2JM8A

R21a spc-sh3 free
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
62
structure length
62
Chain Sequence
MDETGKELVLALYDYQEKSPAEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The high-resolution NMR structure of the R21A Spc-SH3:P41 complex: Understanding the determinants of binding affinity by comparison with Abl-SH3
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Spectrin alpha chain, brain
total genus 14
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jm8A00
2EBPA 1SSHA 1K0SA 2EYYA 2LNHB 2CT4A 2KROA 2C0OA 1AZGB 1X27A 2QDLA 2VKNA 2LQWA 3VS1A 5HCKA 2YSQA 3PVLA 1YWOA 4RTTA 2DILA 2XMFA 2LJ3A 1NEBA 2KXCA 1UJYA 4Z89A 1SEMA 3PVQA 1RLPC 3VS5A 2KNBB 5IHKA 2AKLA 3TSWA 2DBMA 1X2KA 2X3XD 3M0SA 1BK2A 1TUCA 2J6FA 2OAWA 4IIOA 4RTZA 4OMQA 2CH4A 2KRSA 1PRMC 2AK5A 5IXFA 4RTXA 2H8HA 1ZX6A 2L3PA 1CKBA 1VA7A 2A37A 3H0FA 4HVVA 4K11A 3KFVA 3H41A 4X1VA 1FYNA 2O2OA 2KRMA 3RBBB 1M30A 1X6BA 2BZ8A 3EG0A 4DEYA 2DRKA 1E6GA 5IHIA 2AZVA 1UTIA 2K6DA 1E7OA 1NM7A 3EHQA 1M3CA 1HD3A 2CH4W 1JXOA 1GCQC 1MUZA 4CC7A 2VWFA 1KJWA 4AFQC 1U5SA 2D1XA 1NG2A 2RF0A 1VYUA 1W70A 4ZNXA 1NYGA 4F14A 5GJVB 3QWYA 4OMPA 2DX1A 4RUGA 1WXTA 3I35A 3M0RA 4LN2A 1H92A 4AG1C 1W6XA 2J6OA 4Z8AA 4J9GA 2M51A 1JO8A 2EGEA 1Z9QA 2B86A 5FWBA 4OMNA 2V1QA 4JPBW 4M4ZA 2YT6A 1AWXA 2ABLA 2EYWA 2JXBA 3GBQA 4OMMA 3VS4A 2K79A 1YNZA 1FMKA 1U3OA 2EW3A 3I9QA 1SHGA 2DE0X 4DEXA 2FPDA 3NHNA 1QWFA 1YP5A 1BB9A 3M0PA 3NPFA 2YUOA 3EHRA 2EGCA 1M27C 2FRYA 1GFCA 1CKAA 2AKKA 2EYXA 1RLQC 2L2PA 4J9CA 4RTUA 3VS7A 2W10A 2G6FX 2MCNA 1GL5A 1T3SA 2OI3A 3RNJA 5L23A 2F2XA 1MV0B 1M8MA 1T3LA 4OMOA 1AVZC 1BU1A 1AOJA 2K2MA 2DL8A 1K9AA 1KFZA 1UE9A 3VRZA 2GNCA 1GBRA 4LNPA 1PRLC 4J9FA 2DRMA 1U06A 2BZXA 2GQIA 2F2VA 2A36A 5ECAA 1QWEA 3ULRB 1B3QA 2DL3A 4IIMA 1SHFA 2JTEA 2ECZA 2RN8A 1WLPB 1YCSB 1ABOA 1A0NB 1X6GA 2DVJA 2LMJA 2DMOA 2ED0A 1X2QA 1X43A 3THKA 1QKXA 1X69A 2PNIA 2ROTA 3QWXX 1PNJA 3EG3A 1UHFA 3CQTA 2FG0A 1ZLMA 3M0UA 3UATA 2LZ6B 1PKSA 1ZSGA 2GBQA 2FPFA 1QCFA 2HBWA 2FPEA 4LUEA 1YN8A 5FW9A 4E6RA 1GFDA 2EVRA 2J05A 3R6NA 1YWPA 2CDTA 2KE9A 4R0KA 2DLPA 1ABQA 1GCQA 4F16A 1B07A 4Z88A 2SRCA 4AFSC 2DF6A 1QKWA 1AWWA 4ORZA 2JT4A 4JZ3A 4RTYA 3C0CA 1NEGA 1JEGA 1K4US 5GJWB 4J9BA 1SRMA 2L3SA 2YUQA 1EFNA 3ZL7C 2P4RA 1WFWA 1NLOC 1K76A 1BBZA 1PWTA 4J9HA 3UF4A 2KEAA 1Z9ZA 2CREA 4CC4B 5I22A 2CSQA 4LE9A 5FWCA 2O9SA 2YDLA 2K9GA 1V1CA 3VRYA 4HXJA 2FEIA 2DM1A 2KT8A 2X3WD 4CC2A 2ESWA 1M3BA 4HVWA 1IO6A 1K0XA 2HEQA 1UUEA 5IHNA 4AG2C 1WIEA 2J06A 1I1JA 1WA7A 4D8DA 2L3QA 2VVKA 2ED1A 3I5RA 1NYFA 2J6KA 2FO0A 2CT3A 2GTOA 2SEMA 1SPKA 1QLYA 1WYXA 4GBQA 1VYVA 1W1FA 3NMZC 2CSIA 1JQQA 1NLPC 2JW4A 4RTWA 1K1ZA 2MIOA 2CUBA 2F2WA 1SRLA 2LJ1A 2DL5A 1T0JA 2GTJA 3FJ5A 4JJDA 1UHCA 2NWMA 2JS0A 2EKHA 2D0NA 2V1RA 1UDLA 4JJBA 1UECA 3O5ZA 2YUPA 2DYBA 2W0ZA 1JU5C 1ZUYA 1GRIA 1LCKA 2D8HA 4J9EA 1E6HA 2JM8A 4WCIA 3EG1A 3VS3A 1I07A 4J9DA 1G83A 3REBB 3EG2A 2ENMA 2RQRA 2KR3A 1HSQA 2J7IA 2O88A 3SHWA 1OEBA 1G2BA 4KRTA 3UA6A 1UG1A 2EPDA 2CUDA 3LH5A 1MV3A 1OOTA 1TUDA 4QT7A 2RQTA 2DNUA 4AFUC 2YUNA 2LP5A 1WXBA 1Y57A 2KXDA 1M3AA 2LJ0A 1RUWA 2O9VA 1KIKA 2BTTA 2AZSA 1Y0MA 1N5ZA 3TVTA 3I5SA 2LQNA 2DL7A 3EGUA 4HCKA 2EYZA 5EC7A 2L0AA 2RNAA 2RPNA 4F17A 2JMAA 1S1NA 2RMOA 2C0TA 3M0QA 3U23A 3VS0A 1PKTA 1AD5A 1UGVA 1XOVA 2PZ1A 1AZEA 1HJDA 2BZYA 1AWJA 2E5KA 2DL4A 2I0NA 2KBTA 1WXUA 2KGTA 1JXMA 2KYBA 3M0TA 2ROLA 1GCPA 2KT1A 1J3TA 2IIMA 3VS6A 1ZUUA 2HDAA 4LUDA 2MOXA 4CC3A 4J9IA 2A08A 2K3BA 4A63B 1AWOA 2EQIA 2OJ2A 5IXBA 2KRNA 2DA9A 1CSKA 2RQVA 2FRWA 4JJCA 2RQUA 3IQLA 1WI7A 2LCSA 1UJ0A 1GBQA 2DJQA 3H0IA 1OPLA 1VYTA 3NGPA 2JMCA 1UFFA 4JZ4A 3JV3A 1OV3A 1PHTA 2GGRA 3PE0A 4HVUA 4OMLA 4Y92A 1ZBJA 3VS2A 4GLMA 1TG0A 4AFZC 4ESRA 3SEMA 1ARKA 4EIKA 2EGAA 3H0HA 2RQWA 2JM9A 1WDXA 5IH2A 2C0IA 2PTKA 2LX7A 2DBKA 2K7AA 2HSPA 4D8KA 2KYMA 2O31A 1ZUKA 1RI9A 1H3HA 3REAB 1WX6A 2JS2A 1AEYA 5I11A 3UA7A 1H8KA 2A28A 1OPKA 1T0HA 4RTVA 3A98A 2M0YA 1KSWA 3TSZA 2NUZA 1I0CA 2D8JA 4FSSA 2HCKA
chains in the Genus database with same CATH superfamily
2KY9A 4KT0E 4BD3A 1UEBA 1K0SA 1SKUB 2EJGA 2EYYA 1JJ2S 4BDYA 3VS1A 5HCKA 3PVLA 3G71T 2ATCB 1F1BB 1ZBXA 5KCHA 3MEVA 2QQRA 2KXCA 2XK0A 1VQ9A 2JNGA 4C8QG 2DO3A 3CD6T 3TSWA 3CC4A 1X2KA 3M0SA 1QVFP 1IXDA 2OAWA 4LDWA 4EDUA 3PFSA 3F70A 1P92A 1Q7YR 3A1PA 1CKBA 2A37A 4IURA 5C0MA 5LJ5e 3KFVA 4IKFA 4X1VA 1YBYA 5FRNA 2KRMA 2RD1A 7AT1B 5LJ3d 3A8LB 3DB4A 3EG0A 4J5YA 5IHIA 2LQ8A 1BI1A 1IGUA 2K6DA 2XDBA 2DZCA 1G3WA 3LH0A 3EGXB 4DBHA 5GMKh 5GMKe 2CGHA 4R55A 4F7UG 3ME9A 1N8RC 5I2MA 3RMQA 5KYXB 2X51A 1RAAB 5FU7B 3VV0A 1IGQA 2CYZB 1NG2A 2NYSA 4OB1B 2K5FA 3MCAB 5GJVB 4OMPA 4PK4A 1M4ZA 2EGEA 3OMGA 5IN1A 4BB7A 1D09B 4OMNA 1YI2T 2QA4T 2EYWA 4OMMA 2HNIA 3CMAA 2K79A 1FMKA 1U3OA 2QA4A 1SHGA 2DE0X 4DEXA 3NHNA 4M75B 1QWFA 1YP5A 2AT1B 3NPFA 2VUBA 3V7SA 4L59A 4RTUA 2PUKB 1YI2Q 4GY5A 4UC4A 2MCNA 1RAHB 3RNJA 1MV0B 1NZ9A 3CC2T 4ZGJB 1X75C 3CCQT 3OS2A 1AVZC 2ZPFB 2OTJT 1K9AA 1Q7YU 1KFZA 3RKYA 4KULA 2ZPBB 2EFIA 2ZAEA 1C1AA 3A8MB 1JRIA 1TH7A 2XHCA 4J9FA 1XNIA 2BZXA 5GAOn 2GCXA 2F2VA 1QVFS 3UPUA 3VYHB 1IZ6A 1XTDA 4IIMA 2JTEA 4OF1A 4J6XA 5A0DA 3VKIA 1WNLA 1X6GA 2X35A 2DMOA 5DLQE 1X43A 5DM7R 2HZYA 2PNIA 2L3RA 3QWXX 5KCOA 1QVGA 1N8RU 1MMGA 4KH0B 2DJZA 2KVQG 2LZ6B 1PKSA 1ZSGA 4JLGA 2HBWA 3CC4T 1NBEB 1PG5B 2XDDA 4NL3A 1O9SA 2LNVA 3DB3A 3A8HB 4E6RA 1GFDA 2YRDA 1SSFA 2DLPA 2E12A 2X4YA 4EPCA 5KYUB 4N4GA 4Z88A 4XU2A 2SRCA 1G8XA 2R57A 1M2VB 2K3XA 1K73C 1AWWA 3JB9I 3ER0A 5EG2A 1SRMA 5CR2A 1WFWA 4IUQA 4PLIA 3H6ZA 5GAMj 1Z9ZA 2OTJA 1KC8U 2K5LA 2PU9B 2CSQA 5FWCA 1YHQT 4RCBA 2YDLA 2DD5A 2M16A 3EFSA 1MNEA 4HXJA 1YIJQ 3OYKA 4OMFB 2E6NA 1K0XA 1BYMA 1M90U 2HEQA 3PNWC 1K8AR 2PQWA 2L89A 3GNGA 1WIEA 4PJNA 2VB6A 1K9MU 2J06A 1I1JA 4D8DA 4ME7A 2BE9B 1R8OB 3NTIA 3CMAT 3I5RA 4C92E 1WGSA 2CT3A 5I21A 2YRVA 3G7ZA 2GTOA 2SEMA 2DZ9A 3JB9J 1FMVA 3VUBA 4C0DB 5GANj 1RL2A 4E7LA 3M54A 1LOJA 4TVRA 3MJXA 4HCCA 4FW2A 5GAN8 1K1ZA 4E7SA 1SRLA 3JCMW 2DL5A 4N0AC 1T0JA 1UHCA 1JB0E 2RJCA 1BIBA 4PJMA 4B9WA 3OYGA 2D0NA 1QVGP 2HQXA 5A0LA 2DYBA 2JVVA 1NJIR 1LCKA 2DPPB 1E6HA 3WXMB 1PD1A 3OYLA 4L5GA 3FIFA 4LXCA 1RABB 2A3LA 3CCUQ 3SWNC 