2JM4A

The solution nmr structure of the relaxin (rxfp1) receptor ldla module.
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
43
structure length
43
Chain Sequence
GSQDVKCSLGYFPCGNITKCLPQLLHCNGVDDCGNQADEDNCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The NMR solution structure of the relaxin (RXFP1) receptor lipoprotein receptor class A module and identification of key residues in the N-terminal region of the module that mediate receptor activation
pubmed doi rcsb
molecule keywords Relaxin receptor 1
molecule tags Signaling protein
source organism Homo sapiens
total genus 4
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 2jm4A00
1JRFA 1D2LA 2M7PA 2JM4A 2KNXA 2M0PA 2M96A 1LDRA 1CR8A 2FYLB 1LDLA 1F5YA 1XFEA 1J8EA 1N7DA 1K7BA 2I1PA 1D2JA 2FCWB 2KNYA 2LGPA 2FYJA
chains in the Genus database with same CATH superfamily
1JRFA 1D2LA 2M7PA 2JM4A 2KNXA 2M0PA 2M96A 1LDRA 1CR8A 2FYLB 1LDLA 1F5YA 1XFEA 1J8EA 1N7DA 1K7BA 2I1PA 1D2JA 2FCWB 2KNYA 2LGPA 2FYJA
chains in the Genus database with same CATH topology
1JRFA 1D2LA 2M7PA 2JM4A 2KNXA 2M0PA 2M96A 1LDRA 1CR8A 2FYLB 1LDLA 1F5YA 1XFEA 1J8EA 1N7DA 1K7BA 2I1PA 1D2JA 2FCWB 2KNYA 2LGPA 2FYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRF A;  1D2L A;  2M7P A;  2JM4 A;  2KNX A;  2M0P A;  2M96 A;  1LDR A;  1CR8 A;  2FYL B;  1LDL A;  1F5Y A;  1XFE A;  1J8E A;  1N7D A;  1K7B A;  2I1P A;  1D2J A;  2FCW B;  2KNY A;  2LGP A;  2FYJ A; 
#chains in the Genus database with same CATH topology
 1JRF A;  1D2L A;  2M7P A;  2JM4 A;  2KNX A;  2M0P A;  2M96 A;  1LDR A;  1CR8 A;  2FYL B;  1LDL A;  1F5Y A;  1XFE A;  1J8E A;  1N7D A;  1K7B A;  2I1P A;  1D2J A;  2FCW B;  2KNY A;  2LGP A;  2FYJ A; 
#chains in the Genus database with same CATH homology
 1JRF A;  1D2L A;  2M7P A;  2JM4 A;  2KNX A;  2M0P A;  2M96 A;  1LDR A;  1CR8 A;  2FYL B;  1LDL A;  1F5Y A;  1XFE A;  1J8E A;  1N7D A;  1K7B A;  2I1P A;  1D2J A;  2FCW B;  2KNY A;  2LGP A;  2FYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...