2OJZH 2CLZA 2A74A 43CAA 4XWOD 4CNIB 1MHHA 2JIXA 4DTGH 3BEWB 5FHBL 3S3PA 4PJAE 4R7NB 1OTTC 2BHUA 2VR9A 1R3LA 5HY9B 2IAMA 4HPYH 4S1RL 3HC3H 4K8RL 2BDNL 1W72L 3MREA 3GBLA 4ODHL 4U1JA 4KUZL 3ZSTA 1KPUA 8FABA 5DWUL 4NNYA 3MV7B 3S35H 4J2XA 2AXFA 5EU6D 4MA8L 3CFBA 3KJ6L 4PP2A 5IW6B 5B38G 1RZIA 2AJVL 1MNUH 2X4NB 1NGQL 3C5JA 4G9FB 2VN7A 1KIQB 1F02I 3A6BL 1KJ3H 1WIUA 1NBZA 3T77A 1YEGH 4KU1A 4QRTB 5AUMB 3L3HA 2D7TL 2ZJSH 1AGBA 3D6GA 1E4XL 3ZTNL 1C5DA 4OZ4A 1IEBA 3JWOC 2QQLL 4NP4H 1BQLL 2B5IB 3ULUF 2KQMA 3GNMH 4OKVB 2X4TB 5IESH 1KENL 4LLUB 3G08A 3RY6A 5BVJB 2HMID 3B8YA 3ULUD 3F6LA 4WHTB 4ZSOA 3DROA 1T66D 1TZIB 1OGAB 4HZLA 3GFUA 3C6LD 3QWRD 1M4KA 4MAYD 5DHVH 4OFDA 5LJYH 4RAVB 3ULSB 2VOTA 1MCHA 4GAYA 1IGIL 4JY5H 2C3GA 1A6WL 5DD1L 5JXAH 3REWB 3BAEL 1T83C 4PJ7A 4NO5B 4PJ5E 2GJ6A 4MB5A 4W4OC 5B22A 4GQPH 3C6LB 4P46C 4HXAH 1MAKA 5CP7B 1NBQA 1I7TA 5FDWA 1CD1A 3PP3H 5C0CB 4LEXL 4PLJD 3Q5YA 1EO8L 2XZCH 5I8CA 4AEEA 1R5WA 4UT7H 4KRPC 2DYPD 2H6PB 2AK4B 4LLMB 5HGDA 1FYTD 4WI9A 5D72H 1XR8A 1UZ6F 1G7QB 5IW3A 1URLA 4ENEC 3SDXE 4OJFL 2DJSA 2J3SA 3CDCA 2HKHL 3CNKA 4FFVD 3UBXA 4X6CB 2GITA 5J12B 4NC1C 3G08B 5HJ3B 1XAUA 3BPOC 4KVCH 4OM0H 1FZKA 4W4NA 4EI5B 5FA3A 2FEEL 2MCPH 3I9GH 1GC1C 3W82A 4LCYB 1EAPA 3QUMA 4PJXF 1IVLA 1EK3A 4U6HA 1F6AA 1SYVB 5EIQA 1QYGH 1JK8A 2Z92A 3QUYC 3TBWB 4EDWH 5F71A 4BSWA 1I8KA 1C1EH 1TETL 1U93B 5IF0B 2VDOL 1QFWL 1HINH 5C6TH 1JZ5A 5T1KB 1WIOA 1CXLA 1A5FL 1E6OH 1CFVH 3CZFA 2UYLB 5FYJL 1I3RB 1UM6H 2JF1A 1WV7T 4OLYH 1QBMH 1SJXA 3GI9H 1OPGL 4XZUA 5ESVB 1KPVA 4X6DF 3O3UN 2YA1A 4G8IA 4RCAA 1AP2B 4NO2A 4HDIA 4L4TA 4N5UA 5C0FB 4N5EC 1OAKL 5IQ7L 4ZDHA 1PG7L 5E8DL 2EDJA 1OSZA 3NGBC 5SWZD 1CU4H 3P77A 3NH7H 4LBEA 4OLXH 2J7LA 3EDEA 2EZ0C 1F2XK 4JFHE 3PWNB 1LO3H 1UCBH 3VXMB 4DZ8A 2HRLA 3EW3B 4OF8A 1KV3A 4J4PD 2EKSB 1CE1L 5CGTA 4F7PA 1GOHA 2J88L 4IIQA 4LVEA 2B4CC 4RNRA 4GKZA 1K5NA 1OT2A 3VXTB 2PYFA 2R1YB 4FFYH 1XGYH 3U36A 1SHMA 4JM2C 5JDJA 4R7DA 3SY0B 1SJVA 3HPJA 4YDIH 3W9DB 4OTXH 1JPSH 3JWDL 3QRGL 3CZFB 3PDDA 5DC4B 5I1IL 5ICZB 2EIZA 4N1HB 5BOZG 1CFBA 1S3KH 4HIJA 4P9HC 1BZ9B 1UXSA 1G9EA 3FO2B 3AXLB 4NZRH 1EFXA 3O11A 4LCWD 5HVGB 3JWOH 1DL7H 3HFMH 1MVUB 3SN6N 5MP6L 5J13B 4P3WA 5FHBH 2APVA 3QYCA 3BX7C 5FUOH 4OCSL 4Z7OE 2BERA 2EDFA 5JOPD 4JB9L 4BH7B 2NY7L 1M71A 5JDSB 4QHLB 5BS0D 1B9ZA 1GZPB 1TXKA 2D7MA 1NDGA 4DGYL 5F1NB 4AEIH 5C0AE 5T1LA 3EGSA 2HG5B 4DZBB 1A7BA 1D9KD 4HKJA 2HMIC 5K59F 4S1SH 2NY5L 5DEFA 4PJIE 4XPHL 3ARVA 3RJQB 4OFIA 4PJXE 3MGTA 4KTEH 3AC0A 5HHOD 3ARSA 1QUNA 3DVGB 2D03H 2HKFH 3LKPB 4OD1L 4U3CA 5D96B 4G6MH 4BQCA 5GZOC 3VGAC 3FFCE 4KGJA 3EO0A 1UKSA 2DICA 1A7QL 1VERA 2NYYD 4OZIB 1G9ML 3CXDL 3JUYA 4OAWB 2IPUK 4JAMA 3ARED 4LPXA 4NQXB 4EI5D 3NTCL 3TYFA 1UXWB 5FYKL 3QJHB 1ZT4B 4NO5A 5F7LB 1WLHA 5I16A 4LFHG 5ESQA 4WFHD 1QD0A 3M07A 1FE8H 1U42A 4UOW1 4XP5L 2Q8BH 4APQB 3JSSA 4B53A 3IXTB 4WWKD 3STZA 3BKML 1DE4A 5I0ZA 4X8XA 2EH7H 1TLKA 1OB1A 3V6OE 1XF5B 3BVNA 4JFOB 1N0XH 4P5KA 5ADPL 2BVTA 2WUBH 1I1AA 1X5AA