3PMIA 3C95A 1OEBA 1G2BA 3UA6A 3CCVQ 3LH5A 3BE3A 4C5IA 1OQKA 3G6EQ 3MHXA 3JCMe 1RADB 5D6XA 3OB9A 2BTTA 1KC8C 3SB2A 2DYIA 2CZ1B 1YIJT 2XI9A 2GFUA 2LQNA 2QGGA 4DBRA 2DTIA 3CD6A 2RPNA 1MNDA 2RMOA 4M77D 3SFMA 3CCST 2LTOA 2L8DA 4DOVA 3JCMQ 1XOVA 1AZEA 5GAN2 2EQJA 3HKSA 1QQJA 2E5KA 2DL4A 3G71A 1ZQ1A 3QSUA 2KBTA 3QZ5B 3M59A 1GCPA 2KT1A 4M77C 2LCLA 1OI1A 2MAMA 2JTMA 2RH2A 1Q86R 4PJOE 3PMTA 5AYFA 3CC7Q 1WJQA 2K4YA 5C6SA 4RCCA 1CSKA 2HAXA 3UDCA 4BI3A 4HT9A 3IQLA 4IUTA 1UJ0A 1RAFB 5GAOl 3G71Q 4ZTFA 2KSSA 2QXFA 2WSEE 4M75A 4JS5A 2MMPA 1VQ6T 4M77A 1OV3A 2PUOB 2M02A 3PE0A 3HRTA 2QTXA 4OMLA 1ZBJA 2LVMA 2LT4A 2V8IA 4FW1A 3G6EA 4MDWA 3S6WA 3CCEQ 2R58A 4EIKA 4BE0A 2EKOA 3C4SA 2HQHA 2QQAA 3MO8A 2QEXA 1OZ3A 5IH2A 2PTKA 4LDXA 1EIFA 3HP9A 2K7AA 3OYIA 2MWOA 4EMHA 1H3HA 1KK7A 3FB9A 1H8KA 2A28A 4FYYB 3OYBA 1KSWA 4QQ6A 1W2BS 2RK2A 3MEWA 1VQNT 3RKWA 3RMSA 4NS5A 3J7AF 3RESA 3EG9B 2CZ7B 2CT4A 2KROA 2V26A 1RACB 5LJ5h 2YSQA 2EYQA 3WVEB 1YWOA 4XTWA 5KE3A 2DILA 2XMFA 2E1HA 2C06A 4RG2A 4M75E 1UJYA 4Z89A 1SEMA 2CP3A 3VS5A 3OYMA 3QXEB 5IHKA 2AIRB 2LRQA 2X3XD 1BK2A 3OYNA 1UGSB 4IIOA 1YCYA 4RTZA 3T9NA 2CH4A 3CCMA 3CCUT 4A53A 3CMEA 2RJFA 3L2ZA 2F69A 2E3IA 3A8GB 4QVDA 4HVVA 4OGEA 3QYGB 3H41A 3I55A 1FWZA 4HCBA 2BZ8A 4DEYA 4LD9K 1UTIA 3JCMP 5CKHA 1M3CA 1AT1B 3CCQQ 2RJDA 1JXOA 1GCQC 2FZKB 1X6OA 2JTFA 1VQ5Q 1I5OB 2VWFA 3CBOA 3L1AA 4DQ2A 3L2QA 1S72A 4BDZA 3TREA 4FT2A 2CZ0B 3QWYA 2OTLQ 1MHNA 2Y4YA 4LN2A 2WACA 4X9DA 1H92A 4AG1C 1W6XA 1VQNQ 1Q82R 4C5EA 5FU6B 3EFOA 2M51A 1JO8A 1Z9QA 2A7YA 4IUUA 4J6YA 1KQ2A 1D0ZA 1YIJA 5FWBA 3L2WA 3M5AA 1IHWA 2YT6A 1AWXA 3GBQA 1VQOT 2EWNA 2JXBA 1OULA 2X4XA 3C94A 3CC7T 3VS4A 1YNZA 2EW3A 3I9QA 2DD4A 4Y91A 4J6WA 5A0GA 1I4K1 2YUOA 5HY6A 2D6FA 1M27C 1JJ2P 1TXQA 2X4JA 4IUVA 3FEOA 3JCMc 1LJOA 1CKAA 2EYXA 1BI3A 1RLQC 2G6FX 3CCSQ 3SD4A 4C0FA 2I2LA 4JRKA 1N27A 3X25B 3L2UA 3P8DA 3CCET 2KI7A 3EGDA 1BU1A 3L42A 4HA8A 3EGXA 2DL8A 1VQMA 1MMDA 2H3JA 4Y28E 1GBRA 2GNCA 3QDRB 3G4SQ 5I2SA 1M90R 1U06A 2CP6A 1KHIA 1ZA1B 2GQIA 3GLXA 2FL7A 3QJ6A 4BE2A 3MEUA 1BI2A 2YHTA 1YJWA 1A0NB 2LMJA 5D6WA 3THKA 1VQLT 3CCLQ 3V8JA 2F5TX 2DIGA 3EG3A 5GAMf 2XU8A 2FG0A 1ZLMA 4FYXB 3EFOB 2GBQA 5LJ3h 1ZSZC 4HT8A 1YN8A 2RHZA 2ZCFB 5DLOA 2ZPGB 5FW9A 4M7DD 5GAN6 2EVRA 1R0CB 5CCAA 3OYFA 4C92C 3BW1A 1VQ8Q 4EMKA 1D1CA 1ABQA 2QI2A 5CIUA 3CCLA 3OS5A 3JRZA 4WTOB 4ORZA 4RTYA 3C0CA 3RKXA 1NEGA 1JEGA 1M90C 1EFNA 3ZL7C 2CP2A 2ZPEB 1EX4A 2VC8A 4BUGA 1K76A 4PJLA 1TU0B 1BIAA 1R77A 1RAGB 3HL8A 3GF5A 3GP8A 4LE9A 1YJNQ 2LCCA 3SWNB 1D1BA 3OY9A 2K9GA 1TSFA 3KXTA 3RERA 5HKCA 4LDVA 2KT8A 5KYNA 2X3WD 4YTLA 3ZBDA 5GAMd 5GMKj 2YWWA 2E64A 1V76A 5CQXA 2KQWA 4AG2C 1VQ4A 3V7CA 4QW2A 3M4GA 3LWIA 1VIFA 2ED1A 4C0GA 2FO0A 5CKDA 2VV5A 2ZPIB 1VQLQ 1SPKA 1KHCA 3MKDA 3LW5E 4QQDA 1WYXA 1Q86U 2YLBA 1VYVA 2CSIA 2CP0A 1YFNA 1M5Q1 1VQ8A 2DERA 3QZ9B 4PJOB 1W2BP 1Q7YC 1U1TA 2LJ1A 2FVUA 3VUZA 4QVCA 3HHTB 4J8OA 3BDUA 3OYJA 2JS0A 2EKHA 4ATOA 4JJBA 5LJ3e 3CBMA 2E70A 4CI0C 4M7AF 1FMWA 2W0ZA 1JU5C 1D3BA 4PFOA 2K5IA 2E6ZA 1N6AA 2E3HA 3EG1A 3QUIA 4ELZC 1I07A 2XICA 2QAZA 4J9DA 3REBB 4BI8B 1WJSA 3CC4Q 5GAOq 1HSQA 2XKOC 1MGQA 1K9MR 1VQ8T 4KRTA 2EPDA 1YJNA 2CUDA 4OB2B 1OOTA 2O4XA 4QT7A 3PT9A 4DOWA 4EMKB 2DNUA 2HL5C 1PSFA 3EAEA 1B7TA 5GMKm 4M7AD 3J81E 1RUWA 2O9VA 2EAYA 1VQOQ 3OBWA 4PJOA 2AZSA 1G3TA 3WVDB 4EMKC 1KQSA 4GLKA 1N5ZA 4M75D 3TEEA 5GANd 2L0AA 4F17A 1VUBA 2K2VA 1VQPT 4A4FA 3NTKA 2C0TA 3LWHA 1LNXA 5CAIA 3OS1A 1PKTA 2PZ1A 4J7IA 4JRQA 2EQUA 5LJ5f 1JXMA 2KYBA 2FZCB 1J3TA 1D0YA 2IIMA 1HYOA 3VS6A 3HFOA 2MYSA 2HDAA 4LUDA 3I56T 4C92F 4ELYC 4J9IA 1D1AA 4FIBA 2K3BA 4A63B 1AWOA 2OJ2A 1WQWA 5IXBA 5LJ5g 5IT9E 3CPWA 1W2BA 3DLMA 2E65A 4JJCA 4HCZA 4J7FA 3E9FA 2LCSA 1WI7A 1OU8A 3NGPA 1VYTA 2Y4XA 5M9OA 2MI6A 2HD0A 1UFFA 2L5QA 1KC8R 3JV3A 3JB9G 3M53A 3OBYA 1PHTA 2GGRA 1M1GA 2JN0A 3QKJA 2QK0A 1TTHB 3M56A 1TG0A 2XDPA 2E10A 4JS4A 3SEMA 2E41A 2EGAA 3H0HA 3HFNA 9ATCB 3CCRQ 4A4EA 2C0IA 3PIOA 2LX7A 2DBKA 4M7DC 1YJWQ 2HSPA 4XQ3A 5FROA 4Q5WA 1RI9A 4PL6A 2QYZA 3UA7A 8ATCB 1OPKA 1T0HA 1YHQQ 3M9QA 5AT1B 4XTUA 3TSZA 2D8JA 1WQ7A 4FSSA 2HCKA 1VQKA 1Q95G 2DEUA 2EBPA 5GMKl 1VQMT 4C8QC 5L8RE 1RAEB 5D7UA 4II1A 1AZGB 3M55A 1M1KR 1IB8A 3LGFA 1YITA 1VQ7A 2CP5A 1OU9A 5KH6A 3PVQA 1KQSP 3N5BB 2CS7A 2R5AA 5KYXA 3RIRA 3TQ7P 4FL6A 2F5KA 2FHDA 1QCOA 2M9UA 3MP8A 1TUCA 1V29B 4M7AE 4QQGA 2WSFE 4IUPA 2J6FA 4B9XA 5HK0A 3BDLA 1M8VA 5CO7A 3VJPA 4C8QB 5A2QE 3CC7A 1Y07A 2AK5A 5IXFA 4RTXA 4XK8E 2H8HA 4XU1A 4HKEA 1ZX6A 1FXXA 1ZSZA 5GAN5 1NPPA 4PFPA 3I55Q 2O2OA 3RBBB 3R6OA 1M30A 1X6BA 3JB9D 2AZVA 4O5VA 1E7OA 1NM7A 1HD3A 4MZTA 2LT1A 2ZPHB 4XTZA 3OQ5A 1VQPQ 4CRIA 3RDVA 1Y71A 2HMAA 2NUTA 4CC7A 4C0ZA 2FZGB 4AFQC 2D1XA 1WPYA 3JCMX 5GAMg 2KK4A 3CXCA 1VYUA 1W70A 1X01A 3LYIA 4ZNXA 4F14A 2K57A 4OGCA 4F7UE 4KGXB 2QQSA 1WXTA 2O4XB 3M0RA 4N4HA 2GQVA 4M7DG 2VXFA 3JCMJ 2B86A 2V1QA 4JPBW 1JJ2A 1XQHA 3CMET 1GXIE 3MP6A 3OYCA 4C0DC 3CCMT 4M7AA 4M7AC 2MK5A 1W4SA 3DKMA 3AHUA 2HKQB 3J80E 2IG0A 4C92B 3E19A 3KBGA 4RKUE 3M0PA 2CKKA 3QYHB 3JCMd 4M77B 4M7AG 1GFCA 2BKDN 4FCYA 1K8AU 1ZSZB 4J9CA 3CMEQ 5CVIA 4P5NA 2W10A 3GNFB 2OI3A 1O75A 3JSCA 4E7JA 4M78D 1M8MA 3CCJA 3E1SA 1LPLA 8AT1B 3AT1B 2FYKA 2D9TA 2MWPA 2BUDA 4ANJA 2P0KA 3VRZA 1VQNA 4LNPA 2EJ9A 3EH1A 5GAN7 1ACMB 3D7SB 1VQ7Q 1Q81U 3RUXA 1PD0A 3OS0A 1QWEA 3ULRB 1U8RA 2YRCA 1B3QA 2DL3A 3EFRA 2ECZA 3NFCA 1UGPB 1WLPB 1YJ9A 3S3OA 6AT1B 1X2QA 3H8ZA 1VOMA 1QKXA 1X69A 2LQKA 2ROTA 5GAN3 3GOXA 1C6VX 4E47A 1UHFA 3CQTA 3X28B 4LD6A 1N9SA 4N0AA 1D0XA 3UATA 3M0UA 2RK1A 2PVOB 3S3MA 2FPEA 4Z02A 2DXBA 2Y90A 4C8QF 2J05A 3CCRT 2CDTA 1I81A 1SF9A 1U1SA 2KE9A 2IVWA 1G3SA 4ZGEB 2JUFA 1VQ7T 1GCQA 4F16A 1B07A 1TS9A 4AFSC 2QASA 2DF6A 1VQ5A 5FRMA 2JT4A 4JZ3A 2ZZDA 1WJRA 2L3SA 2P4RA 2XD0A 1NLOC 1BBZA 3UF4A 4CC4B 2CREA 1VQ4Q 3PIPA 3FRNA 2O9SA 2RHYA 3FDRA 5GANf 5GAOm 3CC2Q 3EGDB 4N4IA 3JB9H 3VRYA 1TUGB 4F7UF 4M77G 4MMLA 4F04B 3CCSA 1K8AC 1MMAA 3A5ZB 1VQKQ 4CC2A 2ESWA 1M3BA 1KG1A 2VGNA 4KGZB 3V8LA 3E2UA 3X26B 3P8HA 1Q81R 1D3BB 1BCOA 4KUDK 2DAQA 2D0QB 3JCMh 4XAXB 2KDSA 3CEYA 5KYYB 3OYEA 2RHXA 3META 4OB0B 2HSEB 3RR6A 4XTXA 1Q81C 1W1FA 2YLCA 3NMZC 1YJ9Q 1JQQA 1AHJB 2P84A 1PC0A 2CUBA 