2JM8A

R21a spc-sh3 free
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
62
structure length
62
Chain Sequence
b'MDETGKELVLALYDYQEKSPAEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title The high-resolution NMR structure of the R21A Spc-SH3:P41 complex: Understanding the determinants of binding affinity by comparison with Abl-SH3
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 14
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jm8A00
1WLPB 3VS3A 4FSSA 3I5RA 2EYZA 2K2MA 2EKHA 4Z88A 2O9VA 2YDLA 2DYBA 2PNIA 4AFQC 4E6RA 4JPBW 3H0FA 2DX1A 2GTOA 3VS1A 2J7IA 1JXMA 2C0OA 1T0HA 1X43A 1ZUYA 2LX7A 2VWFA 1E6GA 2X3XD 2A08A 4Z89A 2LNHB 1RI9A 1KJWA 2G6FX 4Z8AA 4CC7A 2RQRA 2ED1A 2DM1A 2K6DA 2KRSA 1AD5A 4RTYA 5ECAA 2YT6A 2SEMA 2KEAA 4WCIA 2LQWA 3SHWA 4DEYA 3VS6A 1T3SA 5I22A 1KIKA 2KYMA 3A98A 1UTIA 1ZBJA 1X2QA 1GRIA 1W1FA 1JXOA 1NEBA 1SRLA 1UECA 3H0IA 4X1VA 5EC7A 3GBQA 1PRMC 2LJ1A 2JS2A 2RPNA 3VS0A 1K1ZA 3QWYA 1M8MA 1M27C 2SRCA 2GGRA 3SEMA 2EW3A 2DE0X 2K79A 1PHTA 4LNPA 5L23A 1B07A 4J9CA 2FRYA 2IIMA 2CSQA 1SPKA 1SRMA 1TUDA 1W70A 4F16A 1ZUUA 1QWEA 4OMMA 2KRNA 2HEQA 2HSPA 2RNAA 4ORZA 1NLPC 1CKBA 1CKAA 1ZSGA 1UDLA 3EG0A 2D8JA 1W6XA 3UF4A 2VKNA 4KRTA 1BB9A 1E6HA 2AK5A 3PE0A 3ZL7C 1RLQC 1U06A 2KT1A 2JXBA 3FJ5A 1SEMA 1PWTA 3UA6A 2J05A 2ENMA 2K3BA 2MCNA 1H8KA 3REAB 3PVLA 2FPEA 2DLPA 2EYXA 2JM8A 2C0TA 2ED0A 5GJWB 1I0CA 2F2WA 1RUWA 1M3BA 2D0NA 2LP5A 2GTJA 2OAWA 1KFZA 2DNUA 4RTZA 2O31A 3REBB 2FRWA 2NUZA 1ABOA 2O88A 4D8DA 5IHKA 1A0NB 1X6GA 4GBQA 2C0IA 1B3QA 2D8HA 2RMOA 3EHRA 3JV3A 2DL7A 2KROA 3ULRB 4Y92A 1Z9ZA 4IIMA 2B86A 2AKLA 1TG0A 3NGPA 3CQTA 3RBBB 4J9IA 1RLPC 2J06A 4JZ3A 4D8KA 1JEGA 2D1XA 4CC2A 5FWBA 3EG3A 1BU1A 2LZ6B 2P4RA 3R6NA 4J9BA 3IQLA 1EFNA 2ABLA 