2JM8A

R21a spc-sh3 free
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
62
structure length
62
Chain Sequence
MDETGKELVLALYDYQEKSPAEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title The high-resolution NMR structure of the R21A Spc-SH3:P41 complex: Understanding the determinants of binding affinity by comparison with Abl-SH3
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 14
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jm8A00
2DE0X 4JPBW 1OPLA 2O31A 1GCQA 3CQTA 2RQRA 2EYXA 1TUCA 2YUOA 1HSQA 2DRMA 3KFVA 3UATA 2SRCA 1W1FA 2LCSA 2VKNA 1WXUA 2RMOA 2CUDA 2JM8A 2JTEA 4RTUA 1GBQA 4A63B 3C0CA 2ED0A 2HDAA 1SHFA 2L3QA 4M4ZA 1SSHA 1QWEA 2RPNA 4LUEA 2J6KA 2HSPA 2ED1A 3VS5A 2DBKA 3EG1A 2AKKA 1EFNA 3TSZA 2KR3A 4CC2A 1K76A 2EYWA 4LUDA 3I35A 5GJVB 1NEGA 1JEGA 1G83A 2HCKA 1NLOC 1UE9A 1BK2A 2AK5A 2M0YA 1YP5A 4EIKA 2W0ZA 1KSWA 1V1CA 4FSSA 2AZVA 3H0HA 3PVQA 2BTTA 2SEMA 5L23A 1ZLMA 1UDLA 1X2QA 1X6BA 2A08A 2FEIA 2V1QA 1WLPB 1Y0MA 3M0SA 3VRYA 2KRSA 5GJWB 4RTTA 1WA7A 1GCQC 4Z8AA 2K2MA 2K3BA 1FYNA 2KEAA 4Z89A 1BB9A 2EBPA 3IQLA 4CC4B 3I5RA 3I5SA 1AEYA 1NM7A 1T0HA 2JMAA 2DF6A 1K0SA 1SRLA 2XMFA 2LQNA 3LH5A 3EGUA 4GBQA 2CH4A 2EYYA 2EGEA 2J6FA 2PZ1A 1K0XA 1ABOA 2J05A 2DVJA 3EHQA 4AG1C 2D0NA 1X69A 1JO8A 1WX6A 2X3WD 2OJ2A 3A98A 2KYMA 1ZUKA 3TSWA 1IO6A 2B86A 2JS0A 1U3OA 3ZL7C 4JJCA 1W6XA 5FWBA 1NYGA 2VWFA 2LJ3A 4J9HA 2I0NA 1GRIA 1AWOA 1PWTA 2AKLA 4ZNXA 3PE0A 2GGRA 1XOVA 2JXBA 2VVKA 2ROLA 3VS7A 1G2BA 4J9GA 2DL7A 4E6RA 2YT6A 4RTXA 2EW3A 1UECA 1ZX6A 3R6NA 1UHCA 2KE9A 1W70A 2ROTA 2P4RA 4J9FA 1T3LA 1VA7A 3NPFA 1K1ZA 2K9GA 4RUGA 1HJDA 1K4US 1X43A 3H0FA 4Z88A 1E6HA 2A36A 1B3QA 4CC3A 1PKSA 2ECZA 2FRWA 4OMPA 1YWOA 2MCNA 2NUZA 2LX7A 4AFQC 2BZXA 2W10A 2L3SA 4DEXA 2CDTA 2FPEA 5ECAA 2PNIA 2CREA 1YNZA 2AZSA 2LQWA 3THKA 2DYBA 2YUNA 2O9VA 1HD3A 4WCIA 1ABQA 2EPDA 2L0AA 3EHRA 5I22A 4X1VA 2FPFA 1RUWA 2DA9A 2IIMA 2RF0A 3SHWA 4ORZA 1SHGA 4GLMA 1ZBJA 2EGCA 2L2PA 2F2WA 3VS0A 1X2KA 1GCPA 3M0PA 2HBWA 1WIEA 1U06A 1QKXA 1M8MA 1VYVA 3U23A 4OMQA 1LCKA 4OMNA 2DM1A 1N5ZA 3H41A 5IH2A 4RTZA 1UGVA 4JZ4A 1Z9ZA 2KNBB 4R0KA 4F16A 1Y57A 1PRMC 3ULRB 3UA7A 4JZ3A 1WYXA 2V1RA 4LE9A 4JJDA 5IHNA 3EG2A 1ZSGA 2EKHA 2DL4A 2K6DA 2LZ6B 3NHNA 2GTJA 2F2VA 1CKAA 1SRMA 2C0TA 1AWWA 4DEYA 2X3XD 2J06A 1GFCA 3VS1A 5I11A 2QDLA 1CKBA 3O5ZA 1M3BA 2JT4A 2KXCA 2KXDA 1UTIA 1WDXA 1GL5A 1YN8A 2O88A 5FWCA 2D1XA 2DJQA 5HCKA 4IIOA 1UUEA 2BZYA 1JQQA 1VYTA 1RLQC 5IXBA 1M3AA 3FJ5A 4K11A 2DMOA 1UHFA 2A28A 2CT3A 1M27C 1NYFA 1H3HA 2RQTA 2O2OA 2LNHB 1K9AA 1AWXA 1YCSB 2YUQA 2OAWA 1JXOA 1UJYA 4OMOA 2MOXA 1MV3A 3GBQA 1GFDA 1J3TA 3RNJA 3QWXX 2RQUA 1QCFA 2KBTA 4HVVA 1SPKA 1E7OA 4CC7A 3REBB 2GQIA 4RTYA 2DL3A 3M0QA 4J9BA 1ZUUA 4OMLA 4D8DA 3I9QA 4AFZC 2EGAA 2YDLA 3VS6A 3EG0A 4J9CA 2LP5A 2CSIA 2FG0A 5IHKA 4AFUC 2DX1A 1BBZA 3SEMA 1YWPA 5IXFA 2HEQA 2BZ8A 2KRMA 3H0IA 2DL5A 2FPDA 1M3CA 3JV3A 3PVLA 1RLPC 2DBMA 2DRKA 3UF4A 1CSKA 4F14A 1NG2A 2RQWA 1A0NB 1WFWA 2H8HA 2RNAA 1AD5A 1UG1A 4J9IA 2RN8A 1WI7A 4F17A 2CSQA 1MV0B 1I0CA 4JJBA 1TG0A 2C0OA 2CT4A 2JMCA 1AZEA 5FW9A 3TVTA 1JU5C 1H8KA 2LJ1A 2OI3A 4ESRA 3QWYA 1E6GA 2JS2A 2C0IA 3VS4A 1QKWA 1SEMA 2DLPA 2GBQA 2KYBA 1AWJA 2CH4W 2GTOA 2EYZA 2L3PA 2K7AA 4OMMA 2DNUA 1WXTA 3VS2A 1KFZA 4HVWA 3UA6A 1Z9QA 1OOTA 4AFSC 1ARKA 1PRLC 4KRTA 2GNCA 4J9DA 3VS3A 1AZGB 2EQIA 2K79A 4D8KA 3M0RA 3NGPA 1JXMA 4J9EA 2KROA 1T0JA 1NEBA 2FRYA 1UJ0A 4HCKA 1BU1A 4HVUA 1KJWA 2ENMA 1QWFA 4HXJA 1AOJA 2F2XA 2JM9A 2JW4A 1FMKA 1S1NA 1T3SA 1KIKA 2E5KA 2D8HA 1X27A 1MUZA 4AG2C 3EG3A 2PTKA 1X6GA 1M30A 2YUPA 4IIMA 1TUDA 2KT8A 1WXBA 1OPKA 1PNJA 1I07A 5IHIA 2KT1A 3NMZC 2EVRA 2O9SA 4QT7A 1OEBA 2NWMA 3M0UA 1I1JA 1OV3A 2ABLA 3RBBB 1B07A 2ESWA 1RI9A 2LJ0A 3VRZA 3M0TA 2A37A 2DILA 2G6FX 1NLPC 2RQVA 1PHTA 1UFFA 2MIOA 2J6OA 2CUBA 2LMJA 1GBRA 2D8JA 5EC7A 4RTVA 4Y92A 4LN2A 1H92A 1AVZC 1U5SA 2KGTA 1ZUYA 2FO0A 2KRNA 2YSQA 1PKTA 1QLYA 3REAB 1VYUA 4LNPA 2DL8A 2M51A 2J7IA 4RTWA
chains in the Genus database with same CATH superfamily
1VQ6T 2DE0X 3LYIA 1OPLA 1S72T 2DETA 3OYJA 5FRMA 1YHQQ 1VQNA 3EFOA 2EYXA 1RAHB 2RM4A 3R6OA 3UATA 2RK2A 2RI5A 5DLQE 2CUDA 2JM8A 5LJ3g 2OTJT 2JUFA 2VASA 2IVWA 2V8KA 3RMSA 4OVAA 4R56A 3X20B 1R77A 1SSHA 3I56T 5KH6A 3EAEA 4NL3A 3VS5A 4JRQA 4LDWA 3OYFA 2QG9B 2DBKA 2AKKA 1O9SA 3RR6A 4C8QB 2D9TA 4O5VA 1JEGA 4A54A 2RJFA 5I21A 1G83A 2V26A 2HCKA 3ME9A 1NLOC 5GMKm 1BK2A 2NUPA 3MJXA 2XK0A 4CI0C 2M0YA 4O6JA 2W0ZA 3L2QA 4ATOA 2AZVA 3F70A 3OYGA 1Q82C 2ZZDA 2YRDA 4X9DA 1YJNA 1UDLA 2F5KA 1X2QA 1X6BA 2LT1A 2FEIA 1F1BB 1QVPA 1Y0MA 3PIOA 3M0SA 1G8XA 2X51A 1WA7A 4Z8AA 3G71Q 3CC7T 2K3BA 3IQLA 1O75A 1NM7A 3LX7A 2DVEA 2K57A 5GAN7 2F69A 4KUDK 2HKNA 4UC4A 4RG8A 2EYYA 5KYXB 2CZ0B 2EGEA 1RADB 1LJOA 3BFMA 2VYTA 5FLXE 3E1SA 3OYNA 5CVIA 3JB9F 2KK4A 1JO8A 1B34B 2MPXC 3A98A 1I4K1 1ZUKA 2K5IA 3TSWA 1D3BA 2QDYB 1IRXA 2PVGB 4FT4A 2VWFA 3DB3A 4J9HA 1GRIA 1AWOA 3NFCA 2AKLA 1IB8A 1VQNQ 2YHTA 3VS7A 1QVGS 1D1CA 3OYIA 1KHIA 2DL7A 4E6RA 2YT6A 3R6NA 2EJGA 2KE9A 4RKUE 1W70A 2ROTA 4QVDA 2K9GA 1K4US 4IURA 3CC4A 1X43A 4Z88A 3ZFJA 1YJ9T 2JZ2A 2P4TA 2QQRA 1B3QA 4XTYA 3OS5A 2ECZA 3C12A 1D0YA 4OMPA 1KQSP 2CP7A 2NUZA 4JLIA 4M75C 1KQ1A 2L3SA 5GAN6 1YIJA 4DQ2A 3OYYA 2EQJA 3NTKA 3JB9D 2M16A 2QQSA 4QQDA 1HK9A 2O9VA 2R5AA 3JB9J 2L0AA 4X1VA 4OGCA 2IG0A 2IPOB 3UDCA 2I2LA 4PNOA 2A3LA 2IIMA 4KGXB 2KVQG 1ZBJA 3BDUA 3OW2S 3TEEA 3VS0A 1BI1A 1X2KA 2RHZA 2RK1A 1MNDA 1LPLA 2HBWA 1YJNQ 1QKXA 1VYVA 2HZYA 5IT9E 2DM1A 5IH2A 4JRPA 1UGVA 3EFRA 3HFOA 1MMDA 4BE0A 1VOMA 4LD9K 2CP2A 1Y57A 4WTOB 5D6XA 4XTZA 2EFIA 3ULRB 1YITT 4JZ3A 1QVFP 4JJDA 3S3MA 2XI9A 3EG2A 4E7JA 2ZPHB 5J26A 3CMAA 4MMLA 4Y91A 3S3OA 2ZAEA 2QGFB 1IGQA 2QXFA 1RACB 2LZ6B 2F2VA 4M77B 3X24B 2FYKA 3PFSA 1SRMA 2HNIA 1AWWA 5CKFA 3CPWS 3X25B 3X28B 3QDFA 4PL6A 3OYLA 3V8JA 1TSFA 3O5ZA 4JUVA 5FU7B 1M3BA 1EZZB 3GNFB 1UTIA 1GL5A 1YN8A 1VQ8A 4EMKA 2D1XA 1YI2T 3CCUT 1OI1A 3L1AA 4C8QA 2BZYA 1G3TA 4PKCC 4GY5A 3FJ5A 3V8KA 4C5IA 5GAN2 2CT3A 2MWOA 2F1LA 3GNGA 1OYXA 1JRIA 1VQ9A 1JXOA 1UJYA 3CCJA 5D6YA 4OMOA 1K73C 4C0ZA 2PUOB 2K5LA 8AT1B 4M7AF 3EFSA 1J3TA 3CC4Q 2KDSA 1E7OA 1JB0E 5GAOn 1VQKT 2DL3A 4OMLA 1B7TA 