1WHLA 2QQ9A 2LX9A 3X24B 5KYUA 3FJ5A 4JJDA 2PVDB 1WHMA 2NWMA 3I56A 5LL6S 1UECA 2YUPA 1M1FA 1ZUYA 5J26A 2D8HA 2QEXQ 2JM8A 3VS3A 3QO3A 1G83A 4FU6A 2KR3A 2YXYA 1IHVA 1BKBA 2J7IA 3SHWA 3CPFA 1UG1A 1VQPA 1MV3A 1TUDA 2RQTA 5LJ3f 5GAMe 3L2RA 3OA6A 5FU6C 4AFUC 1NE8A 3QPHA 2LP5A 2IPOB 4R56A 1G3YA 5CKBA 2LJ0A 2QA4Q 1KIKA 2DETA 5LJ3g 1Y0MA 1SG5A 3TVTA 3I5SA 3TCJA 2DL7A 2O01E 3EGUA 5EC7A 2HL3A 3MP1A 3JCMf 3M0QA 2WSCE 3U23A 4ZN1A 3O8VA 1UGVA 4BACA 3LGLA 1HJDA 4M75C 3HRSA 1AWJA 1YITT 2I0NA 2GF7A 1WXUA 2KGTA 2ROLA 5LJ3j 1ZA2B 4E7IA 1ZUUA 5CKFA 4ZN3A 2VXEA 2KRNA 4XTVA 4MZMA 2RQVA 3QG1A 4NL2A 4VUBA 2RQUA 4A54A 1Q86C 2GFAA 3TU4K 2JMCA 3V7RA 2DIQA 4JZ4A 4JDSA 4M78A 3DLLA 2DK3A 2BE7D 2RM4A 2B8AA 4GLMA 1YITQ 1VQ4T 3FC3A 4OVAA 4AFZC 2DXCA 1ARKA 3UT1A 4M7DB 2H3EB 2DVEA 3BFMA 1WDXA 4QKUA 1EZZB 3NTHA 2P4TA 2O31A 1ZUKA 2COWA 3REAB 1H3ZA 1AEYA 2P0PA 2XIDA 4E7HA 2JZ2A 1I5LA 3JB9F 4RTVA 3A98A 4JJNK 3HSBA 2M0YA 1PCXA 1QW1A 2NUZA 4C92G 1M2VA 1DJ7B 1I0CA 3LLRA 3C12A 4NOYA 1XJWB 3ZEHA 1SSHA 4M78G 1K9MC 4PFZA 2LNHB 1BI0A 4C5HA 2C0OA 1X27A 2QDLA 2VKNA 2LQWA 3CCQA 1HK9A 4XU0A 3CC2A 4M77E 4RTTA 2LJ3A 3CCLT 2V8JA 1NEBA 4PKCC 1HXDA 2DTHA 1RLPC 3MEAA 4KUIA 4M78E 2NUPA 2KNBB 4MDXA 2AKLA 4OB3B 2DBMA 3FJPA 2OAUA 3KUFA 4BI4A 4LDYA 3CXCP 4JRIA 5DY9A 3Q1JA 3M58A 1QCNA 4OMQA 2KRSA 1PRMC 1YI2A 1VQ6Q 1VQLA 2L3PA 4F7UB 1YJWT 1VA7A 3H0FA 4K11A 4A4KA 4F7UA 1FYNA 1YJNT 2DRKA 1E6GA 2COYA 1UGQB 3VU3C 4PJOD 5J3BA 2NLUA 3X20B 1OYXA 3EHQA 2CH4W 4DBQA 1M1KU 1TWBA 2E5QA 1MUZA 4FYWB 2QG9B 5GAN4 2RA2A 3CCEA 1KJWA 1U5SA 2RF0A 2RI5A 3G1JA 3JCMV 3A8OB 1NYGA 2DX1A 4RUGA 3I35A 4AMCA 1G5VA 1K73U 2J6OA 4Z8AA 5KE2A 4J9GA 3GIBA 2X4WA 4C8QE 5GMKi 4V2SA 2RHIA 2DKGA 4MMKA 3BY7A 1VIEA 5GANe 4M4ZA 4M7AB 2R5MA 2ABLA 1B34A 2P0QA 1VQOA 1R0BG 4B6MA 2FPDA 1NPRA 1BB9A 4JUVA 1N8RR 4DBFA 3EHRA 2EGCA 2FRYA 3QIIA 2AKKA 2L2PA 1VQ9T 3OYHA 1RAIB 3VS7A 1GL5A 1T3SA 1NJIU 5FU7C 2F2XA 5L23A 3CCJQ 3H9NA 3INZA 1T3LA 4OMOA 3CMAQ 2RI2A 1TOVA 3EH2A 4WF2A 1KQSS 1AOJA 4PLLA 2K2MA 5GANh 4EMGA 3PGGA 1UE9A 1PSEA 3GPLA 1K73R 1M1KC 1PRLC 2DRMA 4J83A 4BE1A 4E7ZA 1I8FA 3URGA 3CPWP 2A36A 5ECAA 5KYYA 4C5GA 4PJOC 4M7DF 1SHFA 2RN8A 2FB7A 3JCMb 1YCSB 1ABOA 4M75F 2DVJA 2ED0A 4C8QA 5CKEA 3EG9A 1PNJA 3FLGA 3CCUA 4BY6B 2QDYB 1IREB 1IRXA 2QQBA 3OW2S 1QVFA 2FPFA 1QCFA 2E4HA 3S3NA 4LUEA 3QDFA 5CQYA 3M57A 2A0FB 5KYWB 1Y96B 3OYYA 3R6NA 4DA4A 1YWPA 2EQKA 2COZA 3OW2A 2QGFB 4R0KA 1VQMQ 2DEQA 3QJYA 4A4HA 2VYTA 2G3RA 2RI3A 4M78F 1QKWA 2HQEA 4RMOA 4BY6C 1BCMA 2DFUA 3LX7A 2Z0WA 4LDUA 5GANg 1K4US 1OX8A 5GJWB 4J9BA 4PJJA 2YUQA 1Q82U 1H641 4QVZA 3OYAA 4L6V5 1PWTA 4J9HA 3QHSA 2KEAA 1MMNA 2MPXC 1VQ5T 4FT4A 5I22A 2V8KA 1C0MA 2XG8D 1V1CA 2K3YA 2BIVA 4M7DE 2OX7A 2FEIA 2DM1A 3MPUB 1QVPA 1RI0A 1KD1U 3CCRA 2VASA 2QEXT 4HVWA 3CCVT 3UWNA 4AT1B 1IO6A 3CBPA 5LJ5d 1NJIC 1UUEA 5IHNA 2CZ6B 2OTLA 3G6ET 2JOYA 1WA7A 3ZFJA 2DXUA 2L3QA 2VVKA 4C8QD 3I56Q 1N9RA 2VGMA 3G4SA 1LVKA 1NYFA 2J6KA 1VQ6A 1QLYA 3E9GA 1YJ9T 2EIFA 4GBQA 4M77F 1NLPC 3HTRA 2DXTA 2JW4A 1WZOA 4X34A 4XU3A 4RTWA 2MIOA 4A4GA 2EQMA 3CPWS 1Y7XA 1WHJA 2F2WA 2NUPB 1S72T 2GTJA 1UGRB 2JJ9A 4FM4B 3OYDA 5J39A 2V1RA 1UDLA 3O5ZA 3V8KA 1GRIA 4C92A 4J9EA 3CCJT 4WCIA 1PM3A 4KGVB 4RG8A 3JCMg 3OW2P 3EG2A 2ENMA 2RQRA 4M7DA 2O88A 4E2FB 4KBMB 3CD6Q 2PVGB 3I55T 2HKNA 2DTOA 5GAMh 2LC4A 1JBMA 2YUNA 3PTAA 1WXBA 1Y57A 4KH1B 2KXDA 1UB4A 5KYWA 1M3AA 1QP3A 3G4ST 2EJFA 2F1LA 4O6JA 5LJ5j 1WHKA 2RJEA 3QBYA 4D6WA 5GAOp 3HPWA 2OTLT 2M1HA 4C92D 2KMTA 2M0OA 2MF2A 5GAOr 1QVGS 3OSSC 1KD1R 4HCKA 2EYZA 2RNAA 3CCVA 2NUTB 2JMAA 1S1NA 3OMCA 3VS0A 1WHGA 3L2VA 1AD5A 1VQ9Q 2BZYA 5FLXE 4M78B 2KAFA 4MZPA 1FX7A 4ZTJA 1KD1C 3M0TA 2HBPA 4PJOG 1M9SA 4JRPA 2MOXA 3OSVA 4FSXA 4CC3A 1OX9A 2A08A 4JLIA 2X9HA 2EQIA 3CCMQ 2RO0A 2DA9A 2CP7A 3JAME 1B34B 2FRWA 2ZGWA 5CK9A 4OP0A 5D6YA 1Q82C 2QTVA 3ASKA 3H0IA 1GBQA 2DJQA 1ZHIA 1OPLA 4FYVB 4X9CA 4XTYA 1S72Q 2RHUA 4M78C 1OZ2A 4HVUA 3VYGA 1M2OA 4Y92A 4E7KA 3VS2A 4PNOA 2RB6A 4ESRA 4M75G 4ZGDB 5IAYA 3M4YA 1WHHA 2RQWA 2JM9A 1KQ1A 2LDMA 2AHJB 1QMCA 3SWNA 1Y96A 2OTJQ 4D8KA 2KYMA 1WX6A 5HK3A 2JS2A 5I11A 1YHQA 3CXCS 3P8BB 4PJOF 3HRUA 3SDZA 1QP2A 1VQKT
chains in the Genus database with same CATH topology
2EBPA 1SSHA 1K0SA 2EYYA 2LNHB 2CT4A 2KROA 2C0OA 1AZGB 1X27A 2QDLA 2VKNA 2LQWA 3VS1A 5HCKA 2YSQA 3PVLA 1YWOA 4RTTA 2DILA 2XMFA 2LJ3A 1NEBA 2KXCA 1UJYA 4Z89A 1SEMA 3PVQA 1RLPC 3VS5A 2KNBB 5IHKA 2AKLA 3TSWA 2DBMA 1X2KA 2X3XD 3M0SA 1BK2A 1TUCA 2J6FA 2OAWA 4IIOA 4RTZA 4OMQA 2CH4A 2KRSA 1PRMC 2AK5A 5IXFA 4RTXA 2H8HA 1ZX6A 2L3PA 1CKBA 1VA7A 2A37A 3H0FA 4HVVA 4K11A 3KFVA 3H41A 4X1VA 1FYNA 2O2OA 2KRMA 3RBBB 1M30A 1X6BA 2BZ8A 3EG0A 4DEYA 2DRKA 1E6GA 5IHIA 2AZVA 1UTIA 2K6DA 1E7OA 1NM7A 3EHQA 1M3CA 1HD3A 2CH4W 1JXOA 1GCQC 1MUZA 4CC7A 2VWFA 1KJWA 4AFQC 1U5SA 2D1XA 1NG2A 2RF0A 1VYUA 1W70A 4ZNXA 1NYGA 4F14A 5GJVB 3QWYA 4OMPA 2DX1A 4RUGA 1WXTA 3I35A 3M0RA 4LN2A 1H92A 4AG1C 1W6XA 2J6OA 4Z8AA 4J9GA 2M51A 1JO8A 2EGEA 1Z9QA 2B86A 5FWBA 4OMNA 2V1QA 4JPBW 4M4ZA 2YT6A 1AWXA 2ABLA 2EYWA 2JXBA 3GBQA 4OMMA 3VS4A 2K79A 1YNZA 1FMKA 1U3OA 2EW3A 3I9QA 1SHGA 2DE0X 4DEXA 2FPDA 3NHNA 1QWFA 1YP5A 1BB9A 3M0PA 3NPFA 2YUOA 3EHRA 2EGCA 1M27C 2FRYA 1GFCA 1CKAA 2AKKA 2EYXA 1RLQC 2L2PA 4J9CA 4RTUA 3VS7A 2W10A 2G6FX 2MCNA 1GL5A 1T3SA 2OI3A 3RNJA 5L23A 2F2XA 1MV0B 1M8MA 1T3LA 4OMOA 1AVZC 1BU1A 1AOJA 2K2MA 2DL8A 1K9AA 1KFZA 1UE9A 3VRZA 2GNCA 1GBRA 4LNPA 1PRLC 4J9FA 2DRMA 1U06A 2BZXA 2GQIA 2F2VA 2A36A 5ECAA 1QWEA 3ULRB 1B3QA 2DL3A 4IIMA 1SHFA 2JTEA 2ECZA 2RN8A 1WLPB 1YCSB 1ABOA 1A0NB 1X6GA 2DVJA 2LMJA 2DMOA 2ED0A 1X2QA 1X43A 3THKA 1QKXA 1X69A 2PNIA 2ROTA 3QWXX 1PNJA 3EG3A 1UHFA 3CQTA 2FG0A 1ZLMA 3M0UA 3UATA 2LZ6B 1PKSA 1ZSGA 2GBQA 2FPFA 1QCFA 2HBWA 2FPEA 4LUEA 1YN8A 5FW9A 4E6RA 1GFDA 2EVRA 2J05A 3R6NA 1YWPA 2CDTA 2KE9A 4R0KA 2DLPA 1ABQA 1GCQA 4F16A 1B07A 4Z88A 2SRCA 4AFSC 2DF6A 1QKWA 1AWWA 4ORZA 2JT4A 4JZ3A 4RTYA 3C0CA 1NEGA 1JEGA 1K4US 5GJWB 4J9BA 1SRMA 2L3SA 2YUQA 1EFNA 3ZL7C 2P4RA 1WFWA 1NLOC 1K76A 1BBZA 1PWTA 4J9HA 3UF4A 2KEAA 1Z9ZA 2CREA 4CC4B 5I22A 2CSQA 4LE9A 5FWCA 2O9SA 2YDLA 2K9GA 1V1CA 3VRYA 4HXJA 2FEIA 2DM1A 2KT8A 2X3WD 4CC2A 2ESWA 1M3BA 4HVWA 