1QKXA 2FPDA 1JU5C 1AWXA 2JS0A 1YCSB 3EHQA 3M0TA 1K0XA 1U5SA 1UUEA 4OMLA 1JO8A 1WYXA 3TVTA 1K76A 3QWXX 2KE9A 4A63B 2HBWA 2JT4A 4J9HA 2KNBB 2DVJA 1OPKA 2MIOA 5FWCA 1CSKA 2YUQA 4R0KA 1MUZA 1UG1A 1GCPA 3M0SA 2A36A 2J6OA 4J9DA 2CUBA 1PNJA 3EG2A 2EPDA 2CH4A 4ZNXA 4HVVA 4GLMA 2LCSA 2A37A 2GNCA 2RQWA 3M0UA 4JJCA 4DEXA 1AVZC 1UJ0A 3H41A 2GBQA 1PKSA 3VS5A 3I5SA 3M0RA 2DRKA 2EQIA 4M4ZA 1WI7A 2JW4A 2M0YA 1WIEA 1NM7A 3I35A 1H92A 1ZUKA 4QT7A 1YWOA 2KXCA 3C0CA 2RQUA 1JQQA 1OOTA 1Z9QA 2E5KA 2CUDA 4RTWA 2YUOA 1AWJA 2DJQA 2FPFA 1AZGB 2EYYA 2V1RA 2MOXA 2L0AA 2FG0A 4HCKA 5GJVB 5FW9A 2YUPA 1SSHA 2F2XA 4LN2A 1BK2A 1S1NA 2HCKA 3VRYA 2JMCA 2F2VA 1HD3A 2KT8A 4RUGA 1GCQC 1UHFA 4OMQA 4RTXA 3UA7A 1QLYA 2DL5A 4HVUA 2RQTA 4RTVA 2LMJA 1MV0B 1NLOC 1WX6A 2H8HA 3PVQA 4LUDA 5IHIA 1U3OA 1AZEA 2M51A 1H3HA 1T3LA 2PZ1A 2ROTA 1WA7A 1LCKA 3TSWA 1AWWA 4AFZC 2PTKA 2NWMA 1SHFA 4J9FA 1NYGA 1PKTA 2LJ3A 2YSQA 2L3QA 2W10A 1M3CA 2KR3A 4K11A 1WXUA 2J6FA 3TSZA 1ARKA 2GQIA 2W0ZA 1BBZA 1WDXA 1YNZA 1UGVA 4JJBA 1GCQA 2EBPA 2KXDA 3M0QA 1X69A 3NHNA 4CC3A 1KSWA 2CREA 5IXBA 5HCKA 2FO0A 1K4US 1VA7A 2CH4W 1VYUA 1XOVA 1ABQA 2EGEA 1HJDA 4AFSC 2DILA 1OPLA 1WXTA 2BZ8A 2JM9A 1UHCA 1TUCA 4J9EA 1V1CA 2RF0A 2DL3A 4J9GA 4RTUA 1X6BA 1QWFA 3EG1A 1M3AA 1T0JA 2KRMA 1ZX6A 4JJDA 1WXBA 4AFUC 2AKKA 2DBKA 2HDAA 1NG2A 1PRLC 1GBRA 1VYTA 2I0NA 1YP5A 2A28A 4OMOA 1ZLMA 1K9AA 2JMAA 3U23A 2KGTA 2DBMA 1AOJA 1I1JA 3VS7A 1I07A 2LQNA 4JZ4A 3NPFA 2ECZA 2EVRA 2JTEA 1NYFA 5IH2A 1G83A 1YWPA 3H0HA 3VS4A 1QCFA 2DF6A 2OJ2A 4CC4B 1OEBA 1M30A 1Y0MA 2EGAA 1HSQA 1G2BA 4LUEA 4ESRA 1GFDA 3RNJA 1E7OA 5IXFA 2VVKA 1VYVA 2O2OA 2KYBA 4RTTA 1UE9A 2DMOA 2BZXA 3KFVA 2CSIA 3THKA 1GFCA 2EGCA 1K0SA 5IHNA 1GL5A 1FYNA 1SHGA 2BTTA 3M0PA 3NMZC 2XMFA 2X3WD 3VRZA 