1ZUUA 4NOYA 1G3YA 4EPCA 2LP5A 2M02A 3FDRA 3GP8A 4M7AB 1YJWA 4M78A 4RG2A 4JDSA 2EYQA 3URGA 1Y71A 2Y4XA 2HEQA 4IKFA 5CR2A 1M2VB 2KRMA 2M1HA 1G3SA 1M3CA 3UWNA 3PVLA 5KYWA 5KYXA 2L8DA 2AHJB 1CSKA 4OMFB 4F14A 4QKUA 4M78G 2MAMA 1ACMB 1OZ3A 2H8HA 1UG1A 4BI8B 3A8LB 3JCMP 3QBYA 2RN8A 3UPUA 1U1SA 5C0MA 3G6ET 1MV0B 4MZMA 1TG0A 2JMCA 4C8QC 3HRSA 1JU5C 4A4HA 3LWHA 3QWYA 4IUTA 2C0IA 2XIDA 2ZGWA 2YXYA 3FIFA 2QASA 4M7AD 2DNUA 4PJJA 1Z9QA 3SB2A 3RMQA 3CMAQ 8ATCB 1IHVA 2RHIA 4C92G 4J9DA 3VS3A 1AZGB 2EQIA 2K79A 4J8OA 3NGPA 4ZN3A 4J9EA 2KROA 3GF5A 4HCKA 1BU1A 4PJOA 4R55A 3QJYA 2CP0A 2JW4A 4PFOA 4E7KA 1VQ8Q 2PTKA 4M7DB 3RKYA 1WXBA 1OPKA 4PJOG 1I07A 1VQ6A 5A0LA 3CCMA 4BD3A 2EVRA 2ATCB 2O9SA 1S72A 3INZA 2QQ9A 4QT7A 2H3EB 1OEBA 3C4SA 2LT4A 4BI4A 2ESWA 1VQ9Q 2JNGA 3M4GA 1YCYA 3CCJQ 2RQVA 4ZGEB 2O01E 4RTVA 4XU3A 1H92A 3HPWA 3ZEHA 3V7SA 1TTHB 2RA2A 2KRNA 2YSQA 3M53A 1K8AR 2M9UA 2DL8A 3OMCA 3I56A 3SWNA 2M51A 4RTWA 3TREA 1VQ8T 1TH7A 3PMTA 3QHSA 4ZTJA 4M7DD 3HTRA 2E4HA 1GCQA 2RQRA 5KYYB 3TU4K 1YJWQ 1PCXA 1TUCA 2YUOA 2F5TX 2RD1A 1BKBA 3KFVA 3JCMb 1W1FA 4LXCA 3ZBDA 2GQVA 2LCSA 2L3RA 3OSVA 2JTEA 1GBQA 4M77A 4FM4B 3LGFA 1H3ZA 4XTXA 3C0CA 3G7ZA 2ED0A 3LLRA 3NTHA 3MKDA 3PT9A 4M4ZA 2QGGA 2RPNA 4HCZA 2J6KA 5CKEA 3KUFA 3CPFA 3TSZA 4CC2A 1K76A 2EIFA 2DEQA 4F7UA 5GAOp 3CC7A 1NEGA 1W2BA 9ATCB 1EX4A 1HYOA 4C5HA 2DXCA 3C94A 2AK5A 2B8AA 3OS2A 3QPHA 4FSSA 2MF2A 3QZ9B 4A4GA 3OYCA 4F7UG 2BTTA 2RJDA 3OS1A 7AT1B 2VB6A 1KC8C 5L23A 4HA8A 4J83A 4V2SA 3UT1A 3X26B 2V1QA 2LCLA 1WLPB 2QTVA 2DIQA 1EIFA 1Q95G 1BYMA 5GJWB 4OB3B 4YTLA 2FL7A 5AT1B 1GCQC 4KGVB 2K2MA 4ME7A 4Z89A 1FYNA 2KEAA 2EJFA 2QQBA 3QKJA 3VYGA 5GAN3 4C0DB 2CZ6B 3CBMA 3A8HB 2JMAA 2DF6A 4PFZA 1VQ7A 1VQ6Q 2EJ9A 3CCMQ 2NLUA 3OY9A 1S72Q 2EQUA 1TU0B 3EGUA 4GBQA 4M77C 4Y28E 2QEXT 2J6FA 3A8GB 1ABOA 4DBQA 2J05A 1MNEA 2DVJA 3M4YA 4A4KA 3GIBA 3LH0A 4AG1C 5FU7C 2D0NA 4BDYA 2GFUA 1X69A 1MMAA 4A53A 2DFUA 1ZSZB 2K5FA 1X6OA 2Y4YA 1IHWA 1QVFS 1IO6A 1Y07A 1YJ9A 3ZL7C 4JJCA 3I56Q 2HL3A 1W6XA 2EWNA 1OULA 1OU9A 2KSSA 3QYGB 1C1AA 3CCMT 1WHHA 2GGRA 2CS7A 2KY9A 3FEOA 3WXMB 4A4EA 3M5AA 1Q82R 2VVKA 2D0QB 1G2BA 1Q82U 1PC0A 3MP8A 2EW3A 3RKXA 2E10A 1UHCA 3CCST 2X4XA 1T3LA 4RUGA 1MHNA 1E6HA 1XTDA 3M57A 2RJEA 4ZGJB 2R57A 2LCCA 1PKSA 2FRWA 5D7UA 4M7AC 4KGZB 2BZXA 3N5BB 2CREA 3THKA 2DYBA 3CC7Q 1M9SA 4E7IA 2YUNA 3JB9I 3TCJA 1HD3A 4M78E 1YITA 5FROA 3EHRA 2CP6A 1X75C 3OYBA 3L2UA 2H3JA 1RUWA 2DA9A 4RCBA 3MO8A 3BE3A 4GLMA 4KUIA 2DPPB 2EGCA 5GANd 2F2WA 3HSBA 2VGNA 3M0PA 4QQGA 5CK9A 1WIEA 2DO3A 3EGDB 1M8MA 4OMQA 4OMNA 3H41A 1N9RA 2AIRB 3E19A 5GANe 3JCMW 4C92E 4R0KA 3TQ7P 4OB0B 2LTOA 4TVRA 1PRMC 4KH1B 4BE2A 4LE9A 1WYXA 2V1RA 1VQ7Q 3JRZA 3CCUA 1YI2A 4CRIA 5KYYA 3AHUA 4HCBA 5GMKe 4M75A 4AMCA 3CCVA 5KYUA 4X9CA 2C0TA 2X3XD 1R8OB 2X9HA 1FX7A 3VS1A 1YFNA 4PFPA 5I11A 4PJOE 2DEUA 4M75G 5GAMd 2QYZA 1AT1B 4XU0A 4C0GA 1WDXA 1YJ9Q 4M7DC 2O88A 5HCKA 2MMPA 4IIOA 1JJ2P 2DTOA 4C92F 1VQKA 1VQOA 4Z02A 1VYTA 1RLQC 1VQ7T 1M3AA 5GAMe 3JCMV 3DKMA 1KQ2A 2DMOA 4FT2A 1D1BA 1H3HA 2O2OA 4J6XA 3E9FA 2Y90A 4N0AC 1Q7YC 1AWXA 2OTLA 5DM7R 4FIBA 1OX9A 1Y96A 2JTMA 1PD1A 4EDUA 2E6NA 3BY7A 4PJLA 3RNJA 1SSFA 2AT1B 4BUGA 3VV0A 3QWXX 3HL8A 4HVVA 1QW1A 1SPKA 2BE9B 2HKQB 3G1JA 4PJOF 2PVOB 1WHMA 1M1FA 4RTYA 3G6EA 4J9BA 3EG0A 1QVGA 3JCMh 3LGLA 3PMIA 3I55T 2JOYA 4Q5WA 4BDZA 1YITQ 3CD6Q 2BZ8A 3H0IA 4KBMB 2DL5A 2FPDA 1XNIA 4C92D 3UF4A 3OYDA 5GAOr 2LRQA 2RQWA 4AT1B 1WFWA 3CXCP 1VQMQ 1WHJA 2ZPBB 1AD5A 1M8VA 2CSQA 3O8VA 2K2VA 4FYXB 4JJBA 3S3NA 1ZSZA 1R0CB 1AZEA 4FW1A 5FW9A 3TVTA 3M56A 1BCMA 1M1KU 2OI3A 4ESRA 1BI2A 1QKWA 5GMKl 5CO7A 2DLPA 2DYIA 2GBQA 2CH4W 4DBHA 2EYZA 2L3PA 2K7AA 4F7UE 4OMMA 1WXTA 2P0KA 1YI2Q 3CCUQ 2HBPA 3UA6A 3J80E 3HKSA 1ARKA 5GANj 1PRLC 5GANh 3CD6T 3OW2A 1VQPA 1K73R 3BW1A 5LJ5d 2WSCE 1K73U 1ZA1B 3CCVQ 5DY9A 5KE2A 5M9OA 1NEBA 2FRYA 3P8HA 1VQMT 3QG1A 5GMKj 3RDVA 1KJWA 5GMKh 2ENMA 5LJ5e 1AOJA 1RAGB 2F2XA 1S1NA 1T3SA 2HSEB 4C0DC 4JJNK 4AG2C 1U8RA 1X6GA 1M30A 2OX7A 1TXQA 3V8LA 2KMTA 3MCAB 1TUDA 2KT8A 2RHXA 1VQOQ 1VQKQ 4OP0A 2KT1A 3NMZC 1M1KC 1FXXA 4N4IA 1UGRB 3A8OB 3M0UA 1MMGA 1OV3A 3CPWA 2E12A 1WJSA 2OTLQ 3VRZA 2JN0A 3CCVT 2A37A 4FCYA 1VIFA 5GAMj 1NLPC 5GAMh 1UFFA 2HMAA 3L2RA 2VV5A 3EGXB 1ZSZC 2XDPA 5EC7A 2RHYA 4Y92A 4C8QG 4II1A 4LN2A 1MMNA 3EGDA 2PVDB 2KGTA 4LDVA 1QLYA 2XU8A 2J7IA 1N9SA 1VQ5A 3G6EQ 4IUQA 1PSFA 3M59A 1VQOT 1M4ZA 2O31A 3DB4A 3NTIA 3CQTA 2NUTB 5FRNA 3RESA 1HSQA 2DRMA 3PNWC 1BIBA 2M0OA 2OTLT 2HQHA 2XG8D 2COWA 2VKNA 2E3HA 5GMKi 1VQLT 3V7CA 2FZGB 3E9GA 3OYKA 2BKDN 1G5VA 2HD0A 1QWEA 2PU9B 4E2FB 4LUEA 2ED1A 1UGSB 5GAN4 5GANf 1NJIC 4C0FA 3GPLA 1B34A 2E3IA 5CQXA 4LUDA 1KD1C 3VKIA 1ZA2B 5GJVB 5A2QE 5J39A 1VQPQ 3JB9H 1QP2A 3HHTB 4EIKA 1NE8A 5GAOq 4DA4A 3PVQA 4GLKA 2QEXA 3RERA 1IREB 2SEMA 2E5QA 3OS0A 1WHGA 2QA4T 3OYHA 2A08A 3CMET 2EQMA 2KRSA 4B9WA 1BB9A 2CGHA 2EBPA 4J7IA 2E70A 4CC4B 2RI3A 1TS9A 1C6VX 1T0HA 5LJ5j 1WQWA 5LJ5h 1K0SA 4LDUA 5GAMf 3OYAA 4JS5A 4KULA 1VQPT 3G4ST 2JVVA 2BE7D 3CCET 1WQ7A 4M75E 2PZ1A 1K0XA 3AT1B 5IAYA 1NPPA 4E47A 1I5OB 3EHQA 3CCSA 1FMWA 1WX6A 2X3WD 2OJ2A 1K9MU 4HT8A 1X01A 1P92A 2B86A 2YLCA 1U3OA 3HRTA 2YRCA 3QUIA 1VQ5Q 4FW2A 2CZ1B 5FWBA 1QMCA 1W4SA 2LJ3A 3MP1A 2I0NA 3J7AF 1PSEA 2E6ZA 5HK3A 3CCLT 4ZNXA 1KC8R 2ROLA 4BB7A 3OA6A 4B9XA 1KC8U 4HKEA 4RTXA 4C5EA 2PQWA 1OU8A 4OB2B 4DOVA 1QQJA 1Q81R 2DK3A 2P4RA 2YRVA 2L89A 1VA7A 4J9FA 4J7FA 1HJDA 1JJ2S 3H0FA 3WVEB 1Q81U 3WVDB 2A36A 3JCMg 3HFNA 1YWOA 1VQ5T 2DJZA 4PK4A 4AFQC 1K9MC 4DEXA 2RHUA 3A5ZB 1YNZA 4JS4A 4BY6B 4M77G 4XAXB 3H6ZA 3H8ZA 2DAQA 3ER0A 3FRNA 3L42A 2A0FB 1C0MA 2QTXA 2FPFA 4E7SA 2MWPA 2RF0A 4ELZC 1V76A 5CAIA 2L2PA 2QEXQ 3VYHB 4J6YA 2LNVA 1M1GA 1GCPA 1D3BB 1U06A 3MEUA 5LJ5f 2VC8A 1N5ZA 1RAAB 1KQSS 1NPRA 2LC4A 3FJPA 4RTZA 4JZ4A 5KYNA 2DKGA 2COZA 4OGEA 4PJMA 5GANg 2DTHA 4F16A 3BDLA 1Q81C 1BI3A 1I81A 2WACA 1M90C 1ZSGA 2DL4A 3CXCS 4M7AA 2K6DA 3CC2T 4KH0B 3NHNA 4QVZA 2EQKA 3VJPA 1LVKA 1KQSA 5A0GA 4WF2A 2EKOA 4XTVA 1M2VA 4DEYA 2P0QA 2J06A 2X4YA 4P5NA 2O4XB 2QDLA 3CCSQ 1I8FA 2CYZB 2DZCA 4M7AG 1VQ4T 2G3RA 3EH1A 3FB9A 2DJQA 5KCOA 4XK8E 1TUGB 2JJ9A 2P0PA 2RJCA 3OBYA 2VGMA 4K11A 1UHFA 2A28A 5GAMg 