1IO6A 1K0XA 2HEQA 1UUEA 5IHNA 4AG2C 1WIEA 2J06A 1I1JA 1WA7A 4D8DA 2L3QA 2VVKA 2ED1A 3I5RA 1NYFA 2J6KA 2FO0A 2CT3A 2GTOA 2SEMA 1SPKA 1QLYA 1WYXA 4GBQA 1VYVA 1W1FA 3NMZC 2CSIA 1JQQA 1NLPC 2JW4A 4RTWA 1K1ZA 2MIOA 2CUBA 2F2WA 1SRLA 2LJ1A 2DL5A 1T0JA 2GTJA 3FJ5A 4JJDA 1UHCA 2NWMA 2JS0A 2EKHA 2D0NA 2V1RA 1UDLA 4JJBA 1UECA 3O5ZA 2YUPA 2DYBA 2W0ZA 1JU5C 1ZUYA 1GRIA 1LCKA 2D8HA 4J9EA 1E6HA 2JM8A 4WCIA 3EG1A 3VS3A 1I07A 4J9DA 1G83A 3REBB 3EG2A 2ENMA 2RQRA 2KR3A 1HSQA 2J7IA 2O88A 3SHWA 1OEBA 1G2BA 4KRTA 3UA6A 1UG1A 2EPDA 2CUDA 3LH5A 1MV3A 1OOTA 1TUDA 4QT7A 2RQTA 2DNUA 4AFUC 2YUNA 2LP5A 1WXBA 1Y57A 2KXDA 1M3AA 2LJ0A 1RUWA 2O9VA 1KIKA 2BTTA 2AZSA 1Y0MA 1N5ZA 3TVTA 3I5SA 2LQNA 2DL7A 3EGUA 4HCKA 2EYZA 5EC7A 2L0AA 2RNAA 2RPNA 4F17A 2JMAA 1S1NA 2RMOA 2C0TA 3M0QA 3U23A 3VS0A 1PKTA 1AD5A 1UGVA 1XOVA 2PZ1A 1AZEA 1HJDA 2BZYA 1AWJA 2E5KA 2DL4A 2I0NA 2KBTA 1WXUA 2KGTA 1JXMA 2KYBA 3M0TA 2ROLA 1GCPA 2KT1A 1J3TA 2IIMA 3VS6A 1ZUUA 2HDAA 4LUDA 2MOXA 4CC3A 4J9IA 2A08A 2K3BA 4A63B 1AWOA 2EQIA 2OJ2A 5IXBA 2KRNA 2DA9A 1CSKA 2RQVA 2FRWA 4JJCA 2RQUA 3IQLA 1WI7A 2LCSA 1UJ0A 1GBQA 2DJQA 3H0IA 1OPLA 1VYTA 3NGPA 2JMCA 1UFFA 4JZ4A 3JV3A 1OV3A 1PHTA 2GGRA 3PE0A 4HVUA 4OMLA 4Y92A 1ZBJA 3VS2A 4GLMA 1TG0A 4AFZC 4ESRA 3SEMA 1ARKA 4EIKA 2EGAA 3H0HA 2RQWA 2JM9A 1WDXA 5IH2A 2C0IA 2PTKA 2LX7A 2DBKA 2K7AA 2HSPA 4D8KA 2KYMA 2O31A 1ZUKA 1RI9A 1H3HA 3REAB 1WX6A 2JS2A 1AEYA 5I11A 3UA7A 1H8KA 2A28A 1OPKA 1T0HA 4RTVA 3A98A 2M0YA 1KSWA 3TSZA 2NUZA 1I0CA 2D8JA 4FSSA 2HCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EBP A;  1SSH A;  1K0S A;  2EYY A;  2LNH B;  2CT4 A;  2KRO A;  2C0O A;  1AZG B;  1X27 A;  2QDL A;  2VKN A;  2LQW A;  3VS1 A;  5HCK A;  2YSQ A;  3PVL A;  1YWO A;  4RTT A;  2DIL A;  2XMF A;  2LJ3 A;  1NEB A;  2KXC A;  1UJY A;  4Z89 A;  1SEM A;  3PVQ A;  1RLP C;  3VS5 A;  2KNB B;  5IHK A;  2AKL A;  3TSW A;  2DBM A;  1X2K A;  2X3X D;  3M0S A;  1BK2 A;  1TUC A;  2J6F A;  2OAW A;  4IIO A;  4RTZ A;  4OMQ A;  2CH4 A;  2KRS A;  1PRM C;  2AK5 A;  5IXF A;  4RTX A;  2H8H A;  1ZX6 A;  2L3P A;  1CKB A;  1VA7 A;  2A37 A;  3H0F A;  4HVV A;  4K11 A;  3KFV A;  3H41 A;  4X1V A;  1FYN A;  2O2O A;  2KRM A;  3RBB B;  1M30 A;  1X6B A;  2BZ8 A;  3EG0 A;  4DEY A;  2DRK A;  1E6G A;  5IHI A;  2AZV A;  1UTI A;  2K6D A;  1E7O A;  1NM7 A;  3EHQ A;  1M3C A;  1HD3 A;  2CH4 W;  1JXO A;  1GCQ C;  1MUZ A;  4CC7 A;  2VWF A;  1KJW A;  4AFQ C;  1U5S A;  2D1X A;  1NG2 A;  2RF0 A;  1VYU A;  1W70 A;  4ZNX A;  1NYG A;  4F14 A;  5GJV B;  3QWY A;  4OMP A;  2DX1 A;  4RUG A;  1WXT A;  3I35 A;  3M0R A;  4LN2 A;  1H92 A;  4AG1 C;  1W6X A;  2J6O A;  4Z8A A;  4J9G A;  2M51 A;  1JO8 A;  2EGE A;  1Z9Q A;  2B86 A;  5FWB A;  4OMN A;  2V1Q A;  4JPB W;  4M4Z A;  2YT6 A;  1AWX A;  2ABL A;  2EYW A;  2JXB A;  3GBQ A;  4OMM A;  3VS4 A;  2K79 A;  1YNZ A;  1FMK A;  1U3O A;  2EW3 A;  3I9Q A;  1SHG A;  2DE0 X;  4DEX A;  2FPD A;  3NHN A;  1QWF A;  1YP5 A;  1BB9 A;  3M0P A;  3NPF A;  2YUO A;  3EHR A;  2EGC A;  1M27 C;  2FRY A;  1GFC A;  1CKA A;  2AKK A;  2EYX A;  1RLQ C;  2L2P A;  4J9C A;  4RTU A;  3VS7 A;  2W10 A;  2G6F X;  2MCN A;  1GL5 A;  1T3S A;  2OI3 A;  3RNJ A;  5L23 A;  2F2X A;  1MV0 B;  1M8M A;  1T3L A;  4OMO A;  1AVZ C;  1BU1 A;  1AOJ A;  2K2M A;  2DL8 A;  1K9A A;  1KFZ A;  1UE9 A;  3VRZ A;  2GNC A;  1GBR A;  4LNP A;  1PRL C;  4J9F A;  2DRM A;  1U06 A;  2BZX A;  2GQI A;  2F2V A;  2A36 A;  5ECA A;  1QWE A;  3ULR B;  1B3Q A;  2DL3 A;  4IIM A;  1SHF A;  2JTE A;  2ECZ A;  2RN8 A;  1WLP B;  1YCS B;  1ABO A;  1A0N B;  1X6G A;  2DVJ A;  2LMJ A;  2DMO A;  2ED0 A;  1X2Q A;  1X43 A;  3THK A;  1QKX A;  1X69 A;  2PNI A;  2ROT A;  3QWX X;  1PNJ A;  3EG3 A;  1UHF A;  3CQT A;  2FG0 A;  1ZLM A;  3M0U A;  3UAT A;  2LZ6 B;  1PKS A;  1ZSG A;  2GBQ A;  2FPF A;  1QCF A;  2HBW A;  2FPE A;  4LUE A;  1YN8 A;  5FW9 A;  4E6R A;  1GFD A;  2EVR A;  2J05 A;  3R6N A;  1YWP A;  2CDT A;  2KE9 A;  4R0K A;  2DLP A;  1ABQ A;  1GCQ A;  4F16 A;  1B07 A;  4Z88 A;  2SRC A;  4AFS C;  2DF6 A;  1QKW A;  1AWW A;  4ORZ A;  2JT4 A;  4JZ3 A;  4RTY A;  3C0C A;  1NEG A;  1JEG A;  1K4U S;  5GJW B;  4J9B A;  1SRM A;  2L3S A;  2YUQ A;  1EFN A;  3ZL7 C;  2P4R A;  1WFW A;  1NLO C;  1K76 A;  1BBZ A;  1PWT A;  4J9H A;  3UF4 A;  2KEA A;  1Z9Z A;  2CRE A;  4CC4 B;  5I22 A;  2CSQ A;  4LE9 A;  5FWC A;  2O9S A;  2YDL A;  2K9G A;  1V1C A;  3VRY A;  4HXJ A;  2FEI A;  2DM1 A;  2KT8 A;  2X3W D;  4CC2 A;  2ESW A;  1M3B A;  4HVW A;  1IO6 A;  1K0X A;  2HEQ A;  1UUE A;  5IHN A;  4AG2 C;  1WIE A;  2J06 A;  1I1J A;  1WA7 A;  4D8D A;  2L3Q A;  2VVK A;  2ED1 A;  3I5R A;  1NYF A;  2J6K A;  2FO0 A;  2CT3 A;  2GTO A;  2SEM A;  1SPK A;  1QLY A;  1WYX A;  4GBQ A;  1VYV A;  1W1F A;  3NMZ C;  2CSI A;  1JQQ A;  1NLP C;  2JW4 A;  4RTW A;  1K1Z A;  2MIO A;  2CUB A;  2F2W A;  1SRL A;  2LJ1 A;  2DL5 A;  1T0J A;  2GTJ A;  3FJ5 A;  4JJD A;  1UHC A;  2NWM A;  2JS0 A;  2EKH A;  2D0N A;  2V1R A;  1UDL A;  4JJB A;  1UEC A;  3O5Z A;  2YUP A;  2DYB A;  2W0Z A;  1JU5 C;  1ZUY A;  1GRI A;  1LCK A;  2D8H A;  4J9E A;  1E6H A;  2JM8 A;  4WCI A;  3EG1 A;  3VS3 A;  1I07 A;  4J9D A;  1G83 A;  3REB B;  3EG2 A;  2ENM A;  2RQR A;  2KR3 A;  1HSQ A;  2J7I A;  2O88 A;  3SHW A;  1OEB A;  1G2B A;  4KRT A;  3UA6 A;  1UG1 A;  2EPD A;  2CUD A;  3LH5 A;  1MV3 A;  1OOT A;  1TUD A;  4QT7 A;  2RQT A;  2DNU A;  4AFU C;  2YUN A;  2LP5 A;  1WXB A;  1Y57 A;  2KXD A;  1M3A A;  2LJ0 A;  1RUW A;  2O9V A;  1KIK A;  2BTT A;  2AZS A;  1Y0M A;  1N5Z A;  3TVT A;  3I5S A;  2LQN A;  2DL7 A;  3EGU A;  4HCK A;  2EYZ A;  5EC7 A;  2L0A A;  2RNA A;  2RPN A;  4F17 A;  2JMA A;  1S1N A;  2RMO A;  2C0T A;  3M0Q A;  3U23 A;  3VS0 A;  1PKT A;  1AD5 A;  1UGV A;  1XOV A;  2PZ1 A;  1AZE A;  1HJD A;  2BZY A;  1AWJ A;  2E5K A;  2DL4 A;  2I0N A;  2KBT A;  1WXU A;  2KGT A;  1JXM A;  2KYB A;  3M0T A;  2ROL A;  1GCP A;  2KT1 A;  1J3T A;  2IIM A;  3VS6 A;  1ZUU A;  2HDA A;  4LUD A;  2MOX A;  4CC3 A;  4J9I A;  2A08 A;  2K3B A;  4A63 B;  1AWO A;  2EQI A;  2OJ2 A;  5IXB A;  2KRN A;  2DA9 A;  1CSK A;  2RQV A;  2FRW A;  4JJC A;  2RQU A;  3IQL A;  1WI7 A;  2LCS A;  1UJ0 A;  1GBQ A;  2DJQ A;  3H0I A;  1OPL A;  1VYT A;  3NGP A;  2JMC A;  1UFF A;  4JZ4 A;  3JV3 A;  1OV3 A;  1PHT A;  2GGR A;  3PE0 A;  4HVU A;  4OML A;  4Y92 A;  1ZBJ A;  3VS2 A;  4GLM A;  1TG0 A;  4AFZ C;  4ESR A;  3SEM A;  1ARK A;  4EIK A;  2EGA A;  3H0H A;  2RQW A;  2JM9 A;  1WDX A;  5IH2 A;  2C0I A;  2PTK A;  2LX7 A;  2DBK A;  2K7A A;  2HSP A;  4D8K A;  2KYM A;  2O31 A;  1ZUK A;  1RI9 A;  1H3H A;  3REA B;  1WX6 A;  2JS2 A;  1AEY A;  5I11 A;  3UA7 A;  1H8K A;  2A28 A;  1OPK A;  1T0H A;  4RTV A;  3A98 A;  2M0Y A;  1KSW A;  3TSZ A;  2NUZ A;  1I0C A;  2D8J A;  4FSS A;  2HCK A; 