2K9GA 1AEYA 2AZSA 2QDLA 1J3TA 4F17A 2KBTA 2V1QA 4F14A 2L2PA 2OI3A 3UATA 1X27A 2CDTA 1UJYA 2K7AA 4HVWA 2BZYA 1FMKA 2DA9A 3VS2A 2CT3A 4EIKA 2AZVA 2J6KA 3I9QA 1AWOA 2L3SA 2RQVA 3O5ZA 4OMPA 2DL8A 5I11A 2EYWA 1OV3A 3LH5A 1GBQA 1QKWA 2RN8A 4HXJA 3EGUA 1Y57A 1NEGA 1UFFA 4OMNA 4LE9A 1N5ZA 4IIOA 4AG2C 2ESWA 2DRMA 2O9SA 2ROLA 1IO6A 2L3PA 1YN8A 1X2KA 2CT4A 2LJ0A 1WFWA 2DL4A 2YUNA 4AG1C 1MV3A 2FEIA
chains in the Genus database with same CATH superfamily
3BY7A 1QVGS 5GAN4 4OF1A 5IN1A 3I5RA 4IUVA 4FM4B 2YDLA 4FW2A 2HQEA 1D0YA 2PNIA 4PFOA 1WHHA 4QVCA 1JXMA 2R5AA 2JZ2A 3BE3A 5GANe 1N9SA 2MK5A 4OB0B 2RK2A 4JRQA 2LNHB 2RQRA 3VYGA 2VGMA 4M75B 2VYTA 3SHWA 4E7LA 3CCRT 2K3XA 1ZBJA 2CZ1B 1X2QA 4PJLA 1BI2A 4B9XA 3CCUT 1VQ7A 1AT1B 5GAN2 1JXOA 2ZPHB 2DTIA 4X1VA 1YBYA 5EC7A 4FSXA 1M2VB 2M16A 4J7FA 3QWYA 1M8MA 3M53A 2XDDA 2D9TA 4ME7A 4C92G 1G3TA 5KYWA 1B07A 4J9CA 1X6OA 2FRYA 2L89A 1BCOA 1QMCA 4M7AB 1U8RA 1TUDA 4MZMA 2BUDA 2LT4A 1M1FA 2V8KA 3S3MA 1R8OB 2RB6A 3C4SA 1W2BP 2VB6A 2QQBA 4ORZA 3KBGA 1PCXA 1YFNA 1CKAA 4NL2A 1IXDA 3QYGB 1W6XA 4FW1A 2RHXA 1WPYA 3PE0A 1YJNA 3L2UA 4PJOA 1U06A 3QYHB 1SEMA 1PWTA 1D0ZA 2J05A 2ENMA 2MCNA 4ZN1A 2DLPA 2RJFA 2C0TA 2ED0A 2CZ0B 2ZPFB 4UC4A 5GJWB 2PVOB 4PNOA 2F2WA 2LP5A 2YRCA 3VKIA 4A4GA 3J81E 2DNUA 2LCCA 1OI1A 1I5OB 1YIJQ 2H3EB 2O88A 3MP8A 2LTOA 1D09B 3UT1A 1ZSZA 4GBQA 2RHZA 3HPWA 2Y4YA 3PTAA 1F1BB 1Z9ZA 4IIMA 2B86A 2AKLA 4PFPA 3QPHA 4FIBA 1QVGP 1BI0A 4J9IA 3FC3A 2J06A 2DIGA 2JOYA 4JZ3A 5FU7B 5GAMd 2VASA 3L42A 1BU1A 1K73U 4C5GA 2P4RA 4J9BA 3IQLA 5GMKm 1EFNA 1WGSA 7AT1B 4C92E 1G3WA 3NTHA 3OBYA 1KD1R 3QG1A 1K76A 2E4HA 2WSEE 3UDCA 4PK4A 1ACMB 2EJ9A 3QSUA 2E6NA 2HBWA 2DETA 1B34B 2DVJA 4RCCA 3HP9A 3I55A 2EYQA 1CSKA 4IURA 1MUZA 1GCPA 3OQ5A 2J6OA 4N4HA 