5L8RE 1NYFA 2RQTA 1V29B 4C8QE 3I55A 4MZTA 3M55A 1YCSB 1M2OA 2JTFA 3JCMd 3CCQT 1QVFA 2MOXA 1MV3A 2FHDA 3GBQA 5AYFA 2DERA 4RMOA 1FMVA 2RQUA 2KBTA 2CZ7B 4HT9A 3REBB 2GQIA 3JCMe 5FU6B 1WHKA 1WGSA 3M0QA 2D6FA 2YDLA 3VS6A 1OZ2A 2PUKB 4J9CA 1RAFB 1PD0A 4AFUC 1Q86C 1BBZA 5C6SA 1YWPA 4M7DA 4PLIA 5GAN5 2KQWA 3JV3A 2WSFE 1D0ZA 3CD6A 4C8QF 2DBMA 2DRKA 1IGUA 3RKWA 5DLOA 3VUBA 2RNAA 2RI2A 2DXUA 3M9QA 4N0AA 1WI7A 4PLLA 4L5GA 4F17A 4EMKB 4M7DG 1VQMA 3MHXA 1LNXA 1BI0A 4OF1A 1H8KA 1U1TA 2LJ1A 3MEAA 3CBPA 1YHQT 1E6GA 4MDWA 1KHCA 1SEMA 4LD6A 1Q7YR 3VS2A 4AFSC 1Q7YU 1OOTA 3GOXA 4KT0E 3P8DA 4KRTA 1RI0A 2XHCA 1BCOA 3QJ6A 3E2UA 4D8KA 3HP9A 4M78F 3D7SB 5LL6S 1NZ9A 1TOVA 1UJ0A 4HVUA 1QWFA 4HXJA 2KI7A 1UGQB 2JM9A 2XKOC 5LJ5g 1FMKA 4C8QD 6AT1B 1KIKA 1QP3A 4M78B 3HRUA 1Y7XA 3EG3A 1VIEA 4IIMA 2VXFA 3PGGA 3SD4A 3OB9A 3A8MB 4XTUA 4ZTFA 2XDBA 1PNJA 5IHIA 4B6MA 5KYWB 4BI3A 2MYSA 4JLGA 2NWMA 3QZ5B 3RBBB 1B07A 3EG9B 3I55Q 2A7YA 2XD0A 1KG1A 3M0TA 1ZBXA 2DILA 4L6V5 2GFAA 1PHTA 2R58A 2J6OA 4C92B 1VQLA 1W2BP 1GBRA 2D8JA 5HK0A 2RB6A 1U5SA 4JRIA 5GAOl 3G71T 2FO0A 5HY6A 4XQ3A 1VYUA 1MGQA 4M78D 2XICA 3DLMA 2DXTA 4OB1B 1RL2A 2NYSA 3KXTA 3OSSC 2CKKA 2DD5A 4FL6A 4JPBW 3LWIA 3GLXA 5LJ3d 2P84A 1SKUB 3C95A 1JBMA 1QCNA 3L2VA 2RO0A 2X4WA 2SRCA 2LX9A 4PJOB 1WXUA 2RMOA 5LJ3e 4RTUA 4A63B 4XTWA 4XU2A 1PM3A 4PJNA 3MEWA 2HDAA 2K3XA 1SHFA 3CEYA 2L3QA 4BE1A 4LDYA 4M77E 2FVUA 2QA4A 2O4XA 2HSPA 3JSCA 3CMEA 5CKBA 3EG1A 4BY6C 4E7ZA 1M1KR 1EFNA 2KR3A 4QW2A 2EYWA 5CCAA 1VQNT 3I35A 1GXIE 3T9NA 4JRKA 1RAIB 4A4FA 1WNLA 2HL5C 1RAEB 3A1PA 4DBFA 1UE9A 4NS5A 3OQ5A 2QK0A 1YP5A 2QI2A 2K3YA 1KSWA 1V1CA 4PJOD 2X35A 3G4SA 3H0HA 3CCEA 1ZLMA 2LQ8A 1VUBA 5CKHA 2DIGA 1G3WA 3SWNB 1LOJA 2ZPGB 3RIRA 3VRYA 4M77F 4RTTA 4RCCA 4J5YA 5A0DA 3I5RA 2K4YA 3I5SA 4FSXA 1AEYA 1SRLA 2XMFA 3JCMQ 1SG5A 2LQNA 3LH5A 1D1AA 3CCLA 2CH4A 1N6AA 4N4HA 4F7UF 4M7AE 4QVCA 1YJNT 1I5LA 5GAN8 1NBEB 1NJIR 1VQLQ 2MI6A 1D09B 1KD1R 4FYYB 1NJIU 3CCRA 2KYMA 4F7UB 3RUXA 2JS0A 1DJ7B 3JCMf 1KD1U 2RH2A 1N8RR 1YBYA 1NYGA 2DTIA 4LDXA 1PWTA 1N8RU 1IZ6A 3PE0A 1XOVA 4M77D 2DD4A 2JXBA 4IUUA 2CP5A 4EMGA 4J9GA 4FYVB 2OAUA 1ZHIA 1UECA 1ZX6A 2DXBA 2ZCFB 3L2ZA 3NPFA 1K1ZA 5KCHA 5FU6C 4D6WA 1RABB 2QA4Q 3DLLA 3KBGA 4QQ6A 5LJ3j 5LJ3h 4CC3A 3CMEQ 1YIJQ 3OYMA 2MCNA 5KE3A 2LX7A 2W10A 4F04B 2CDTA 2GCXA 2FPEA 5ECAA 2PNIA 2YLBA 3JCMX 1HXDA 2LQWA 2AZSA 2FB7A 3V7RA 2BUDA 1TWBA 3MP6A 4EMHA 5CKDA 4ANJA 5D6WA 4WCIA 1ABQA 3JAME 2EPDA 2HQEA 4ELYC 5I22A 1UB4A 3JCMc 1OQKA 4M7DE 1N8RC 3SHWA 5CIUA 4ORZA 1SHGA 3EG9A 4MZPA 5HKCA 4FU6A 3G4SQ 3CC2A 3CCEQ 3CC4T 3FLGA 4EMKC 4C92A 2R5MA 3MPUB 3U23A 1LCKA 2BIVA 1BIAA 1QCOA 1IXDA 2XDDA 4C5GA 4HCCA 2LQKA 5I2SA 3OYEA 1Z9ZA 2KNBB 3SDZA 1YIJT 3JB9G 1VQ4A 3EFOB 3UA7A 5EG2A 2CP3A 5IHNA 3VU3C 2EKHA 4IUPA 2FZCB 3CCLQ 1ZQ1A 2GTJA 3QO3A 3QYHB 1H641 1CKAA 3M58A 4M7DF 4L59A 3QIIA 2ZPEB 1QVGP 5CQYA 1GFCA 3CCQA 3CBOA 3OBWA 4E7HA 1CKBA 1K9MR 4M78C 4X34A 2JT4A 2KXCA 2KXDA 2V8JA 2EAYA 3CCRQ 2X4JA 5FWCA 3J81E 4VUBA 1UUEA 3CMAT 4N4GA 1JQQA 2HQXA 5IXBA 4ZN1A 2NUPB 1M27C 2LNHB 1K9AA 1UEBA 2YUQA 2GF7A 2OAWA 5LJ3f 4C92C 1OX8A 2WSEE 2OTJA 4NL2A 3SFMA 1WHLA 4M75F 1GFDA 1QCFA 3CCRT 3OW2P 1K8AU 4CC7A 2MK5A 3P8BB 4D8DA 4DOWA 3I9QA 1M90R 4AFZC 2EGAA 3PIPA 2CSIA 3LW5E 4M75B 1M90U 2FG0A 5IHKA 1YHQA 2QAZA 4J6WA 2DX1A 3SEMA 5IXFA 2YWWA 5KYUB 1VQ9T 4PJOC 3Q1JA 2C06A 2HAXA 3M54A 1W2BS 3CCJT 1RLPC 1JJ2A 3CC2Q 2VXEA 1NG2A 1A0NB 5J3BA 3FC3A 2L5QA 4J9IA 4ZGDB 1KK7A 2FZKB 1I0CA 3OMGA 3META 2C0OA 2CT4A 2ZPIB 3CPWP 3EGXA 2DZ9A 1YJWT 3S6WA 2JS2A 2VUBA 3VS4A 1D0XA 2QQAA 1VQ4Q 1WPYA 4DBRA 1WJQA 1AHJB 3EH2A 2KYBA 1AWJA 2GTOA 4M75D 1K8AC 2V8IA 1KFZA 1R0BG 4HVWA 4E7LA 1Y96B 2GNCA 3L2WA 2COYA 3PTAA 2NUTA 1WJRA 2E64A 1XJWB 3M0RA 3SWNC 5I2MA 1JXMA 1PG5B 1T0JA 1SF9A 2LVMA 3CCQQ 3VUZA 2Z0WA 4XU1A 2E65A 2E41A 5IN1A 3JCMJ 2KAFA 2E1HA 2E5KA 2D8HA 1Q86R 1X27A 1MUZA 3MEVA 3G71A 3ASKA 2YUPA 1WZOA 1Q86U 3CXCA 1XQHA 3QDRB 1FWZA 1I1JA 1N27A 4IUVA 3QSUA 2ABLA 1RI9A 2LJ0A 3QXEB 1M5Q1 2G6FX 2MIOA 2OTJQ 1UGPB 4MDXA 4FYWB 2CUBA 2LMJA 4MMKA 1AVZC 1ZUYA 5GAOm 1PKTA 3H9NA 2ZPFB 3REAB 4LNPA 2LDMA 4BACA
chains in the Genus database with same CATH topology
2DE0X 4JPBW 1OPLA 2O31A 1GCQA 3CQTA 2RQRA 2EYXA 1TUCA 2YUOA 1HSQA 2DRMA 3KFVA 3UATA 2SRCA 1W1FA 2LCSA 2VKNA 1WXUA 2RMOA 2CUDA 2JM8A 2JTEA 4RTUA 1GBQA 4A63B 3C0CA 2ED0A 2HDAA 1SHFA 2L3QA 4M4ZA 1SSHA 1QWEA 2RPNA 4LUEA 2J6KA 2HSPA 2ED1A 3VS5A 2DBKA 3EG1A 2AKKA 1EFNA 3TSZA 2KR3A 4CC2A 1K76A 2EYWA 4LUDA 3I35A 5GJVB 1NEGA 1JEGA 1G83A 2HCKA 1NLOC 1UE9A 1BK2A 2AK5A 2M0YA 1YP5A 4EIKA 2W0ZA 1KSWA 1V1CA 4FSSA 2AZVA 3H0HA 3PVQA 2BTTA 2SEMA 5L23A 1ZLMA 1UDLA 1X2QA 1X6BA 2A08A 2FEIA 2V1QA 1WLPB 1Y0MA 3M0SA 3VRYA 2KRSA 5GJWB 4RTTA 1WA7A 1GCQC 4Z8AA 2K2MA 2K3BA 1FYNA 2KEAA 4Z89A 1BB9A 2EBPA 3IQLA 4CC4B 3I5RA 3I5SA 1AEYA 1NM7A 1T0HA 2JMAA 2DF6A 1K0SA 1SRLA 2XMFA 2LQNA 3LH5A 3EGUA 4GBQA 2CH4A 2EYYA 2EGEA 2J6FA 2PZ1A 1K0XA 1ABOA 2J05A 2DVJA 3EHQA 4AG1C 2D0NA 1X69A 1JO8A 1WX6A 2X3WD 2OJ2A 3A98A 2KYMA 1ZUKA 3TSWA 1IO6A 2B86A 2JS0A 1U3OA 3ZL7C 4JJCA 1W6XA 5FWBA 1NYGA 2VWFA 2LJ3A 4J9HA 2I0NA 1GRIA 1AWOA 1PWTA 2AKLA 4ZNXA 3PE0A 2GGRA 1XOVA 2JXBA 2VVKA 2ROLA 3VS7A 1G2BA 4J9GA 2DL7A 4E6RA 2YT6A 4RTXA 2EW3A 1UECA 1ZX6A 3R6NA 1UHCA 2KE9A 1W70A 2ROTA 2P4RA 4J9FA 1T3LA 1VA7A 3NPFA 1K1ZA 2K9GA 4RUGA 1HJDA 1K4US 1X43A 3H0FA 4Z88A 1E6HA 2A36A 1B3QA 4CC3A 1PKSA 2ECZA 2FRWA 4OMPA 1YWOA 2MCNA 2NUZA 2LX7A 4AFQC 2BZXA 2W10A 2L3SA 4DEXA 2CDTA 2FPEA 5ECAA 2PNIA 2CREA 1YNZA 2AZSA 2LQWA 3THKA 2DYBA 2YUNA 2O9VA 1HD3A 4WCIA 1ABQA 2EPDA 2L0AA 3EHRA 5I22A 4X1VA 2FPFA 1RUWA 2DA9A 2IIMA 2RF0A 3SHWA 4ORZA 1SHGA 4GLMA 1ZBJA 2EGCA 2L2PA 2F2WA 3VS0A 1X2KA 1GCPA 3M0PA 2HBWA 1WIEA 1U06A 1QKXA 1M8MA 1VYVA 3U23A 4OMQA 1LCKA 4OMNA 2DM1A 1N5ZA 3H41A 5IH2A 4RTZA 1UGVA 4JZ4A 1Z9ZA 2KNBB 4R0KA 4F16A 1Y57A 1PRMC 3ULRB 3UA7A 4JZ3A 1WYXA 2V1RA 4LE9A 4JJDA 5IHNA 3EG2A 1ZSGA 2EKHA 2DL4A 2K6DA 2LZ6B 3NHNA 2GTJA 2F2VA 1CKAA 1SRMA 2C0TA 1AWWA 4DEYA 2X3XD 2J06A 1GFCA 3VS1A 5I11A 2QDLA 1CKBA 3O5ZA 1M3BA 2JT4A 2KXCA 2KXDA 1UTIA 1WDXA 1GL5A 1YN8A 2O88A 5FWCA 2D1XA 2DJQA 5HCKA 4IIOA 1UUEA 2BZYA 1JQQA 