#chains in the Genus database with same CATH topology
 2KY9 A;  4KT0 E;  4BD3 A;  1UEB A;  1K0S A;  1SKU B;  2EJG A;  2EYY A;  1JJ2 S;  4BDY A;  3VS1 A;  5HCK A;  3PVL A;  3G71 T;  2ATC B;  1F1B B;  1ZBX A;  5KCH A;  3MEV A;  2QQR A;  2KXC A;  2XK0 A;  1VQ9 A;  2JNG A;  4C8Q G;  2DO3 A;  3CD6 T;  3TSW A;  3CC4 A;  1X2K A;  3M0S A;  1QVF P;  1IXD A;  2OAW A;  4LDW A;  4EDU A;  3PFS A;  3F70 A;  1P92 A;  1Q7Y R;  3A1P A;  1CKB A;  2A37 A;  4IUR A;  5C0M A;  5LJ5 e;  3KFV A;  4IKF A;  4X1V A;  1YBY A;  5FRN A;  2KRM A;  2RD1 A;  7AT1 B;  5LJ3 d;  3A8L B;  3DB4 A;  3EG0 A;  4J5Y A;  5IHI A;  2LQ8 A;  1BI1 A;  1IGU A;  2K6D A;  2XDB A;  2DZC A;  1G3W A;  3LH0 A;  3EGX B;  4DBH A;  5GMK h;  5GMK e;  2CGH A;  4R55 A;  4F7U G;  3ME9 A;  1N8R C;  5I2M A;  3RMQ A;  5KYX B;  2X51 A;  1RAA B;  5FU7 B;  3VV0 A;  1IGQ A;  2CYZ B;  1NG2 A;  2NYS A;  4OB1 B;  2K5F A;  3MCA B;  5GJV B;  4OMP A;  4PK4 A;  1M4Z A;  2EGE A;  3OMG A;  5IN1 A;  4BB7 A;  1D09 B;  4OMN A;  1YI2 T;  2QA4 T;  2EYW A;  4OMM A;  2HNI A;  3CMA A;  2K79 A;  1FMK A;  1U3O A;  2QA4 A;  1SHG A;  2DE0 X;  4DEX A;  3NHN A;  4M75 B;  1QWF A;  1YP5 A;  2AT1 B;  3NPF A;  2VUB A;  3V7S A;  4L59 A;  4RTU A;  2PUK B;  1YI2 Q;  4GY5 A;  4UC4 A;  2MCN A;  1RAH B;  3RNJ A;  1MV0 B;  1NZ9 A;  3CC2 T;  4ZGJ B;  1X75 C;  3CCQ T;  3OS2 A;  1AVZ C;  2ZPF B;  2OTJ T;  1K9A A;  1Q7Y U;  1KFZ A;  3RKY A;  4KUL A;  2ZPB B;  2EFI A;  2ZAE A;  1C1A A;  3A8M B;  1JRI A;  1TH7 A;  2XHC A;  4J9F A;  1XNI A;  2BZX A;  5GAO n;  2GCX A;  2F2V A;  1QVF S;  3UPU A;  3VYH B;  1IZ6 A;  1XTD A;  4IIM A;  2JTE A;  4OF1 A;  4J6X A;  5A0D A;  3VKI A;  1WNL A;  1X6G A;  2X35 A;  2DMO A;  5DLQ E;  1X43 A;  5DM7 R;  2HZY A;  2PNI A;  2L3R A;  3QWX X;  5KCO A;  1QVG A;  1N8R U;  1MMG A;  4KH0 B;  2DJZ A;  2KVQ G;  2LZ6 B;  1PKS A;  1ZSG A;  4JLG A;  2HBW A;  3CC4 T;  1NBE B;  1PG5 B;  2XDD A;  4NL3 A;  1O9S A;  2LNV A;  3DB3 A;  3A8H B;  4E6R A;  1GFD A;  2YRD A;  1SSF A;  2DLP A;  2E12 A;  2X4Y A;  4EPC A;  5KYU B;  4N4G A;  4Z88 A;  4XU2 A;  2SRC A;  1G8X A;  2R57 A;  1M2V B;  2K3X A;  1K73 C;  1AWW A;  3JB9 I;  3ER0 A;  5EG2 A;  1SRM A;  5CR2 A;  1WFW A;  4IUQ A;  4PLI A;  3H6Z A;  5GAM j;  1Z9Z A;  2OTJ A;  1KC8 U;  2K5L A;  2PU9 B;  2CSQ A;  5FWC A;  1YHQ T;  4RCB A;  2YDL A;  2DD5 A;  2M16 A;  3EFS A;  1MNE A;  4HXJ A;  1YIJ Q;  3OYK A;  4OMF B;  2E6N A;  1K0X A;  1BYM A;  1M90 U;  2HEQ A;  3PNW C;  1K8A R;  2PQW A;  2L89 A;  3GNG A;  1WIE A;  4PJN A;  2VB6 A;  1K9M U;  2J06 A;  1I1J A;  4D8D A;  4ME7 A;  2BE9 B;  1R8O B;  3NTI A;  3CMA T;  3I5R A;  4C92 E;  1WGS A;  2CT3 A;  5I21 A;  2YRV A;  3G7Z A;  2GTO A;  2SEM A;  2DZ9 A;  3JB9 J;  1FMV A;  3VUB A;  4C0D B;  5GAN j;  1RL2 A;  4E7L A;  3M54 A;  1LOJ A;  4TVR A;  3MJX A;  4HCC A;  4FW2 A;  5GAN 8;  1K1Z A;  4E7S A;  1SRL A;  3JCM W;  2DL5 A;  4N0A C;  1T0J A;  1UHC A;  1JB0 E;  2RJC A;  1BIB A;  4PJM A;  4B9W A;  3OYG A;  2D0N A;  1QVG P;  2HQX A;  5A0L A;  2DYB A;  2JVV A;  1NJI R;  1LCK A;  2DPP B;  1E6H A;  3WXM B;  1PD1 A;  3OYL A;  4L5G A;  3FIF A;  4LXC A;  1RAB B;  2A3L A;  3CCU Q;  3SWN C;  3PMI A;  3C95 A;  1OEB A;  1G2B A;  3UA6 A;  3CCV Q;  3LH5 A;  3BE3 A;  4C5I A;  1OQK A;  3G6E Q;  3MHX A;  3JCM e;  1RAD B;  5D6X A;  3OB9 A;  2BTT A;  1KC8 C;  3SB2 A;  2DYI A;  2CZ1 B;  1YIJ T;  2XI9 A;  2GFU A;  2LQN A;  2QGG A;  4DBR A;  2DTI A;  3CD6 A;  2RPN A;  1MND A;  2RMO A;  4M77 D;  3SFM A;  3CCS T;  2LTO A;  2L8D A;  4DOV A;  3JCM Q;  1XOV A;  1AZE A;  5GAN 2;  2EQJ A;  3HKS A;  1QQJ A;  2E5K A;  2DL4 A;  3G71 A;  1ZQ1 A;  3QSU A;  2KBT A;  3QZ5 B;  3M59 A;  1GCP A;  2KT1 A;  4M77 C;  2LCL A;  1OI1 A;  2MAM A;  2JTM A;  2RH2 A;  1Q86 R;  4PJO E;  3PMT A;  5AYF A;  3CC7 Q;  1WJQ A;  2K4Y A;  5C6S A;  4RCC A;  1CSK A;  2HAX A;  3UDC A;  4BI3 A;  4HT9 A;  3IQL A;  4IUT A;  1UJ0 A;  1RAF B;  5GAO l;  3G71 Q;  4ZTF A;  2KSS A;  2QXF A;  2WSE E;  4M75 A;  4JS5 A;  2MMP A;  1VQ6 T;  4M77 A;  1OV3 A;  2PUO B;  2M02 A;  3PE0 A;  3HRT A;  2QTX A;  4OML A;  1ZBJ A;  2LVM A;  2LT4 A;  2V8I A;  4FW1 A;  3G6E A;  4MDW A;  3S6W A;  3CCE Q;  2R58 A;  4EIK A;  4BE0 A;  2EKO A;  3C4S A;  2HQH A;  2QQA A;  3MO8 A;  2QEX A;  1OZ3 A;  5IH2 A;  2PTK A;  4LDX A;  1EIF A;  3HP9 A;  2K7A A;  3OYI A;  2MWO A;  4EMH A;  1H3H A;  1KK7 A;  3FB9 A;  1H8K A;  2A28 A;  4FYY B;  3OYB A;  1KSW A;  4QQ6 A;  1W2B S;  2RK2 A;  3MEW A;  1VQN T;  3RKW A;  3RMS A;  4NS5 A;  3J7A F;  3RES A;  3EG9 B;  2CZ7 B;  2CT4 A;  2KRO A;  2V26 A;  1RAC B;  5LJ5 h;  2YSQ A;  2EYQ A;  3WVE B;  1YWO A;  4XTW A;  5KE3 A;  2DIL A;  2XMF A;  2E1H A;  2C06 A;  4RG2 A;  4M75 E;  1UJY A;  4Z89 A;  1SEM A;  2CP3 A;  3VS5 A;  3OYM A;  3QXE B;  5IHK A;  2AIR B;  2LRQ A;  2X3X D;  1BK2 A;  3OYN A;  1UGS B;  4IIO A;  1YCY A;  4RTZ A;  3T9N A;  2CH4 A;  3CCM A;  3CCU T;  4A53 A;  3CME A;  2RJF A;  3L2Z A;  2F69 A;  2E3I A;  3A8G B;  4QVD A;  4HVV A;  4OGE A;  3QYG B;  3H41 A;  3I55 A;  1FWZ A;  4HCB A;  2BZ8 A;  4DEY A;  4LD9 K;  1UTI A;  3JCM P;  5CKH A;  1M3C A;  1AT1 B;  3CCQ Q;  2RJD A;  1JXO A;  1GCQ C;  2FZK B;  1X6O A;  2JTF A;  1VQ5 Q;  1I5O B;  2VWF A;  3CBO A;  3L1A A;  4DQ2 A;  3L2Q A;  1S72 A;  4BDZ A;  3TRE A;  4FT2 A;  2CZ0 B;  3QWY A;  2OTL Q;  1MHN A;  2Y4Y A;  4LN2 A;  2WAC A;  4X9D A;  1H92 A;  4AG1 C;  1W6X A;  1VQN Q;  1Q82 R;  4C5E A;  5FU6 B;  3EFO A;  2M51 A;  1JO8 A;  1Z9Q A;  