1OU8A 1IRXA 5I2SA 1Q81U 4JDSA 2M9UA 2EPDA 3EGDB 4ZNXA 3RIRA 4HVVA 4M75F 4GLMA 4M78D 5GAMe 3OYNA 4C8QE 2A37A 2VXEA 2GNCA 3M56A 3M0UA 1VQOQ 4M77G 2GBQA 4JLIA 1PKSA 3OS2A 3M0RA 1ZQ1A 1WI7A 1M90R 3RUXA 2M0YA 4J6XA 1YWOA 1R0CB 4R55A 2XHCA 1RAIB 4E7ZA 1OOTA 4RG8A 2E5KA 4XTUA 1LOJA 5HK0A 2H3JA 2K5FA 3GNFB 2FPFA 1QVFA 1AZGB 1QCNA 3JRZA 4QQDA 5D6YA 2LVMA 5KYYB 4M7AF 5CO7A 1VQ5A 2E41A 1IREB 1LPLA 5I21A 3CC2A 2RI3A 3BW1A 2YUPA 1SSHA 2P84A 3CCVA 1V76A 4J6WA 1Q82R 3VRYA 2JMCA 2F2VA 4ZTFA 1HD3A 4BI8B 1NPRA 4M7DD 4OGCA 2NUTA 4L5GA 3JSCA 1QLYA 4Z02A 2K5LA 5D7UA 2XKOC 4HVUA 3G6EA 3LGLA 2M1HA 3WXMB 2LMJA 3PVQA 2CP5A 4F7UB 1AZEA 2QGFB 3DB3A 3JB9F 2ZPGB 5KYNA 3H9NA 3TSWA 2E70A 2PTKA 5GMKi 1SHFA 4J8OA 3UWNA 1VQ7T 2YRVA 3S3OA 4K11A 3CBOA 3M58A 4C5HA 2GQIA 1YNZA 2DTOA 2EBPA 2KXDA 4CC3A 3NHNA 4LDWA 2GF7A 5HCKA 1VA7A 1OQKA 2VXFA 1OULA 2AHJB 4M77E 1OPLA 2BZ8A 4J9EA 4M75A 1V1CA 5A0LA 3G4SQ 4RTUA 3X20B 1X6BA 3RMQA 3EG1A 2DJZA 2DYIA 2KVQG 2FZGB 2KY9A 2E65A 1Q7YU 1WXBA 2DTHA 5LJ5g 1NJIR 2PVDB 3GOXA 1GBRA 2MI6A 1VYTA 1TUGB 2I0NA 3HRUA 2A28A 1M2VA 1ZLMA 1VQ9A 1LJOA 3U23A 2KGTA 5GAOr 2DBMA 3VS7A 1YJNT 2LQNA 3FB9A 3P8HA 1K8AU 4JZ4A 5GAN6 2K4YA 1VQKA 2QEXT 3MP6A 4C0DC 3CCMA 1KK7A 1WQWA 2DF6A 1BKBA 1G2BA 3JCMX 2O01E 3CC4A 1Y96A 3PT9A 3V7SA 4BB7A 1UE9A 2DMOA 4GLKA 5GAOq 1GL5A 2QA4T 3BDLA 1SHGA 4AT1B 1JJ2S 3VRZA 2K9GA 1AEYA 5J26A 1MMGA 3LWHA 2KBTA 1ZHIA 2DFUA 4OB2B 2MWOA 3PNWC 3UATA 1QP3A 1SG5A 1FMKA 2PQWA 4EIKA 2P0PA 4LDXA 4C92C 3O5ZA 4HT8A 3EG9B 3TQ7P 4KT0E 2L8DA 2DEUA 1GBQA 1QKWA 4C0DB 3CXCA 3M54A 5LJ3f 5FLXE 4OMNA 4JRKA 1G8XA 4LE9A 4FYWB 4PJOD 1N5ZA 4AG2C 2ESWA 1KQ1A 4N0AA 5GAOp 3E19A 4FCYA 2O9SA 3I55T 4JS5A 1D3BA 1JB0E 4F7UF 1IO6A 2CT4A 1WJSA 4AG1C 3QJ6A 2NWMA 4BE0A 2FEIA 2P0KA 2CZ6B 