1VYTA 1RLQC 5IXBA 1M3AA 3FJ5A 4K11A 2DMOA 1UHFA 2A28A 2CT3A 1M27C 1NYFA 1H3HA 2RQTA 2O2OA 2LNHB 1K9AA 1AWXA 1YCSB 2YUQA 2OAWA 1JXOA 1UJYA 4OMOA 2MOXA 1MV3A 3GBQA 1GFDA 1J3TA 3RNJA 3QWXX 2RQUA 1QCFA 2KBTA 4HVVA 1SPKA 1E7OA 4CC7A 3REBB 2GQIA 4RTYA 2DL3A 3M0QA 4J9BA 1ZUUA 4OMLA 4D8DA 3I9QA 4AFZC 2EGAA 2YDLA 3VS6A 3EG0A 4J9CA 2LP5A 2CSIA 2FG0A 5IHKA 4AFUC 2DX1A 1BBZA 3SEMA 1YWPA 5IXFA 2HEQA 2BZ8A 2KRMA 3H0IA 2DL5A 2FPDA 1M3CA 3JV3A 3PVLA 1RLPC 2DBMA 2DRKA 3UF4A 1CSKA 4F14A 1NG2A 2RQWA 1A0NB 1WFWA 2H8HA 2RNAA 1AD5A 1UG1A 4J9IA 2RN8A 1WI7A 4F17A 2CSQA 1MV0B 1I0CA 4JJBA 1TG0A 2C0OA 2CT4A 2JMCA 1AZEA 5FW9A 3TVTA 1JU5C 1H8KA 2LJ1A 2OI3A 4ESRA 3QWYA 1E6GA 2JS2A 2C0IA 3VS4A 1QKWA 1SEMA 2DLPA 2GBQA 2KYBA 1AWJA 2CH4W 2GTOA 2EYZA 2L3PA 2K7AA 4OMMA 2DNUA 1WXTA 3VS2A 1KFZA 4HVWA 3UA6A 1Z9QA 1OOTA 4AFSC 1ARKA 1PRLC 4KRTA 2GNCA 4J9DA 3VS3A 1AZGB 2EQIA 2K79A 4D8KA 3M0RA 3NGPA 1JXMA 4J9EA 2KROA 1T0JA 1NEBA 2FRYA 1UJ0A 4HCKA 1BU1A 4HVUA 1KJWA 2ENMA 1QWFA 4HXJA 1AOJA 2F2XA 2JM9A 2JW4A 1FMKA 1S1NA 1T3SA 1KIKA 2E5KA 2D8HA 1X27A 1MUZA 4AG2C 3EG3A 2PTKA 1X6GA 1M30A 2YUPA 4IIMA 1TUDA 2KT8A 1WXBA 1OPKA 1PNJA 1I07A 5IHIA 2KT1A 3NMZC 2EVRA 2O9SA 4QT7A 1OEBA 2NWMA 3M0UA 1I1JA 1OV3A 2ABLA 3RBBB 1B07A 2ESWA 1RI9A 2LJ0A 3VRZA 3M0TA 2A37A 2DILA 2G6FX 1NLPC 2RQVA 1PHTA 1UFFA 2MIOA 2J6OA 2CUBA 2LMJA 1GBRA 2D8JA 5EC7A 4RTVA 4Y92A 4LN2A 1H92A 1AVZC 1U5SA 2KGTA 1ZUYA 2FO0A 2KRNA 2YSQA 1PKTA 1QLYA 3REAB 1VYUA 4LNPA 2DL8A 2M51A 2J7IA 4RTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DE0 X;  4JPB W;  1OPL A;  2O31 A;  1GCQ A;  3CQT A;  2RQR A;  2EYX A;  1TUC A;  2YUO A;  1HSQ A;  2DRM A;  3KFV A;  3UAT A;  2SRC A;  1W1F A;  2LCS A;  2VKN A;  1WXU A;  2RMO A;  2CUD A;  2JM8 A;  2JTE A;  4RTU A;  1GBQ A;  4A63 B;  3C0C A;  2ED0 A;  2HDA A;  1SHF A;  2L3Q A;  4M4Z A;  1SSH A;  1QWE A;  2RPN A;  4LUE A;  2J6K A;  2HSP A;  2ED1 A;  3VS5 A;  2DBK A;  3EG1 A;  2AKK A;  1EFN A;  3TSZ A;  2KR3 A;  4CC2 A;  1K76 A;  2EYW A;  4LUD A;  3I35 A;  5GJV B;  1NEG A;  1JEG A;  1G83 A;  2HCK A;  1NLO C;  1UE9 A;  1BK2 A;  2AK5 A;  2M0Y A;  1YP5 A;  4EIK A;  2W0Z A;  1KSW A;  1V1C A;  4FSS A;  2AZV A;  3H0H A;  3PVQ A;  2BTT A;  2SEM A;  5L23 A;  1ZLM A;  1UDL A;  1X2Q A;  1X6B A;  2A08 A;  2FEI A;  2V1Q A;  1WLP B;  1Y0M A;  3M0S A;  3VRY A;  2KRS A;  5GJW B;  4RTT A;  1WA7 A;  1GCQ C;  4Z8A A;  2K2M A;  2K3B A;  1FYN A;  2KEA A;  4Z89 A;  1BB9 A;  2EBP A;  3IQL A;  4CC4 B;  3I5R A;  3I5S A;  1AEY A;  1NM7 A;  1T0H A;  2JMA A;  2DF6 A;  1K0S A;  1SRL A;  2XMF A;  2LQN A;  3LH5 A;  3EGU A;  4GBQ A;  2CH4 A;  2EYY A;  2EGE A;  2J6F A;  2PZ1 A;  1K0X A;  1ABO A;  2J05 A;  2DVJ A;  3EHQ A;  4AG1 C;  2D0N A;  1X69 A;  1JO8 A;  1WX6 A;  2X3W D;  2OJ2 A;  3A98 A;  2KYM A;  1ZUK A;  3TSW A;  1IO6 A;  2B86 A;  2JS0 A;  1U3O A;  3ZL7 C;  4JJC A;  1W6X A;  5FWB A;  1NYG A;  2VWF A;  2LJ3 A;  4J9H A;  2I0N A;  1GRI A;  1AWO A;  1PWT A;  2AKL A;  4ZNX A;  3PE0 A;  2GGR A;  1XOV A;  2JXB A;  2VVK A;  2ROL A;  3VS7 A;  1G2B A;  4J9G A;  2DL7 A;  4E6R A;  2YT6 A;  4RTX A;  2EW3 A;  1UEC A;  1ZX6 A;  3R6N A;  1UHC A;  2KE9 A;  1W70 A;  2ROT A;  2P4R A;  4J9F A;  1T3L A;  1VA7 A;  3NPF A;  1K1Z A;  2K9G A;  4RUG A;  1HJD A;  1K4U S;  1X43 A;  3H0F A;  4Z88 A;  1E6H A;  2A36 A;  1B3Q A;  4CC3 A;  1PKS A;  2ECZ A;  2FRW A;  4OMP A;  1YWO A;  2MCN A;  2NUZ A;  2LX7 A;  4AFQ C;  2BZX A;  2W10 A;  2L3S A;  4DEX A;  2CDT A;  2FPE A;  5ECA A;  2PNI A;  2CRE A;  1YNZ A;  2AZS A;  2LQW A;  3THK A;  2DYB A;  2YUN A;  2O9V A;  1HD3 A;  4WCI A;  1ABQ A;  2EPD A;  2L0A A;  3EHR A;  5I22 A;  4X1V A;  2FPF A;  1RUW A;  2DA9 A;  2IIM A;  2RF0 A;  3SHW A;  4ORZ A;  1SHG A;  4GLM A;  1ZBJ A;  2EGC A;  2L2P A;  2F2W A;  3VS0 A;  1X2K A;  1GCP A;  3M0P A;  2HBW A;  1WIE A;  1U06 A;  1QKX A;  1M8M A;  1VYV A;  3U23 A;  4OMQ A;  1LCK A;  4OMN A;  2DM1 A;  1N5Z A;  3H41 A;  5IH2 A;  4RTZ A;  1UGV A;  4JZ4 A;  1Z9Z A;  2KNB B;  4R0K A;  4F16 A;  1Y57 A;  1PRM C;  3ULR B;  3UA7 A;  4JZ3 A;  1WYX A;  2V1R A;  4LE9 A;  4JJD A;  5IHN A;  3EG2 A;  1ZSG A;  2EKH A;  2DL4 A;  2K6D A;  2LZ6 B;  3NHN A;  2GTJ A;  2F2V A;  1CKA A;  1SRM A;  2C0T A;  1AWW A;  4DEY A;  2X3X D;  2J06 A;  1GFC A;  3VS1 A;  5I11 A;  2QDL A;  1CKB A;  3O5Z A;  1M3B A;  2JT4 A;  2KXC A;  2KXD A;  1UTI A;  1WDX A;  1GL5 A;  1YN8 A;  2O88 A;  5FWC A;  2D1X A;  2DJQ A;  5HCK A;  4IIO A;  1UUE A;  2BZY A;  1JQQ A;  1VYT A;  1RLQ C;  5IXB A;  1M3A A;  3FJ5 A;  4K11 A;  2DMO A;  1UHF A;  2A28 A;  2CT3 A;  1M27 C;  1NYF A;  1H3H A;  2RQT A;  2O2O A;  2LNH B;  1K9A A;  1AWX A;  1YCS B;  2YUQ A;  2OAW A;  1JXO A;  1UJY A;  4OMO A;  2MOX A;  1MV3 A;  3GBQ A;  1GFD A;  1J3T A;  3RNJ A;  3QWX X;  2RQU A;  1QCF A;  2KBT A;  4HVV A;  1SPK A;  1E7O A;  4CC7 A;  3REB B;  2GQI A;  4RTY A;  2DL3 A;  3M0Q A;  4J9B A;  1ZUU A;  4OML A;  4D8D A;  3I9Q A;  4AFZ C;  2EGA A;  2YDL A;  3VS6 A;  3EG0 A;  4J9C A;  2LP5 A;  2CSI A;  2FG0 A;  5IHK A;  4AFU C;  2DX1 A;  1BBZ A;  3SEM A;  1YWP A;  5IXF A;  2HEQ A;  2BZ8 A;  2KRM A;  3H0I A;  2DL5 A;  2FPD A;  1M3C A;  3JV3 A;  3PVL A;  1RLP C;  2DBM A;  2DRK A;  3UF4 A;  1CSK A;  4F14 A;  1NG2 A;  2RQW A;  1A0N B;  1WFW A;  2H8H A;  2RNA A;  1AD5 A;  1UG1 A;  4J9I A;  2RN8 A;  1WI7 A;  4F17 A;  2CSQ A;  1MV0 B;  1I0C A;  4JJB A;  1TG0 A;  2C0O A;  2CT4 A;  2JMC A;  1AZE A;  5FW9 A;  3TVT A;  1JU5 C;  1H8K A;  2LJ1 A;  2OI3 A;  4ESR A;  3QWY A;  1E6G A;  2JS2 A;  2C0I A;  3VS4 A;  1QKW A;  1SEM A;  2DLP A;  2GBQ A;  2KYB A;  1AWJ A;  2CH4 W;  2GTO A;  2EYZ A;  2L3P A;  2K7A A;  4OMM A;  2DNU A;  1WXT A;  3VS2 A;  1KFZ A;  4HVW A;  3UA6 A;  1Z9Q A;  1OOT A;  4AFS C;  1ARK A;  1PRL C;  4KRT A;  2GNC A;  4J9D A;  3VS3 A;  1AZG B;  2EQI A;  2K79 A;  4D8K A;  3M0R A;  3NGP A;  1JXM A;  4J9E A;  2KRO A;  1T0J A;  1NEB A;  2FRY A;  1UJ0 A;  4HCK A;  1BU1 A;  4HVU A;  1KJW A;  2ENM A;  1QWF A;  4HXJ A;  1AOJ A;  2F2X A;  2JM9 A;  2JW4 A;  1FMK A;  1S1N A;  1T3S A;  1KIK A;  2E5K A;  2D8H A;  1X27 A;  1MUZ A;  4AG2 C;  3EG3 A;  2PTK A;  1X6G A;  1M30 A;  2YUP A;  4IIM A;  1TUD A;  2KT8 A;  1WXB A;  1OPK A;  1PNJ A;  1I07 A;  5IHI A;  2KT1 A;  3NMZ C;  2EVR A;  2O9S A;  4QT7 A;  1OEB A;  2NWM A;  3M0U A;  1I1J A;  1OV3 A;  2ABL A;  3RBB B;  1B07 A;  2ESW A;  1RI9 A;  2LJ0 A;  3VRZ A;  3M0T A;  2A37 A;  2DIL A;  2G6F X;  1NLP C;  2RQV A;  1PHT A;  1UFF A;  2MIO A;  2J6O A;  2CUB A;  2LMJ A;  1GBR A;  2D8J A;  5EC7 A;  4RTV A;  4Y92 A;  4LN2 A;  1H92 A;  1AVZ C;  1U5S A;  2KGT A;  1ZUY A;  2FO0 A;  2KRN A;  2YSQ A;  1PKT A;  1QLY A;  3REA B;  1VYU A;  4LNP A;  2DL8 A;  2M51 A;  2J7I A;  4RTW A; 