2A7Y A;  4IUU A;  4J6Y A;  1KQ2 A;  1D0Z A;  1YIJ A;  5FWB A;  3L2W A;  3M5A A;  1IHW A;  2YT6 A;  1AWX A;  3GBQ A;  1VQO T;  2EWN A;  2JXB A;  1OUL A;  2X4X A;  3C94 A;  3CC7 T;  3VS4 A;  1YNZ A;  2EW3 A;  3I9Q A;  2DD4 A;  4Y91 A;  4J6W A;  5A0G A;  1I4K 1;  2YUO A;  5HY6 A;  2D6F A;  1M27 C;  1JJ2 P;  1TXQ A;  2X4J A;  4IUV A;  3FEO A;  3JCM c;  1LJO A;  1CKA A;  2EYX A;  1BI3 A;  1RLQ C;  2G6F X;  3CCS Q;  3SD4 A;  4C0F A;  2I2L A;  4JRK A;  1N27 A;  3X25 B;  3L2U A;  3P8D A;  3CCE T;  2KI7 A;  3EGD A;  1BU1 A;  3L42 A;  4HA8 A;  3EGX A;  2DL8 A;  1VQM A;  1MMD A;  2H3J A;  4Y28 E;  1GBR A;  2GNC A;  3QDR B;  3G4S Q;  5I2S A;  1M90 R;  1U06 A;  2CP6 A;  1KHI A;  1ZA1 B;  2GQI A;  3GLX A;  2FL7 A;  3QJ6 A;  4BE2 A;  3MEU A;  1BI2 A;  2YHT A;  1YJW A;  1A0N B;  2LMJ A;  5D6W A;  3THK A;  1VQL T;  3CCL Q;  3V8J A;  2F5T X;  2DIG A;  3EG3 A;  5GAM f;  2XU8 A;  2FG0 A;  1ZLM A;  4FYX B;  3EFO B;  2GBQ A;  5LJ3 h;  1ZSZ C;  4HT8 A;  1YN8 A;  2RHZ A;  2ZCF B;  5DLO A;  2ZPG B;  5FW9 A;  4M7D D;  5GAN 6;  2EVR A;  1R0C B;  5CCA A;  3OYF A;  4C92 C;  3BW1 A;  1VQ8 Q;  4EMK A;  1D1C A;  1ABQ A;  2QI2 A;  5CIU A;  3CCL A;  3OS5 A;  3JRZ A;  4WTO B;  4ORZ A;  4RTY A;  3C0C A;  3RKX A;  1NEG A;  1JEG A;  1M90 C;  1EFN A;  3ZL7 C;  2CP2 A;  2ZPE B;  1EX4 A;  2VC8 A;  4BUG A;  1K76 A;  4PJL A;  1TU0 B;  1BIA A;  1R77 A;  1RAG B;  3HL8 A;  3GF5 A;  3GP8 A;  4LE9 A;  1YJN Q;  2LCC A;  3SWN B;  1D1B A;  3OY9 A;  2K9G A;  1TSF A;  3KXT A;  3RER A;  5HKC A;  4LDV A;  2KT8 A;  5KYN A;  2X3W D;  4YTL A;  3ZBD A;  5GAM d;  5GMK j;  2YWW A;  2E64 A;  1V76 A;  5CQX A;  2KQW A;  4AG2 C;  1VQ4 A;  3V7C A;  4QW2 A;  3M4G A;  3LWI A;  1VIF A;  2ED1 A;  4C0G A;  2FO0 A;  5CKD A;  2VV5 A;  2ZPI B;  1VQL Q;  1SPK A;  1KHC A;  3MKD A;  3LW5 E;  4QQD A;  1WYX A;  1Q86 U;  2YLB A;  1VYV A;  2CSI A;  2CP0 A;  1YFN A;  1M5Q 1;  1VQ8 A;  2DER A;  3QZ9 B;  4PJO B;  1W2B P;  1Q7Y C;  1U1T A;  2LJ1 A;  2FVU A;  3VUZ A;  4QVC A;  3HHT B;  4J8O A;  3BDU A;  3OYJ A;  2JS0 A;  2EKH A;  4ATO A;  4JJB A;  5LJ3 e;  3CBM A;  2E70 A;  4CI0 C;  4M7A F;  1FMW A;  2W0Z A;  1JU5 C;  1D3B A;  4PFO A;  2K5I A;  2E6Z A;  1N6A A;  2E3H A;  3EG1 A;  3QUI A;  4ELZ C;  1I07 A;  2XIC A;  2QAZ A;  4J9D A;  3REB B;  4BI8 B;  1WJS A;  3CC4 Q;  5GAO q;  1HSQ A;  2XKO C;  1MGQ A;  1K9M R;  1VQ8 T;  4KRT A;  2EPD A;  1YJN A;  2CUD A;  4OB2 B;  1OOT A;  2O4X A;  4QT7 A;  3PT9 A;  4DOW A;  4EMK B;  2DNU A;  2HL5 C;  1PSF A;  3EAE A;  1B7T A;  5GMK m;  4M7A D;  3J81 E;  1RUW A;  2O9V A;  2EAY A;  1VQO Q;  3OBW A;  4PJO A;  2AZS A;  1G3T A;  3WVD B;  4EMK C;  1KQS A;  4GLK A;  1N5Z A;  4M75 D;  3TEE A;  5GAN d;  2L0A A;  4F17 A;  1VUB A;  2K2V A;  1VQP T;  4A4F A;  3NTK A;  2C0T A;  3LWH A;  1LNX A;  5CAI A;  3OS1 A;  1PKT A;  2PZ1 A;  4J7I A;  4JRQ A;  2EQU A;  5LJ5 f;  1JXM A;  2KYB A;  2FZC B;  1J3T A;  1D0Y A;  2IIM A;  1HYO A;  3VS6 A;  3HFO A;  2MYS A;  2HDA A;  4LUD A;  3I56 T;  4C92 F;  4ELY C;  4J9I A;  1D1A A;  4FIB A;  2K3B A;  4A63 B;  1AWO A;  2OJ2 A;  1WQW A;  5IXB A;  5LJ5 g;  5IT9 E;  3CPW A;  1W2B A;  3DLM A;  2E65 A;  4JJC A;  4HCZ A;  4J7F A;  3E9F A;  2LCS A;  1WI7 A;  1OU8 A;  3NGP A;  1VYT A;  2Y4X A;  5M9O A;  2MI6 A;  2HD0 A;  1UFF A;  2L5Q A;  1KC8 R;  3JV3 A;  3JB9 G;  3M53 A;  3OBY A;  1PHT A;  2GGR A;  1M1G A;  2JN0 A;  3QKJ A;  2QK0 A;  1TTH B;  3M56 A;  1TG0 A;  2XDP A;  2E10 A;  4JS4 A;  3SEM A;  2E41 A;  2EGA A;  3H0H A;  3HFN A;  9ATC B;  3CCR Q;  4A4E A;  2C0I A;  3PIO A;  2LX7 A;  2DBK A;  4M7D C;  1YJW Q;  2HSP A;  4XQ3 A;  5FRO A;  4Q5W A;  1RI9 A;  4PL6 A;  2QYZ A;  3UA7 A;  8ATC B;  1OPK A;  1T0H A;  1YHQ Q;  3M9Q A;  5AT1 B;  4XTU A;  3TSZ A;  2D8J A;  1WQ7 A;  4FSS A;  2HCK A;  1VQK A;  1Q95 G;  2DEU A;  2EBP A;  5GMK l;  1VQM T;  4C8Q C;  5L8R E;  1RAE B;  5D7U A;  4II1 A;  1AZG B;  3M55 A;  1M1K R;  1IB8 A;  3LGF A;  1YIT A;  1VQ7 A;  2CP5 A;  1OU9 A;  5KH6 A;  3PVQ A;  1KQS P;  3N5B B;  2CS7 A;  2R5A A;  5KYX A;  3RIR A;  3TQ7 P;  4FL6 A;  2F5K A;  2FHD A;  1QCO A;  2M9U A;  3MP8 A;  1TUC A;  1V29 B;  4M7A E;  4QQG A;  2WSF E;  4IUP A;  2J6F A;  4B9X A;  5HK0 A;  3BDL A;  1M8V A;  5CO7 A;  3VJP A;  4C8Q B;  5A2Q E;  3CC7 A;  1Y07 A;  2AK5 A;  5IXF A;  4RTX A;  4XK8 E;  2H8H A;  4XU1 A;  4HKE A;  1ZX6 A;  1FXX A;  1ZSZ A;  5GAN 5;  1NPP A;  4PFP A;  3I55 Q;  2O2O A;  3RBB B;  3R6O A;  1M30 A;  1X6B A;  3JB9 D;  2AZV A;  4O5V A;  1E7O A;  1NM7 A;  1HD3 A;  4MZT A;  2LT1 A;  2ZPH B;  4XTZ A;  3OQ5 A;  1VQP Q;  4CRI A;  3RDV A;  1Y71 A;  2HMA A;  2NUT A;  4CC7 A;  4C0Z A;  2FZG B;  4AFQ C;  2D1X A;  1WPY A;  3JCM X;  5GAM g;  2KK4 A;  3CXC A;  1VYU A;  1W70 A;  1X01 A;  3LYI A;  4ZNX A;  4F14 A;  2K57 A;  4OGC A;  4F7U E;  4KGX B;  2QQS A;  1WXT A;  2O4X B;  3M0R A;  4N4H A;  2GQV A;  4M7D G;  2VXF A;  3JCM J;  2B86 A;  2V1Q A;  4JPB W;  1JJ2 A;  1XQH A;  3CME T;  1GXI E;  3MP6 A;  3OYC A;  4C0D C;  3CCM T;  4M7A A;  4M7A C;  2MK5 A;  1W4S A;  3DKM A;  3AHU A;  2HKQ B;  3J80 E;  2IG0 A;  4C92 B;  3E19 A;  3KBG A;  4RKU E;  3M0P A;  2CKK A;  3QYH B;  3JCM d;  4M77 B;  4M7A G;  1GFC A;  2BKD N;  4FCY A;  1K8A U;  1ZSZ B;  4J9C A;  3CME Q;  5CVI A;  4P5N A;  2W10 A;  3GNF B;  2OI3 A;  1O75 A;  3JSC A;  4E7J A;  4M78 D;  1M8M A;  3CCJ A;  3E1S A;  1LPL A;  8AT1 B;  3AT1 B;  2FYK A;  2D9T A;  2MWP A;  2BUD A;  4ANJ A;  2P0K A;  3VRZ A;  1VQN A;  4LNP A;  2EJ9 A;  3EH1 A;  5GAN 7;  1ACM B;  3D7S B;  1VQ7 Q;  1Q81 U;  3RUX A;  1PD0 A;  3OS0 A;  1QWE A;  3ULR B;  1U8R A;  2YRC A;  1B3Q A;  2DL3 A;  3EFR A;  2ECZ A;  3NFC A;  1UGP B;  1WLP B;  1YJ9 A;  3S3O A;  6AT1 B;  1X2Q A;  3H8Z A;  1VOM A;  1QKX A;  1X69 A;  2LQK A;  2ROT A;  5GAN 3;  3GOX A;  1C6V X;  4E47 A;  1UHF A;  3CQT A;  3X28 B;  4LD6 A;  1N9S A;  4N0A A;  1D0X A;  3UAT A;  3M0U A;  2RK1 A;  2PVO B;  3S3M A;  2FPE A;  4Z02 A;  2DXB A;  2Y90 A;  4C8Q F;  2J05 A;  3CCR T;  2CDT A;  1I81 A;  1SF9 A;  1U1S A;  2KE9 A;  2IVW A;  1G3S A;  4ZGE B;  2JUF A;  1VQ7 T;  1GCQ A;  4F16 A;  1B07 A;  1TS9 A;  4AFS C;  2QAS A;  2DF6 A;  1VQ5 A;  5FRM A;  2JT4 A;  4JZ3 A;  2ZZD A;  1WJR A;  2L3S A;  2P4R A;  2XD0 A;  1NLO C;  1BBZ A;  3UF4 A;  4CC4 B;  2CRE A;  1VQ4 Q;  3PIP A;  3FRN A;  2O9S A;  2RHY A;  3FDR A;  5GAN f;  5GAO m;  3CC2 Q;  3EGD B;  4N4I A;  3JB9 H;  3VRY A;  1TUG B;  4F7U F;  4M77 G;  4MML A;  4F04 B;  3CCS A;  1K8A C;  1MMA A;  3A5Z B;  1VQK Q;  4CC2 A;  2ESW A;  1M3B A;  1KG1 A;  2VGN A;  4KGZ B;  3V8L A;  3E2U A;  3X26 B;  3P8H A;  1Q81 R;  1D3B B;  1BCO A;  4KUD K;  2DAQ A;  2D0Q B;  3JCM h;  4XAX B;  2KDS A;  3CEY A;  5KYY B;  3OYE A;  2RHX A;  3MET A;  4OB0 B;  2HSE B;  3RR6 A;  4XTX A;  1Q81 C;  1W1F A;  2YLC A;  3NMZ C;  1YJ9 Q;  1JQQ A;  1AHJ B;  2P84 A;  1PC0 A;  2CUB A;  1WHL A;  2QQ9 A;  2LX9 A;  3X24 B;  5KYU A;  3FJ5 A;  4JJD A;  2PVD B;  1WHM A;  2NWM A;  3I56 A;  5LL6 S;  1UEC A;  2YUP A;  1M1F A;  1ZUY A;  5J26 A;  2D8H A;  2QEX Q;  2JM8 A;  3VS3 A;  3QO3 A;  1G83 A;  4FU6 A;  2KR3 A;  2YXY A;  1IHV A;  1BKB A;  2J7I A;  3SHW A;  3CPF A;  1UG1 A;  1VQP A;  1MV3 A;  1TUD A;  2RQT A;  5LJ3 f;  5GAM e;  3L2R A;  3OA6 A;  5FU6 C;  4AFU C;  1NE8 A;  3QPH A;  2LP5 A;  2IPO B;  4R56 A;  1G3Y A;  5CKB A;  2LJ0 A;  2QA4 Q;  1KIK A;  2DET A;  5LJ3 g;  1Y0M A;  1SG5 A;  3TVT A;  3I5S A;  3TCJ A;  2DL7 A;  2O01 E;  3EGU A;  5EC7 A;  2HL3 A;  3MP1 A;  3JCM f;  3M0Q A;  2WSC E;  3U23 A;  4ZN1 A;  3O8V A;  1UGV A;  4BAC A;  3LGL A;  1HJD A;  4M75 C;  3HRS A;  1AWJ A;  1YIT T;  2I0N A;  2GF7 A;  1WXU A;  2KGT A;  2ROL A;  5LJ3 j;  1ZA2 B;  4E7I A;  1ZUU A;  5CKF A;  4ZN3 A;  2VXE A;  2KRN A;  4XTV A;  4MZM A;  2RQV A;  3QG1 A;  4NL2 A;  4VUB A;  2RQU A;  4A54 A;  1Q86 C;  2GFA A;  3TU4 K;  2JMC A;  3V7R A;  2DIQ A;  4JZ4 A;  4JDS A;  4M78 A;  3DLL A;  2DK3 A;  2BE7 D;  2RM4 A;  2B8A A;  4GLM A;  1YIT Q;  1VQ4 T;  3FC3 A;  4OVA A;  4AFZ C;  2DXC A;  1ARK A;  3UT1 A;  4M7D B;  2H3E B;  2DVE A;  3BFM A;  1WDX A;  4QKU A;  1EZZ B;  3NTH A;  2P4T A;  2O31 A;  1ZUK A;  2COW A;  3REA B;  1H3Z A;  1AEY A;  2P0P A;  2XID A;  4E7H A;  2JZ2 A;  1I5L A;  3JB9 F;  4RTV A;  3A98 A;  4JJN K;  3HSB A;  2M0Y A;  1PCX A;  1QW1 A;  2NUZ A;  4C92 G;  1M2V A;  1DJ7 B;  1I0C A;  3LLR A;  3C12 A;  4NOY A;  1XJW B;  3ZEH A;  1SSH A;  4M78 G;  1K9M C;  4PFZ A;  2LNH B;  1BI0 A;  4C5H A;  2C0O A;  1X27 A;  2QDL A;  2VKN A;  2LQW A;  3CCQ A;  1HK9 A;  4XU0 A;  3CC2 A;  4M77 E;  4RTT A;  2LJ3 A;  3CCL T;  2V8J A;  1NEB A;  4PKC C;  1HXD A;  2DTH A;  1RLP C;  3MEA A;  4KUI A;  4M78 E;  2NUP A;  2KNB B;  4MDX A;  2AKL A;  4OB3 B;  2DBM A;  3FJP A;  2OAU A;  3KUF A;  4BI4 A;  4LDY A;  3CXC P;  4JRI A;  5DY9 A;  3Q1J A;  3M58 A;  1QCN A;  4OMQ A;  2KRS A;  1PRM C;  1YI2 A;  1VQ6 Q;  1VQL A;  2L3P A;  4F7U B;  1YJW T;  1VA7 A;  3H0F A;  4K11 A;  4A4K A;  4F7U A;  1FYN A;  1YJN T;  2DRK A;  1E6G A;  2COY A;  1UGQ B;  3VU3 C;  4PJO D;  5J3B A;  2NLU A;  3X20 B;  1OYX A;  3EHQ A;  2CH4 W;  4DBQ A;  1M1K U;  1TWB A;  2E5Q A;  1MUZ A;  4FYW B;  2QG9 B;  5GAN 4;  2RA2 A;  3CCE A;  1KJW A;  1U5S A;  2RF0 A;  2RI5 A;  3G1J A;  3JCM V;  3A8O B;  1NYG A;  2DX1 A;  4RUG A;  3I35 A;  4AMC A;  1G5V A;  1K73 U;  2J6O A;  4Z8A A;  5KE2 A;  4J9G A;  3GIB A;  2X4W A;  4C8Q E;  5GMK i;  4V2S A;  2RHI A;  2DKG A;  4MMK A;  3BY7 A;  1VIE A;  5GAN e;  4M4Z A;  4M7A B;  2R5M A;  2ABL A;  1B34 A;  2P0Q A;  1VQO A;  1R0B G;  4B6M A;  2FPD A;  1NPR A;  1BB9 A;  4JUV A;  1N8R R;  4DBF A;  3EHR A;  2EGC A;  2FRY A;  3QII A;  2AKK A;  2L2P A;  1VQ9 T;  3OYH A;  1RAI B;  3VS7 A;  1GL5 A;  1T3S A;  1NJI U;  5FU7 C;  2F2X A;  5L23 A;  3CCJ Q;  3H9N A;  3INZ A;  1T3L A;  4OMO A;  3CMA Q;  2RI2 A;  1TOV A;  3EH2 A;  4WF2 A;  1KQS S;  1AOJ A;  4PLL A;  2K2M A;  5GAN h;  4EMG A;  3PGG A;  1UE9 A;  1PSE A;  3GPL A;  1K73 R;  1M1K C;  1PRL C;  2DRM A;  4J83 A;  4BE1 A;  4E7Z A;  1I8F A;  3URG A;  3CPW P;  2A36 A;  5ECA A;  5KYY A;  4C5G A;  4PJO C;  4M7D F;  1SHF A;  2RN8 A;  2FB7 A;  3JCM b;  1YCS B;  1ABO A;  4M75 F;  2DVJ A;  2ED0 A;  4C8Q A;  5CKE A;  3EG9 A;  1PNJ A;  3FLG A;  3CCU A;  4BY6 B;  2QDY B;  1IRE B;  1IRX A;  2QQB A;  3OW2 S;  1QVF A;  2FPF A;  1QCF A;  2E4H A;  3S3N A;  4LUE A;  3QDF A;  5CQY A;  3M57 A;  2A0F B;  5KYW B;  1Y96 B;  3OYY A;  3R6N A;  4DA4 A;  1YWP A;  2EQK A;  2COZ A;  3OW2 A;  2QGF B;  4R0K A;  1VQM Q;  2DEQ A;  3QJY A;  4A4H A;  2VYT A;  2G3R A;  2RI3 A;  4M78 F;  1QKW A;  2HQE A;  4RMO A;  4BY6 C;  1BCM A;  2DFU A;  3LX7 A;  2Z0W A;  4LDU A;  5GAN g;  1K4U S;  1OX8 A;  5GJW B;  4J9B A;  4PJJ A;  2YUQ A;  1Q82 U;  1H64 1;  4QVZ A;  3OYA A;  4L6V 5;  1PWT A;  4J9H A;  3QHS A;  2KEA A;  1MMN A;  2MPX C;  1VQ5 T;  4FT4 A;  5I22 A;  2V8K A;  1C0M A;  2XG8 D;  1V1C A;  2K3Y A;  2BIV A;  4M7D E;  2OX7 A;  2FEI A;  2DM1 A;  3MPU B;  1QVP A;  1RI0 A;  1KD1 U;  3CCR A;  2VAS A;  2QEX T;  4HVW A;  3CCV T;  3UWN A;  4AT1 B;  1IO6 A;  3CBP A;  5LJ5 d;  1NJI C;  1UUE A;  5IHN A;  2CZ6 B;  2OTL A;  3G6E T;  2JOY A;  1WA7 A;  3ZFJ A;  2DXU A;  2L3Q A;  2VVK A;  4C8Q D;  3I56 Q;  1N9R A;  2VGM A;  3G4S A;  1LVK A;  1NYF A;  2J6K A;  1VQ6 A;  1QLY A;  3E9G A;  1YJ9 T;  2EIF A;  4GBQ A;  4M77 F;  1NLP C;  3HTR A;  2DXT A;  2JW4 A;  1WZO A;  4X34 A;  4XU3 A;  4RTW A;  2MIO A;  4A4G A;  2EQM A;  3CPW S;  1Y7X A;  1WHJ A;  2F2W A;  2NUP B;  1S72 T;  2GTJ A;  1UGR B;  2JJ9 A;  4FM4 B;  3OYD A;  5J39 A;  2V1R A;  1UDL A;  3O5Z A;  3V8K A;  1GRI A;  4C92 A;  4J9E A;  3CCJ T;  4WCI A;  1PM3 A;  4KGV B;  4RG8 A;  3JCM g;  3OW2 P;  3EG2 A;  2ENM A;  2RQR A;  4M7D A;  2O88 A;  4E2F B;  4KBM B;  3CD6 Q;  2PVG B;  3I55 T;  2HKN A;  2DTO A;  5GAM h;  2LC4 A;  1JBM A;  2YUN A;  3PTA A;  1WXB A;  1Y57 A;  4KH1 B;  2KXD A;  1UB4 A;  5KYW A;  1M3A A;  1QP3 A;  3G4S T;  2EJF A;  2F1L A;  4O6J A;  5LJ5 j;  1WHK A;  2RJE A;  3QBY A;  4D6W A;  5GAO p;  3HPW A;  2OTL T;  2M1H A;  4C92 D;  2KMT A;  2M0O A;  2MF2 A;  5GAO r;  1QVG S;  3OSS C;  1KD1 R;  4HCK A;  2EYZ A;  2RNA A;  3CCV A;  2NUT B;  2JMA A;  1S1N A;  3OMC A;  3VS0 A;  1WHG A;  3L2V A;  1AD5 A;  1VQ9 Q;  2BZY A;  5FLX E;  4M78 B;  2KAF A;  4MZP A;  1FX7 A;  4ZTJ A;  1KD1 C;  3M0T A;  2HBP A;  4PJO G;  1M9S A;  4JRP A;  2MOX A;  3OSV A;  4FSX A;  4CC3 A;  1OX9 A;  2A08 A;  4JLI A;  2X9H A;  2EQI A;  3CCM Q;  2RO0 A;  2DA9 A;  2CP7 A;  3JAM E;  1B34 B;  2FRW A;  2ZGW A;  5CK9 A;  4OP0 A;  5D6Y A;  1Q82 C;  2QTV A;  3ASK A;  3H0I A;  1GBQ A;  2DJQ A;  1ZHI A;  1OPL A;  4FYV B;  4X9C A;  4XTY A;  1S72 Q;  2RHU A;  4M78 C;  1OZ2 A;  4HVU A;  3VYG A;  1M2O A;  4Y92 A;  4E7K A;  3VS2 A;  4PNO A;  2RB6 A;  4ESR A;  4M75 G;  4ZGD B;  5IAY A;  3M4Y A;  1WHH A;  2RQW A;  2JM9 A;  1KQ1 A;  2LDM A;  2AHJ B;  1QMC A;  3SWN A;  1Y96 A;  2OTJ Q;  4D8K A;  2KYM A;  1WX6 A;  5HK3 A;  2JS2 A;  5I11 A;  1YHQ A;  3CXC S;  3P8B B;  4PJO F;  3HRU A;  3SDZ A;  1QP2 A;  1VQK T; 