#chains in the Genus database with same CATH topology
 1VQ6 T;  2DE0 X;  3LYI A;  1OPL A;  1S72 T;  2DET A;  3OYJ A;  5FRM A;  1YHQ Q;  1VQN A;  3EFO A;  2EYX A;  1RAH B;  2RM4 A;  3R6O A;  3UAT A;  2RK2 A;  2RI5 A;  5DLQ E;  2CUD A;  2JM8 A;  5LJ3 g;  2OTJ T;  2JUF A;  2VAS A;  2IVW A;  2V8K A;  3RMS A;  4OVA A;  4R56 A;  3X20 B;  1R77 A;  1SSH A;  3I56 T;  5KH6 A;  3EAE A;  4NL3 A;  3VS5 A;  4JRQ A;  4LDW A;  3OYF A;  2QG9 B;  2DBK A;  2AKK A;  1O9S A;  3RR6 A;  4C8Q B;  2D9T A;  4O5V A;  1JEG A;  4A54 A;  2RJF A;  5I21 A;  1G83 A;  2V26 A;  2HCK A;  3ME9 A;  1NLO C;  5GMK m;  1BK2 A;  2NUP A;  3MJX A;  2XK0 A;  4CI0 C;  2M0Y A;  4O6J A;  2W0Z A;  3L2Q A;  4ATO A;  2AZV A;  3F70 A;  3OYG A;  1Q82 C;  2ZZD A;  2YRD A;  4X9D A;  1YJN A;  1UDL A;  2F5K A;  1X2Q A;  1X6B A;  2LT1 A;  2FEI A;  1F1B B;  1QVP A;  1Y0M A;  3PIO A;  3M0S A;  1G8X A;  2X51 A;  1WA7 A;  4Z8A A;  3G71 Q;  3CC7 T;  2K3B A;  3IQL A;  1O75 A;  1NM7 A;  3LX7 A;  2DVE A;  2K57 A;  5GAN 7;  2F69 A;  4KUD K;  2HKN A;  4UC4 A;  4RG8 A;  2EYY A;  5KYX B;  2CZ0 B;  2EGE A;  1RAD B;  1LJO A;  3BFM A;  2VYT A;  5FLX E;  3E1S A;  3OYN A;  5CVI A;  3JB9 F;  2KK4 A;  1JO8 A;  1B34 B;  2MPX C;  3A98 A;  1I4K 1;  1ZUK A;  2K5I A;  3TSW A;  1D3B A;  2QDY B;  1IRX A;  2PVG B;  4FT4 A;  2VWF A;  3DB3 A;  4J9H A;  1GRI A;  1AWO A;  3NFC A;  2AKL A;  1IB8 A;  1VQN Q;  2YHT A;  3VS7 A;  1QVG S;  1D1C A;  3OYI A;  1KHI A;  2DL7 A;  4E6R A;  2YT6 A;  3R6N A;  2EJG A;  2KE9 A;  4RKU E;  1W70 A;  2ROT A;  4QVD A;  2K9G A;  1K4U S;  4IUR A;  3CC4 A;  1X43 A;  4Z88 A;  3ZFJ A;  1YJ9 T;  2JZ2 A;  2P4T A;  2QQR A;  1B3Q A;  4XTY A;  3OS5 A;  2ECZ A;  3C12 A;  1D0Y A;  4OMP A;  1KQS P;  2CP7 A;  2NUZ A;  4JLI A;  4M75 C;  1KQ1 A;  2L3S A;  5GAN 6;  1YIJ A;  4DQ2 A;  3OYY A;  2EQJ A;  3NTK A;  3JB9 D;  2M16 A;  2QQS A;  4QQD A;  1HK9 A;  2O9V A;  2R5A A;  3JB9 J;  2L0A A;  4X1V A;  4OGC A;  2IG0 A;  2IPO B;  3UDC A;  2I2L A;  4PNO A;  2A3L A;  2IIM A;  4KGX B;  2KVQ G;  1ZBJ A;  3BDU A;  3OW2 S;  3TEE A;  3VS0 A;  1BI1 A;  1X2K A;  2RHZ A;  2RK1 A;  1MND A;  1LPL A;  2HBW A;  1YJN Q;  1QKX A;  1VYV A;  2HZY A;  5IT9 E;  2DM1 A;  5IH2 A;  4JRP A;  1UGV A;  3EFR A;  3HFO A;  1MMD A;  4BE0 A;  1VOM A;  4LD9 K;  2CP2 A;  1Y57 A;  4WTO B;  5D6X A;  4XTZ A;  2EFI A;  3ULR B;  1YIT T;  4JZ3 A;  1QVF P;  4JJD A;  3S3M A;  2XI9 A;  3EG2 A;  4E7J A;  2ZPH B;  5J26 A;  3CMA A;  4MML A;  4Y91 A;  3S3O A;  2ZAE A;  2QGF B;  1IGQ A;  2QXF A;  1RAC B;  2LZ6 B;  2F2V A;  4M77 B;  3X24 B;  2FYK A;  3PFS A;  1SRM A;  2HNI A;  1AWW A;  5CKF A;  3CPW S;  3X25 B;  3X28 B;  3QDF A;  4PL6 A;  3OYL A;  3V8J A;  1TSF A;  3O5Z A;  4JUV A;  5FU7 B;  1M3B A;  1EZZ B;  3GNF B;  1UTI A;  1GL5 A;  1YN8 A;  1VQ8 A;  4EMK A;  2D1X A;  1YI2 T;  3CCU T;  1OI1 A;  3L1A A;  4C8Q A;  2BZY A;  1G3T A;  4PKC C;  4GY5 A;  3FJ5 A;  3V8K A;  4C5I A;  5GAN 2;  2CT3 A;  2MWO A;  2F1L A;  3GNG A;  1OYX A;  1JRI A;  1VQ9 A;  1JXO A;  1UJY A;  3CCJ A;  5D6Y A;  4OMO A;  1K73 C;  4C0Z A;  2PUO B;  2K5L A;  8AT1 B;  4M7A F;  3EFS A;  1J3T A;  3CC4 Q;  2KDS A;  1E7O A;  1JB0 E;  5GAO n;  1VQK T;  2DL3 A;  4OML A;  1B7T A;  1ZUU A;  4NOY A;  1G3Y A;  4EPC A;  2LP5 A;  2M02 A;  3FDR A;  3GP8 A;  4M7A B;  1YJW A;  4M78 A;  4RG2 A;  4JDS A;  2EYQ A;  3URG A;  1Y71 A;  2Y4X A;  2HEQ A;  4IKF A;  5CR2 A;  1M2V B;  2KRM A;  2M1H A;  1G3S A;  1M3C A;  3UWN A;  3PVL A;  5KYW A;  5KYX A;  2L8D A;  2AHJ B;  1CSK A;  4OMF B;  4F14 A;  4QKU A;  4M78 G;  2MAM A;  1ACM B;  1OZ3 A;  2H8H A;  1UG1 A;  4BI8 B;  3A8L B;  3JCM P;  3QBY A;  2RN8 A;  3UPU A;  1U1S A;  5C0M A;  3G6E T;  1MV0 B;  4MZM A;  1TG0 A;  2JMC A;  4C8Q C;  3HRS A;  1JU5 C;  4A4H A;  3LWH A;  3QWY A;  4IUT A;  2C0I A;  2XID A;  2ZGW A;  2YXY A;  3FIF A;  2QAS A;  4M7A D;  2DNU A;  4PJJ A;  1Z9Q A;  3SB2 A;  3RMQ A;  3CMA Q;  8ATC B;  1IHV A;  2RHI A;  4C92 G;  4J9D A;  3VS3 A;  1AZG B;  2EQI A;  2K79 A;  4J8O A;  3NGP A;  4ZN3 A;  4J9E A;  2KRO A;  3GF5 A;  4HCK A;  1BU1 A;  4PJO A;  4R55 A;  3QJY A;  2CP0 A;  2JW4 A;  4PFO A;  4E7K A;  1VQ8 Q;  2PTK A;  4M7D B;  3RKY A;  1WXB A;  1OPK A;  4PJO G;  1I07 A;  1VQ6 A;  5A0L A;  3CCM A;  4BD3 A;  2EVR A;  2ATC B;  2O9S A;  1S72 A;  3INZ A;  2QQ9 A;  4QT7 A;  2H3E B;  1OEB A;  3C4S A;  2LT4 A;  4BI4 A;  2ESW A;  1VQ9 Q;  2JNG A;  3M4G A;  1YCY A;  3CCJ Q;  2RQV A;  4ZGE B;  2O01 E;  4RTV A;  4XU3 A;  1H92 A;  3HPW A;  3ZEH A;  3V7S A;  1TTH B;  2RA2 A;  2KRN A;  2YSQ A;  3M53 A;  1K8A R;  2M9U A;  2DL8 A;  3OMC A;  3I56 A;  3SWN A;  2M51 A;  4RTW A;  3TRE A;  1VQ8 T;  1TH7 A;  3PMT A;  3QHS A;  4ZTJ A;  4M7D D;  3HTR A;  2E4H A;  1GCQ A;  2RQR A;  5KYY B;  3TU4 K;  1YJW Q;  1PCX A;  1TUC A;  2YUO A;  2F5T X;  2RD1 A;  1BKB A;  3KFV A;  3JCM b;  1W1F A;  4LXC A;  3ZBD A;  2GQV A;  2LCS A;  2L3R A;  3OSV A;  2JTE A;  1GBQ A;  4M77 A;  4FM4 B;  3LGF A;  1H3Z A;  4XTX A;  3C0C A;  3G7Z A;  2ED0 A;  3LLR A;  3NTH A;  3MKD A;  3PT9 A;  4M4Z A;  2QGG A;  2RPN A;  4HCZ A;  2J6K A;  5CKE A;  3KUF A;  3CPF A;  3TSZ A;  4CC2 A;  1K76 A;  2EIF A;  2DEQ A;  4F7U A;  5GAO p;  3CC7 A;  1NEG A;  1W2B A;  9ATC B;  1EX4 A;  1HYO A;  4C5H A;  2DXC A;  3C94 A;  2AK5 A;  2B8A A;  3OS2 A;  3QPH A;  4FSS A;  2MF2 A;  3QZ9 B;  4A4G A;  3OYC A;  4F7U G;  2BTT A;  2RJD A;  3OS1 A;  7AT1 B;  2VB6 A;  1KC8 C;  5L23 A;  4HA8 A;  4J83 A;  4V2S A;  3UT1 A;  3X26 B;  2V1Q