#chains in the Genus database with same CATH homology
 2EBP A;  1SSH A;  1K0S A;  2EYY A;  2LNH B;  2CT4 A;  2KRO A;  2C0O A;  1AZG B;  1X27 A;  2QDL A;  2VKN A;  2LQW A;  3VS1 A;  5HCK A;  2YSQ A;  3PVL A;  1YWO A;  4RTT A;  2DIL A;  2XMF A;  2LJ3 A;  1NEB A;  2KXC A;  1UJY A;  4Z89 A;  1SEM A;  3PVQ A;  1RLP C;  3VS5 A;  2KNB B;  5IHK A;  2AKL A;  3TSW A;  2DBM A;  1X2K A;  2X3X D;  3M0S A;  1BK2 A;  1TUC A;  2J6F A;  2OAW A;  4IIO A;  4RTZ A;  4OMQ A;  2CH4 A;  2KRS A;  1PRM C;  2AK5 A;  5IXF A;  4RTX A;  2H8H A;  1ZX6 A;  2L3P A;  1CKB A;  1VA7 A;  2A37 A;  3H0F A;  4HVV A;  4K11 A;  3KFV A;  3H41 A;  4X1V A;  1FYN A;  2O2O A;  2KRM A;  3RBB B;  1M30 A;  1X6B A;  2BZ8 A;  3EG0 A;  4DEY A;  2DRK A;  1E6G A;  5IHI A;  2AZV A;  1UTI A;  2K6D A;  1E7O A;  1NM7 A;  3EHQ A;  1M3C A;  1HD3 A;  2CH4 W;  1JXO A;  1GCQ C;  1MUZ A;  4CC7 A;  2VWF A;  1KJW A;  4AFQ C;  1U5S A;  2D1X A;  1NG2 A;  2RF0 A;  1VYU A;  1W70 A;  4ZNX A;  1NYG A;  4F14 A;  5GJV B;  3QWY A;  4OMP A;  2DX1 A;  4RUG A;  1WXT A;  3I35 A;  3M0R A;  4LN2 A;  1H92 A;  4AG1 C;  1W6X A;  2J6O A;  4Z8A A;  4J9G A;  2M51 A;  1JO8 A;  2EGE A;  1Z9Q A;  2B86 A;  5FWB A;  4OMN A;  2V1Q A;  4JPB W;  4M4Z A;  2YT6 A;  1AWX A;  2ABL A;  2EYW A;  2JXB A;  3GBQ A;  4OMM A;  3VS4 A;  2K79 A;  1YNZ A;  1FMK A;  1U3O A;  2EW3 A;  3I9Q A;  1SHG A;  2DE0 X;  4DEX A;  2FPD A;  3NHN A;  1QWF A;  1YP5 A;  1BB9 A;  3M0P A;  3NPF A;  2YUO A;  3EHR A;  2EGC A;  1M27 C;  2FRY A;  1GFC A;  1CKA A;  2AKK A;  2EYX A;  1RLQ C;  2L2P A;  4J9C A;  4RTU A;  3VS7 A;  2W10 A;  2G6F X;  2MCN A;  1GL5 A;  1T3S A;  2OI3 A;  3RNJ A;  5L23 A;  2F2X A;  1MV0 B;  1M8M A;  1T3L A;  4OMO A;  1AVZ C;  1BU1 A;  1AOJ A;  2K2M A;  2DL8 A;  1K9A A;  1KFZ A;  1UE9 A;  3VRZ A;  2GNC A;  1GBR A;  4LNP A;  1PRL C;  4J9F A;  2DRM A;  1U06 A;  2BZX A;  2GQI A;  2F2V A;  2A36 A;  5ECA A;  1QWE A;  3ULR B;  1B3Q A;  2DL3 A;  4IIM A;  1SHF A;  2JTE A;  2ECZ A;  2RN8 A;  1WLP B;  1YCS B;  1ABO A;  1A0N B;  1X6G A;  2DVJ A;  2LMJ A;  2DMO A;  2ED0 A;  1X2Q A;  1X43 A;  3THK A;  1QKX A;  1X69 A;  2PNI A;  2ROT A;  3QWX X;  1PNJ A;  3EG3 A;  1UHF A;  3CQT A;  2FG0 A;  1ZLM A;  3M0U A;  3UAT A;  2LZ6 B;  1PKS A;  1ZSG A;  2GBQ A;  2FPF A;  1QCF A;  2HBW A;  2FPE A;  4LUE A;  1YN8 A;  5FW9 A;  4E6R A;  1GFD A;  2EVR A;  2J05 A;  3R6N A;  1YWP A;  2CDT A;  2KE9 A;  4R0K A;  2DLP A;  1ABQ A;  1GCQ A;  4F16 A;  1B07 A;  4Z88 A;  2SRC A;  4AFS C;  2DF6 A;  1QKW A;  1AWW A;  4ORZ A;  2JT4 A;  4JZ3 A;  4RTY A;  3C0C A;  1NEG A;  1JEG A;  1K4U S;  5GJW B;  4J9B A;  1SRM A;  2L3S A;  2YUQ A;  1EFN A;  3ZL7 C;  2P4R A;  1WFW A;  1NLO C;  1K76 A;  1BBZ A;  1PWT A;  4J9H A;  3UF4 A;  2KEA A;  1Z9Z A;  2CRE A;  4CC4 B;  5I22 A;  2CSQ A;  4LE9 A;  5FWC A;  2O9S A;  2YDL A;  2K9G A;  1V1C A;  3VRY A;  4HXJ A;  2FEI A;  2DM1 A;  2KT8 A;  2X3W D;  4CC2 A;  2ESW A;  1M3B A;  4HVW A;  1IO6 A;  1K0X A;  2HEQ A;  1UUE A;  5IHN A;  4AG2 C;  1WIE A;  2J06 A;  1I1J A;  1WA7 A;  4D8D A;  2L3Q A;  2VVK A;  2ED1 A;  3I5R A;  1NYF A;  2J6K A;  2FO0 A;  2CT3 A;  2GTO A;  2SEM A;  1SPK A;  1QLY A;  1WYX A;  4GBQ A;  1VYV A;  1W1F A;  3NMZ C;  2CSI A;  1JQQ A;  1NLP C;  2JW4 A;  4RTW A;  1K1Z A;  2MIO A;  2CUB A;  2F2W A;  1SRL A;  2LJ1 A;  2DL5 A;  1T0J A;  2GTJ A;  3FJ5 A;  4JJD A;  1UHC A;  2NWM A;  2JS0 A;  2EKH A;  2D0N A;  2V1R A;  1UDL A;  4JJB A;  1UEC A;  3O5Z A;  2YUP A;  2DYB A;  2W0Z A;  1JU5 C;  1ZUY A;  1GRI A;  1LCK A;  2D8H A;  4J9E A;  1E6H A;  2JM8 A;  4WCI A;  3EG1 A;  3VS3 A;  1I07 A;  4J9D A;  1G83 A;  3REB B;  3EG2 A;  2ENM A;  2RQR A;  2KR3 A;  1HSQ A;  2J7I A;  2O88 A;  3SHW A;  1OEB A;  1G2B A;  4KRT A;  3UA6 A;  1UG1 A;  2EPD A;  2CUD A;  3LH5 A;  1MV3 A;  1OOT A;  1TUD A;  4QT7 A;  2RQT A;  2DNU A;  4AFU C;  2YUN A;  2LP5 A;  1WXB A;  1Y57 A;  2KXD A;  1M3A A;  2LJ0 A;  1RUW A;  2O9V A;  1KIK A;  2BTT A;  2AZS A;  1Y0M A;  1N5Z A;  3TVT A;  3I5S A;  2LQN A;  2DL7 A;  3EGU A;  4HCK A;  2EYZ A;  5EC7 A;  2L0A A;  2RNA A;  2RPN A;  4F17 A;  2JMA A;  1S1N A;  2RMO A;  2C0T A;  3M0Q A;  3U23 A;  3VS0 A;  1PKT A;  1AD5 A;  1UGV A;  1XOV A;  2PZ1 A;  1AZE A;  1HJD A;  2BZY A;  1AWJ A;  2E5K A;  2DL4 A;  2I0N A;  2KBT A;  1WXU A;  2KGT A;  1JXM A;  2KYB A;  3M0T A;  2ROL A;  1GCP A;  2KT1 A;  1J3T A;  2IIM A;  3VS6 A;  1ZUU A;  2HDA A;  4LUD A;  2MOX A;  4CC3 A;  4J9I A;  2A08 A;  2K3B A;  4A63 B;  1AWO A;  2EQI A;  2OJ2 A;  5IXB A;  2KRN A;  2DA9 A;  1CSK A;  2RQV A;  2FRW A;  4JJC A;  2RQU A;  3IQL A;  1WI7 A;  2LCS A;  1UJ0 A;  1GBQ A;  2DJQ A;  3H0I A;  1OPL A;  1VYT A;  3NGP A;  2JMC A;  1UFF A;  4JZ4 A;  3JV3 A;  1OV3 A;  1PHT A;  2GGR A;  3PE0 A;  4HVU A;  4OML A;  4Y92 A;  1ZBJ A;  3VS2 A;  4GLM A;  1TG0 A;  4AFZ C;  4ESR A;  3SEM A;  1ARK A;  4EIK A;  2EGA A;  3H0H A;  2RQW A;  2JM9 A;  1WDX A;  5IH2 A;  2C0I A;  2PTK A;  2LX7 A;  2DBK A;  2K7A A;  2HSP A;  4D8K A;  2KYM A;  2O31 A;  1ZUK A;  1RI9 A;  1H3H A;  3REA B;  1WX6 A;  2JS2 A;  1AEY A;  5I11 A;  3UA7 A;  1H8K A;  2A28 A;  1OPK A;  1T0H A;  4RTV A;  3A98 A;  2M0Y A;  1KSW A;  3TSZ A;  2NUZ A;  1I0C A;  2D8J A;  4FSS A;  2HCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...