A;  2LCL A;  1WLP B;  2QTV A;  2DIQ A;  1EIF A;  1Q95 G;  1BYM A;  5GJW B;  4OB3 B;  4YTL A;  2FL7 A;  5AT1 B;  1GCQ C;  4KGV B;  2K2M A;  4ME7 A;  4Z89 A;  1FYN A;  2KEA A;  2EJF A;  2QQB A;  3QKJ A;  3VYG A;  5GAN 3;  4C0D B;  2CZ6 B;  3CBM A;  3A8H B;  2JMA A;  2DF6 A;  4PFZ A;  1VQ7 A;  1VQ6 Q;  2EJ9 A;  3CCM Q;  2NLU A;  3OY9 A;  1S72 Q;  2EQU A;  1TU0 B;  3EGU A;  4GBQ A;  4M77 C;  4Y28 E;  2QEX T;  2J6F A;  3A8G B;  1ABO A;  4DBQ A;  2J05 A;  1MNE A;  2DVJ A;  3M4Y A;  4A4K A;  3GIB A;  3LH0 A;  4AG1 C;  5FU7 C;  2D0N A;  4BDY A;  2GFU A;  1X69 A;  1MMA A;  4A53 A;  2DFU A;  1ZSZ B;  2K5F A;  1X6O A;  2Y4Y A;  1IHW A;  1QVF S;  1IO6 A;  1Y07 A;  1YJ9 A;  3ZL7 C;  4JJC A;  3I56 Q;  2HL3 A;  1W6X A;  2EWN A;  1OUL A;  1OU9 A;  2KSS A;  3QYG B;  1C1A A;  3CCM T;  1WHH A;  2GGR A;  2CS7 A;  2KY9 A;  3FEO A;  3WXM B;  4A4E A;  3M5A A;  1Q82 R;  2VVK A;  2D0Q B;  1G2B A;  1Q82 U;  1PC0 A;  3MP8 A;  2EW3 A;  3RKX A;  2E10 A;  1UHC A;  3CCS T;  2X4X A;  1T3L A;  4RUG A;  1MHN A;  1E6H A;  1XTD A;  3M57 A;  2RJE A;  4ZGJ B;  2R57 A;  2LCC A;  1PKS A;  2FRW A;  5D7U A;  4M7A C;  4KGZ B;  2BZX A;  3N5B B;  2CRE A;  3THK A;  2DYB A;  3CC7 Q;  1M9S A;  4E7I A;  2YUN A;  3JB9 I;  3TCJ A;  1HD3 A;  4M78 E;  1YIT A;  5FRO A;  3EHR A;  2CP6 A;  1X75 C;  3OYB A;  3L2U A;  2H3J A;  1RUW A;  2DA9 A;  4RCB A;  3MO8 A;  3BE3 A;  4GLM A;  4KUI A;  2DPP B;  2EGC A;  5GAN d;  2F2W A;  3HSB A;  2VGN A;  3M0P A;  4QQG A;  5CK9 A;  1WIE A;  2DO3 A;  3EGD B;  1M8M A;  4OMQ A;  4OMN A;  3H41 A;  1N9R A;  2AIR B;  3E19 A;  5GAN e;  3JCM W;  4C92 E;  4R0K A;  3TQ7 P;  4OB0 B;  2LTO A;  4TVR A;  1PRM C;  4KH1 B;  4BE2 A;  4LE9 A;  1WYX A;  2V1R A;  1VQ7 Q;  3JRZ A;  3CCU A;  1YI2 A;  4CRI A;  5KYY A;  3AHU A;  4HCB A;  5GMK e;  4M75 A;  4AMC A;  3CCV A;  5KYU A;  4X9C A;  2C0T A;  2X3X D;  1R8O B;  2X9H A;  1FX7 A;  3VS1 A;  1YFN A;  4PFP A;  5I11 A;  4PJO E;  2DEU A;  4M75 G;  5GAM d;  2QYZ A;  1AT1 B;  4XU0 A;  4C0G A;  1WDX A;  1YJ9 Q;  4M7D C;  2O88 A;  5HCK A;  2MMP A;  4IIO A;  1JJ2 P;  2DTO A;  4C92 F;  1VQK A;  1VQO A;  4Z02 A;  1VYT A;  1RLQ C;  1VQ7 T;  1M3A A;  5GAM e;  3JCM V;  3DKM A;  1KQ2 A;  2DMO A;  4FT2 A;  1D1B A;  1H3H A;  2O2O A;  4J6X A;  3E9F A;  2Y90 A;  4N0A C;  1Q7Y C;  1AWX A;  2OTL A;  5DM7 R;  4FIB A;  1OX9 A;  1Y96 A;  2JTM A;  1PD1 A;  4EDU A;  2E6N A;  3BY7 A;  4PJL A;  3RNJ A;  1SSF A;  2AT1 B;  4BUG A;  3VV0 A;  3QWX X;  3HL8 A;  4HVV A;  1QW1 A;  1SPK A;  2BE9 B;  2HKQ B;  3G1J A;  4PJO F;  2PVO B;  1WHM A;  1M1F A;  4RTY A;  3G6E A;  4J9B A;  3EG0 A;  1QVG A;  3JCM h;  3LGL A;  3PMI A;  3I55 T;  2JOY A;  4Q5W A;  4BDZ A;  1YIT Q;  3CD6 Q;  2BZ8 A;  3H0I A;  4KBM B;  2DL5 A;  2FPD A;  1XNI A;  4C92 D;  3UF4 A;  3OYD A;  5GAO r;  2LRQ A;  2RQW A;  4AT1 B;  1WFW A;  3CXC P;  1VQM Q;  1WHJ A;  2ZPB B;  1AD5 A;  1M8V A;  2CSQ A;  3O8V A;  2K2V A;  4FYX B;  4JJB A;  3S3N A;  1ZSZ A;  1R0C B;  1AZE A;  4FW1 A;  5FW9 A;  3TVT A;  3M56 A;  1BCM A;  1M1K U;  2OI3 A;  4ESR A;  1BI2 A;  1QKW A;  5GMK l;  5CO7 A;  2DLP A;  2DYI A;  2GBQ A;  2CH4 W;  4DBH A;  2EYZ A;  2L3P A;  2K7A A;  4F7U E;  4OMM A;  1WXT A;  2P0K A;  1YI2 Q;  3CCU Q;  2HBP A;  3UA6 A;  3J80 E;  3HKS A;  1ARK A;  5GAN j;  1PRL C;  5GAN h;  3CD6 T;  3OW2 A;  1VQP A;  1K73 R;  3BW1 A;  5LJ5 d;  2WSC E;  1K73 U;  1ZA1 B;  3CCV Q;  5DY9 A;  5KE2 A;  5M9O A;  1NEB A;  2FRY A;  3P8H A;  1VQM T;  3QG1 A;  5GMK j;  3RDV A;  1KJW A;  5GMK h;  2ENM A;  5LJ5 e;  1AOJ A;  1RAG B;  2F2X A;  1S1N A;  1T3S A;  2HSE B;  4C0D C;  4JJN K;  4AG2 C;  1U8R A;  1X6G A;  1M30 A;  2OX7 A;  1TXQ A;  3V8L A;  2KMT A;  3MCA B;  1TUD A;  2KT8 A;  2RHX A;  1VQO Q;  1VQK Q;  4OP0 A;  2KT1 A;  3NMZ C;  1M1K C;  1FXX A;  4N4I A;  1UGR B;  3A8O B;  3M0U A;  1MMG A;  1OV3 A;  3CPW A;  2E12 A;  1WJS A;  2OTL Q;  3VRZ A;  2JN0 A;  3CCV T;  2A37 A;  4FCY A;  1VIF A;  5GAM j;  1NLP C;  5GAM h;  1UFF A;  2HMA A;  3L2R A;  2VV5 A;  3EGX B;  1ZSZ C;  2XDP A;  5EC7 A;  2RHY A;  4Y92 A;  4C8Q G;  4II1 A;  4LN2 A;  1MMN A;  3EGD A;  2PVD B;  2KGT A;  4LDV A;  1QLY A;  2XU8 A;  2J7I A;  1N9S A;  1VQ5 A;  3G6E Q;  4IUQ A;  1PSF A;  3M59 A;  1VQO T;  1M4Z A;  2O31 A;  3DB4 A;  3NTI A;  3CQT A;  2NUT B;  5FRN A;  3RES A;  1HSQ A;  2DRM A;  3PNW C;  1BIB A;  2M0O A;  2OTL T;  2HQH A;  2XG8 D;  2COW A;  2VKN A;  2E3H A;  5GMK i;  1VQL T;  3V7C A;  2FZG B;  3E9G A;  3OYK A;  2BKD N;  1G5V A;  2HD0 A;  1QWE A;  2PU9 B;  4E2F B;  4LUE A;  2ED1 A;  1UGS B;  5GAN 4;  5GAN f;  1NJI C;  4C0F A;  3GPL A;  1B34 A;  2E3I A;  5CQX A;  4LUD A;  1KD1 C;  3VKI A;  1ZA2 B;  5GJV B;  5A2Q E;  5J39 A;  1VQP Q;  3JB9 H;  1QP2 A;  3HHT B;  4EIK A;  1NE8 A;  5GAO q;  4DA4 A;  3PVQ A;  4GLK A;  2QEX A;  3RER A;  1IRE B;  2SEM A;  2E5Q A;  3OS0 A;  1WHG A;  2QA4 T;  3OYH A;  2A08 A;  3CME T;  2EQM A;  2KRS A;  4B9W A;  1BB9 A;  2CGH A;  2EBP A;  4J7I A;  2E70 A;  4CC4 B;  2RI3 A;  1TS9 A;  1C6V X;  1T0H A;  5LJ5 j;  1WQW A;  5LJ5 h;  1K0S A;  4LDU A;  5GAM f;  3OYA A;  4JS5 A;  4KUL A;  1VQP T;  3G4S T;  2JVV A;  2BE7 D;  3CCE T;  1WQ7 A;  4M75 E;  2PZ1 A;  1K0X A;  3AT1 B;  5IAY A;  1NPP A;  4E47 A;  1I5O B;  3EHQ A;  3CCS A;  1FMW A;  1WX6 A;  2X3W D;  2OJ2 A;  1K9M U;  4HT8 A;  1X01 A;  1P92 A;  2B86 A;  2YLC A;  1U3O A;  3HRT A;  2YRC A;  3QUI A;  1VQ5 Q;  4FW2 A;  2CZ1 B;  5FWB A;  1QMC A;  1W4S A;  2LJ3 A;  3MP1 A;  2I0N A;  3J7A F;  1PSE A;  2E6Z A;  5HK3 A;  3CCL T;  4ZNX A;  1KC8 R;  2ROL A;  4BB7 A;  3OA6 A;  4B9X A;  1KC8 U;  4HKE A;  4RTX A;  4C5E A;  2PQW A;  1OU8 A;  4OB2 B;  4DOV A;  1QQJ A;  1Q81 R;  2DK3 A;  2P4R A;  2YRV A;  2L89 A;  1VA7 A;  4J9F A;  4J7F A;  1HJD A;  1JJ2 S;  3H0F A;  3WVE B;  1Q81 U;  3WVD B;  2A36 A;  3JCM g;  3HFN A;  1YWO A;  1VQ5 T;  2DJZ A;  4PK4 A;  4AFQ C;  1K9M C;  4DEX A;  2RHU A;  3A5Z B;  1YNZ A;  4JS4 A;  4BY6 B;  4M77 G;  4XAX B;  3H6Z A;  3H8Z A;  2DAQ A;  3ER0 A;  3FRN A;  3L42 A;  2A0F B;  1C0M A;  2QTX A;  2FPF A;  4E7S A;  2MWP A;  2RF0 A;  4ELZ C;  1V76 A;  5CAI A;  2L2P A;  2QEX Q;  3VYH B;  4J6Y A;  2LNV A;  1M1G A;  1GCP A;  1D3B B;  1U06 A;  3MEU A;  5LJ5 f;  2VC8 A;  1N5Z A;  1RAA B;  1KQS S;  1NPR A;  2LC4 A;  3FJP A;  4RTZ A;  4JZ4 A;  5KYN A;  2DKG A;  2COZ A;  4OGE A;  4PJM A;  5GAN g;  2DTH A;  4F16 A;  3BDL A;  1Q81 C;  1BI3 A;  1I81 A;  2WAC A;  1M90 C;  1ZSG A;  2DL4 A;  3CXC S;  4M7A A;  2K6D A;  3CC2 T;  4KH0 B;  3NHN A;  4QVZ A;  2EQK A;  3VJP A;  1LVK A;  1KQS A;  5A0G A;  4WF2 A;  2EKO A;  4XTV A;  1M2V A;  4DEY A;  2P0Q A;  2J06 A;  2X4Y A;  4P5N A;  2O4X B;  2QDL A;  3CCS Q;  1I8F A;  2CYZ B;  2DZC A;  4M7A G;  1VQ4 T;  2G3R A;  3EH1 A;  3FB9 A;  2DJQ A;  5KCO A;  4XK8 E;  1TUG B;  2JJ9 A;  2P0P A;  2RJC A;  3OBY A;  2VGM A;  4K11 A;  1UHF A;  2A28 A;  5GAM g;  5L8R E;  1NYF A;  2RQT A;  1V29 B;  4C8Q E;  3I55 A;  4MZT A;  3M55 A;  1YCS B;  1M2O A;  2JTF A;  3JCM d;  3CCQ T;  1QVF A;  2MOX A;  1MV3 A;  2FHD A;  3GBQ A;  5AYF A;  2DER A;  4RMO A;  1FMV A;  2RQU A;  2KBT A;  2CZ7 B;  4HT9 A;  3REB B;  2GQI A;  3JCM e;  5FU6 B;  1WHK A;  1WGS A;  3M0Q A;  2D6F A;  2YDL A;  3VS6 A;  1OZ2 A;  2PUK B;  4J9C A;  1RAF B;  1PD0 A;  4AFU C;  1Q86 C;  1BBZ A;  5C6S A;  1YWP A;  4M7D A;  4PLI A;  5GAN 5;  2KQW A;  3JV3 A;  2WSF E;  1D0Z A;  3CD6 A;  4C8Q F;  2DBM A;  2DRK A;  1IGU A;  3RKW A;  5DLO A;  3VUB A;  2RNA A;  2RI2 A;  2DXU A;  3M9Q A;  4N0A A;  1WI7 A;  4PLL A;  4L5G A;  4F17 A;  4EMK B;  4M7D G;  1VQM A;  3MHX A;  1LNX A;  1BI0 A;  4OF1 A;  1H8K A;  1U1T A;  2LJ1 A;  3MEA A;  3CBP A;  1YHQ T;  1E6G A;  4MDW A;  1KHC A;  1SEM A;  4LD6 A;  1Q7Y R;  3VS2 A;  4AFS C;  1Q7Y U;  1OOT A;  3GOX A;  4KT0 E;  3P8D A;  4KRT A;  1RI0 A;  2XHC A;  1BCO A;  3QJ6 A;  3E2U A;  4D8K A;  3HP9 A;  4M78 F;  3D7S B;  5LL6 S;  1NZ9 A;  1TOV A;  1UJ0 A;  4HVU A;  1QWF A;  4HXJ A;  2KI7 A;  1UGQ B;  2JM9 A;  2XKO C;  5LJ5 g;  1FMK A;  4C8Q D;  6AT1 B;  1KIK A;  1QP3 A;  4M78 B;  3HRU A;  1Y7X A;  3EG3 A;  1VIE A;  4IIM A;  2VXF A;  3PGG A;  3SD4 A;  3OB9 A;  3A8M B;  4XTU A;  4ZTF A;  2XDB A;  1PNJ A;  5IHI A;  4B6M A;  5KYW B;  4BI3 A;  2MYS A;  4JLG A;  2NWM A;  3QZ5 B;  3RBB B;  1B07 A;  3EG9 B;  3I55 Q;  2A7Y A;  2XD0 A;  1KG1 A;  3M0T A;  1ZBX A;  2DIL A;  4L6V 5;  2GFA A;  1PHT A;  2R58 A;  2J6O A;  4C92 B;  1VQL A;  1W2B P;  1GBR A;  2D8J A;  5HK0 A;  2RB6 A;  1U5S A;  4JRI A;  5GAO l;  3G71 T;  2FO0 A;  5HY6 A;  4XQ3 A;  1VYU A;  1MGQ A;  4M78 D;  2XIC A;  3DLM A;  2DXT A;  4OB1 B;  1RL2 A;  2NYS A;  3KXT A;  3OSS C;  2CKK A;  2DD5 A;  4FL6 A;  4JPB W;  3LWI A;  3GLX A;  5LJ3 d;  2P84 A;  1SKU B;  3C95 A;  1JBM A;  1QCN A;  3L2V A;  2RO0 A;  2X4W A;  2SRC A;  2LX9 A;  4PJO B;  1WXU A;  2RMO A;  5LJ3 e;  4RTU A;  4A63 B;  4XTW A;  4XU2 A;  1PM3 A;  4PJN A;  3MEW A;  2HDA A;  2K3X A;  1SHF A;  3CEY A;  2L3Q A;  4BE1 A;  4LDY A;  4M77 E;  2FVU A;  2QA4 A;  2O4X A;  2HSP A;  3JSC A;  3CME A;  5CKB A;  3EG1 A;  4BY6 C;  4E7Z A;  1M1K R;  1EFN A;  2KR3 A;  4QW2 A;  2EYW A;  5CCA A;  1VQN T;  3I35 A;  1GXI E;  3T9N A;  4JRK A;  1RAI B;  4A4F A;  1WNL A;  2HL5 C;  1RAE B;  3A1P A;  4DBF A;  1UE9 A;  4NS5 A;  3OQ5 A;  2QK0 A;  1YP5 A;  2QI2 A;  2K3Y A;  1KSW A;  1V1C A;  4PJO D;  2X35 A;  3G4S A;  3H0H A;  3CCE A;  1ZLM A;  2LQ8 A;  1VUB A;  5CKH A;  2DIG A;  1G3W A;  3SWN B;  1LOJ A;  2ZPG B;  3RIR A;  3VRY A;  4M77 F;  4RTT A;  4RCC A;  4J5Y A;  5A0D A;  3I5R A;  2K4Y A;  3I5S A;  4FSX A;  1AEY A;  1SRL A;  2XMF A;  3JCM Q;  1SG5 A;  2LQN A;  3LH5 A;  1D1A A;  3CCL A;  2CH4 A;  1N6A A;  4N4H A;  4F7U F;  4M7A E;  4QVC A;  1YJN T;  1I5L A;  5GAN 8;  1NBE B;  1NJI R;  1VQL Q;  2MI6 A;  1D09 B;  1KD1 R;  4FYY B;  1NJI U;  3CCR A;  2KYM A;  4F7U B;  3RUX A;  2JS0 A;  1DJ7 B;  3JCM f;  1KD1 U;  2RH2 A;  1N8R R;  1YBY A;  1NYG A;  2DTI A;  4LDX A;  1PWT A;  1N8R U;  1IZ6 A;  3PE0 A;  1XOV A;  4M77 D;  2DD4 A;  2JXB A;  4IUU A;  2CP5 A;  4EMG A;  4J9G A;  4FYV B;  2OAU A;  1ZHI A;  1UEC A;  1ZX6 A;  2DXB A;  2ZCF B;  3L2Z A;  3NPF A;  1K1Z A;  5KCH A;  5FU6 C;  4D6W A;  1RAB B;  2QA4 Q;  3DLL A;  3KBG A;  4QQ6 A;  5LJ3 j;  5LJ3 h;  4CC3 A;  3CME Q;  1YIJ Q;  3OYM A;  2MCN A;  5KE3 A;  2LX7 A;  2W10 A;  4F04 B;  2CDT A;  2GCX A;  2FPE A;  5ECA A;  2PNI A;  2YLB A;  3JCM X;  1HXD A;  2LQW A;  2AZS A;  2FB7 A;  3V7R A;  2BUD A;  1TWB A;  3MP6 A;  4EMH A;  5CKD A;  4ANJ A;  5D6W A;  4WCI A;  1ABQ A;  3JAM E;  2EPD A;  2HQE A;  4ELY C;  5I22 A;  1UB4 A;  3JCM c;  1OQK A;  4M7D E;  1N8R C;  3SHW A;  5CIU A;  4ORZ A;  1SHG A;  3EG9 A;  4MZP A;  5HKC A;  4FU6 A;  3G4S Q;  3CC2 A;  3CCE Q;  3CC4 T;  3FLG A;  4EMK C;  4C92 A;  2R5M A;  3MPU B;  3U23 A;  1LCK A;  2BIV A;  1BIA A;  1QCO A;  1IXD A;  2XDD A;  4C5G A;  4HCC A;  2LQK A;  5I2S A;  3OYE A;  1Z9Z A;  2KNB B;  3SDZ A;  1YIJ T;  3JB9 G;  1VQ4 A;  3EFO B;  3UA7 A;  5EG2 A;  2CP3 A;  5IHN A;  3VU3 C;  2EKH A;  4IUP A;  2FZC B;  3CCL Q;  1ZQ1 A;  2GTJ A;  3QO3 A;  3QYH B;  1H64 1;  1CKA A;  3M58 A;  4M7D F;  4L59 A;  3QII A;  2ZPE B;  1QVG P;  5CQY A;  1GFC A;  3CCQ A;  3CBO A;  3OBW A;  4E7H A;  1CKB A;  1K9M R;  4M78 C;  4X34 A;  2JT4 A;  2KXC A;  2KXD A;  2V8J A;  2EAY A;  3CCR Q;  2X4J A;  5FWC A;  3J81 E;  4VUB A;  1UUE A;  3CMA T;  4N4G A;  1JQQ A;  2HQX A;  5IXB A;  4ZN1 A;  2NUP B;  1M27 C;  2LNH B;  1K9A A;  1UEB A;  2YUQ A;  2GF7 A;  2OAW A;  5LJ3 f;  4C92 C;  1OX8 A;  2WSE E;  2OTJ A;  4NL2 A;  3SFM A;  1WHL A;  4M75 F;  1GFD A;  1QCF A;  3CCR T;  3OW2 P;  1K8A U;  4CC7 A;  2MK5 A;  3P8B B;  4D8D A;  4DOW A;  3I9Q A;  1M90 R;  4AFZ C;  2EGA A;  3PIP A;  2CSI A;  3LW5 E;  4M75 B;  1M90 U;  2FG0 A;  5IHK A;  1YHQ A;  2QAZ A;  4J6W A;  2DX1 A;  3SEM A;  5IXF A;  2YWW A;  5KYU B;  1VQ9 T;  4PJO C;  3Q1J A;  2C06 A;  2HAX A;  3M54 A;  1W2B S;  3CCJ T;  1RLP C;  1JJ2 A;  3CC2 Q;  2VXE A;  1NG2 A;  1A0N B;  5J3B A;  3FC3 A;  2L5Q A;  4J9I A;  4ZGD B;  1KK7 A;  2FZK B;  1I0C A;  3OMG A;  3MET A;  2C0O A;  2CT4 A;  2ZPI B;  3CPW P;  3EGX A;  2DZ9 A;  1YJW T;  3S6W A;  2JS2 A;  2VUB A;  3VS4 A;  1D0X A;  2QQA A;  1VQ4 Q;  1WPY A;  4DBR A;  1WJQ A;  1AHJ B;  3EH2 A;  2KYB A;  1AWJ A;  2GTO A;  4M75 D;  1K8A C;  2V8I A;  1KFZ A;  1R0B G;  4HVW A;  4E7L A;  1Y96 B;  2GNC A;  3L2W A;  2COY A;  3PTA A;  2NUT A;  1WJR A;  2E64 A;  1XJW B;  3M0R A;  3SWN C;  5I2M A;  1JXM A;  1PG5 B;  1T0J A;  1SF9 A;  2LVM A;  3CCQ Q;  3VUZ A;  2Z0W A;  4XU1 A;  2E65 A;  2E41 A;  5IN1 A;  3JCM J;  2KAF A;  2E1H A;  2E5K A;  2D8H A;  1Q86 R;  1X27 A;  1MUZ A;  3MEV A;  3G71 A;  3ASK A;  2YUP A;  1WZO A;  1Q86 U;  3CXC A;  1XQH A;  3QDR B;  1FWZ A;  1I1J A;  1N27 A;  4IUV A;  3QSU A;  2ABL A;  1RI9 A;  2LJ0 A;  3QXE B;  1M5Q 1;  2G6F X;  2MIO A;  2OTJ Q;  1UGP B;  4MDX A;  4FYW B;  2CUB A;  2LMJ A;  4MMK A;  1AVZ C;  1ZUY A;  5GAO m;  1PKT A;  3H9N A;  2ZPF B;  3REA B;  4LNP A;  2LDM A;  4BAC A; 
#chains in the Genus database with same CATH homology
 2DE0 X;  4JPB W;  1OPL A;  2O31 A;  1GCQ A;  3CQT A;  2RQR A;  2EYX A;  1TUC A;  2YUO A;  1HSQ A;  2DRM A;  3KFV A;  3UAT A;  2SRC A;  1W1F A;  2LCS A;  2VKN A;  1WXU A;  2RMO A;  2CUD A;  2JM8 A;  2JTE A;  4RTU A;  1GBQ A;  4A63 B;  3C0C A;  2ED0 A;  2HDA A;  1SHF A;  2L3Q A;  4M4Z A;  1SSH A;  1QWE A;  2RPN A;  4LUE A;  2J6K A;  2HSP A;  2ED1 A;  3VS5 A;  2DBK A;  3EG1 A;  2AKK A;  1EFN A;  3TSZ A;  2KR3 A;  4CC2 A;  1K76 A;  2EYW A;  4LUD A;  3I35 A;  5GJV B;  1NEG A;  1JEG A;  1G83 A;  2HCK A;  1NLO C;  1UE9 A;  1BK2 A;  2AK5 A;  2M0Y A;  1YP5 A;  4EIK A;  2W0Z A;  1KSW A;  1V1C A;  4FSS A;  2AZV A;  3H0H A;  3PVQ A;  2BTT A;  2SEM A;  5L23 A;  1ZLM A;  1UDL A;  1X2Q A;  1X6B A;  2A08 A;  2FEI A;  2V1Q A;  1WLP B;  1Y0M A;  3M0S A;  3VRY A;  2KRS A;  5GJW B;  4RTT A;  1WA7 A;  1GCQ C;  4Z8A A;  2K2M A;  2K3B A;  1FYN A;  2KEA A;  4Z89 A;  1BB9 A;  2EBP A;  3IQL A;  4CC4 B;  3I5R A;  3I5S A;  1AEY A;  1NM7 A;  1T0H A;  2JMA A;  2DF6 A;  1K0S A;  1SRL A;  2XMF A;  2LQN A;  3LH5 A;  3EGU A;  4GBQ A;  2CH4 A;  2EYY A;  2EGE A;  2J6F A;  2PZ1 A;  1K0X A;  1ABO A;  2J05 A;  2DVJ A;  3EHQ A;  4AG1 C;  2D0N A;  1X69 A;  1JO8 A;  1WX6 A;  2X3W D;  2OJ2 A;  3A98 A;  2KYM A;  1ZUK A;  3TSW A;  1IO6 A;  2B86 A;  2JS0 A;  1U3O A;  3ZL7 C;  4JJC A;  1W6X A;  5FWB A;  1NYG A;  2VWF A;  2LJ3 A;  4J9H A;  2I0N A;  1GRI A;  1AWO A;  1PWT A;  2AKL A;  4ZNX A;  3PE0 A;  2GGR A;  1XOV A;  2JXB A;  2VVK A;  2ROL A;  3VS7 A;  1G2B A;  4J9G A;  2DL7 A;  4E6R A;  2YT6 A;  4RTX A;  2EW3 A;  1UEC A;  1ZX6 A;  3R6N A;  1UHC A;  2KE9 A;  1W70 A;  2ROT A;  2P4R A;  4J9F A;  1T3L A;  1VA7 A;  3NPF A;  1K1Z A;  2K9G A;  4RUG A;  1HJD A;  1K4U S;  1X43 A;  3H0F A;  4Z88 A;  1E6H A;  2A36 A;  1B3Q A;  4CC3 A;  1PKS A;  2ECZ A;  2FRW A;  4OMP A;  1YWO A;  2MCN A;  2NUZ A;  2LX7 A;  4AFQ C;  2BZX A;  2W10 A;  2L3S A;  4DEX A;  2CDT A;  2FPE A;  5ECA A;  2PNI A;  2CRE A;  1YNZ A;  2AZS A;  2LQW A;  3THK A;  2DYB A;  2YUN A;  2O9V A;  1HD3 A;  4WCI A;  1ABQ A;  2EPD A;  2L0A A;  3EHR A;  5I22 A;  4X1V A;  2FPF A;  1RUW A;  2DA9 A;  2IIM A;  2RF0 A;  3SHW A;  4ORZ A;  1SHG A;  4GLM A;  1ZBJ A;  2EGC A;  2L2P A;  2F2W A;  3VS0 A;  1X2K A;  1GCP A;  3M0P A;  2HBW A;  1WIE A;  1U06 A;  1QKX A;  1M8M A;  1VYV A;  3U23 A;  4OMQ A;  1LCK A;  4OMN A;  2DM1 A;  1N5Z A;  3H41 A;  5IH2 A;  4RTZ A;  1UGV A;  4JZ4 A;  1Z9Z A;  2KNB B;  4R0K A;  4F16 A;  1Y57 A;  1PRM C;  3ULR B;  3UA7 A;  4JZ3 A;  1WYX A;  2V1R A;  4LE9 A;  4JJD A;  5IHN A;  3EG2 A;  1ZSG A;  2EKH A;  2DL4 A;  2K6D A;  2LZ6 B;  3NHN A;  2GTJ A;  2F2V A;  1CKA A;  1SRM A;  2C0T A;  1AWW A;  4DEY A;  2X3X D;  2J06 A;  1GFC A;  3VS1 A;  5I11 A;  2QDL A;  1CKB A;  3O5Z A;  1M3B A;  2JT4 A;  2KXC A;  2KXD A;  1UTI A;  1WDX A;  1GL5 A;  1YN8 A;  2O88 A;  5FWC A;  2D1X A;  2DJQ A;  5HCK A;  4IIO A;  1UUE A;  2BZY A;  1JQQ A;  1VYT A;  1RLQ C;  5IXB A;  1M3A A;  3FJ5 A;  4K11 A;  2DMO A;  1UHF A;  2A28 A;  2CT3 A;  1M27 C;  1NYF A;  1H3H A;  2RQT A;  2O2O A;  2LNH B;  1K9A A;  1AWX A;  1YCS B;  2YUQ A;  2OAW A;  1JXO A;  1UJY A;  4OMO A;  2MOX A;  1MV3 A;  3GBQ A;  1GFD A;  1J3T A;  3RNJ A;  3QWX X;  2RQU A;  1QCF A;  2KBT A;  4HVV A;  1SPK A;  1E7O A;  4CC7 A;  3REB B;  2GQI A;  4RTY A;  2DL3 A;  3M0Q A;  4J9B A;  1ZUU A;  4OML A;  4D8D A;  3I9Q A;  4AFZ C;  2EGA A;  2YDL A;  3VS6 A;  3EG0 A;  4J9C A;  2LP5 A;  2CSI A;  2FG0 A;  5IHK A;  4AFU C;  2DX1 A;  1BBZ A;  3SEM A;  1YWP A;  5IXF A;  2HEQ A;  2BZ8 A;  2KRM A;  3H0I A;  2DL5 A;  2FPD A;  1M3C A;  3JV3 A;  3PVL A;  1RLP C;  2DBM A;  2DRK A;  3UF4 A;  1CSK A;  4F14 A;  1NG2 A;  2RQW A;  1A0N B;  1WFW A;  2H8H A;  2RNA A;  1AD5 A;  1UG1 A;  4J9I A;  2RN8 A;  1WI7 A;  4F17 A;  2CSQ A;  1MV0 B;  1I0C A;  4JJB A;  1TG0 A;  2C0O A;  2CT4 A;  2JMC A;  1AZE A;  5FW9 A;  3TVT A;  1JU5 C;  1H8K A;  2LJ1 A;  2OI3 A;  4ESR A;  3QWY A;  1E6G A;  2JS2 A;  2C0I A;  3VS4 A;  1QKW A;  1SEM A;  2DLP A;  2GBQ A;  2KYB A;  1AWJ A;  2CH4 W;  2GTO A;  2EYZ A;  2L3P A;  2K7A A;  4OMM A;  2DNU A;  1WXT A;  3VS2 A;  1KFZ A;  4HVW A;  3UA6 A;  1Z9Q A;  1OOT A;  4AFS C;  1ARK A;  1PRL C;  4KRT A;  2GNC A;  4J9D A;  3VS3 A;  1AZG B;  2EQI A;  2K79 A;  4D8K A;  3M0R A;  3NGP A;  1JXM A;  4J9E A;  2KRO A;  1T0J A;  1NEB A;  2FRY A;  1UJ0 A;  4HCK A;  1BU1 A;  4HVU A;  1KJW A;  2ENM A;  1QWF A;  4HXJ A;  1AOJ A;  2F2X A;  2JM9 A;  2JW4 A;  1FMK A;  1S1N A;  1T3S A;  1KIK A;  2E5K A;  2D8H A;  1X27 A;  1MUZ A;  4AG2 C;  3EG3 A;  2PTK A;  1X6G A;  1M30 A;  2YUP A;  4IIM A;  1TUD A;  2KT8 A;  1WXB A;  1OPK A;  1PNJ A;  1I07 A;  5IHI A;  2KT1 A;  3NMZ C;  2EVR A;  2O9S A;  4QT7 A;  1OEB A;  2NWM A;  3M0U A;  1I1J A;  1OV3 A;  2ABL A;  3RBB B;  1B07 A;  2ESW A;  1RI9 A;  2LJ0 A;  3VRZ A;  3M0T A;  2A37 A;  2DIL A;  2G6F X;  1NLP C;  2RQV A;  1PHT A;  1UFF A;  2MIO A;  2J6O A;  2CUB A;  2LMJ A;  1GBR A;  2D8J A;  5EC7 A;  4RTV A;  4Y92 A;  4LN2 A;  1H92 A;  1AVZ C;  1U5S A;  2KGT A;  1ZUY A;  2FO0 A;  2KRN A;  2YSQ A;  1PKT A;  1QLY A;  3REA B;  1VYU A;  4LNP A;  2DL8 A;  2M51 A;  2J7I A;  4RTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...