3VS3A 4BUGA 5KYXB 3ZBDA 5GMKj 2PVGB 3A5ZB 1Y71A 4JJNK 2DYBA 4M78A 3JB9I 2DX1A 2GTOA 3VS1A 2R57A 2BIVA 2ZZDA 1VQ6Q 2CGHA 3EFOA 1HYOA 2EJFA 4QKUA 4XU1A 3OYDA 4Z89A 1RI9A 2G6FX 4Z8AA 5GANg 3OSSC 1FMWA 2DM1A 3CPFA 3EH2A 2KRSA 1AD5A 5ECAA 4C92B 1K73C 3VS6A 2FZKB 2IVWA 3JCMc 2OTJT 5LJ5f 2GFUA 1K9MU 1GRIA 5DLOA 3OA6A 3OMCA 4A4HA 3JAME 1SRLA 3FRNA 1UECA 3H0IA 1RAHB 3VU3C 4XU0A 2JS2A 4PJMA 4JUVA 1KC8U 3VS0A 3OYGA 2KMTA 1K1ZA 2FVUA 1M27C 2SRCA 3SEMA 2DE0X 4LNPA 5D6XA 2OTLA 1KHIA 4M7DA 3CMEQ 2CSQA 3G6ET 3CCLA 3HFOA 5KYYA 1ZUUA 2A7YA 5DLQE 1QWEA 1M5Q1 3CD6Q 4C8QB 4E7SA 2JVVA 2QEXQ 1Q81C 3G71Q 3RR6A 1JJ2P 2RNAA 4HA8A 3OYBA 3EFRA 1XJWB 3GLXA 1ZSGA 2LX9A 1UDLA 3JCMf 5GMKh 3EG0A 4EPCA 2ZGWA 4E47A 2VKNA 5GAOl 3V7CA 4KRTA 2LCLA 1OU9A 1BCMA 1E6HA 2DO3A 4A4FA 9ATCB 3CCSA 1ZA1B 4F7UE 2C06A 3MO8A 2KT1A 2EIFA 2L5QA 4DBQA 3A8OB 1H8KA 4CI0C 2EYXA 3LW5E 2VGNA 4M77C 1G3YA 2QA4Q 4EMHA 2A3LA 1YITT 6AT1B 1X75C 3CCJA 2GTJA 2OAWA 3M9QA 4RTZA 2O31A 2HKQB 4D8DA 3WVEB 3EGXB 3GIBA 2IPOB 1VQ8Q 2HZYA 5CR2A 2D8HA 2EFIA 2BKDN 3CPWA 4Y92A 2QTXA 3DB4A 1V29B 4QQGA 2LC4A 3CCET 1VQ9T 2RHYA 4KGZB 3T9NA 1VQMA 1YJWQ 1VQKT 3M5AA 3EG3A 2LZ6B 4PJOG 4JS4A 2LQ8A 3R6NA 3OYFA 5KYUA 2NUPA 1QKXA 3OYLA 2CS7A 1JU5C 1AWXA 2JS0A 1YCSB 4MZTA 3EHQA 2RJDA 1K0XA 4EMKA 1U5SA 4E7KA 1UUEA 4OMLA 2KK4A 1RABB 3GNGA 4PJJA 3LH0A 3F70A 3TVTA 3QWXX 3FLGA 2KE9A 1OX8A 4WF2A 4M77B 5GANf 2JT4A 4AMCA 2KNBB 1OPKA 2MIOA 1MMDA 1WJQA 3HRSA 2A36A 1IHVA 4J9DA 2CUBA 3EG2A 2CH4A 3HL8A 4C92F 2CZ7B 3OW2A 4M75D 1BIAA 1C6VX 2LCSA 5CAIA 4RMOA 2RQWA 4FT2A 1AVZC 1Q7YC 5GAMg 4DBRA 3UPUA 1QCOA 3OYMA 2IG0A 2OTJQ 3HTRA 2V26A 1WIEA 1NM7A 1H92A 4BD3A 1ZUKA 2DVEA 3PGGA 5C6SA 3C0CA 4BACA 2RQUA 1K8AC 3E1SA 3JCMW 2QK0A 4ZN3A 4E7HA 4NOYA 5GAOn 3OW2P 4RTWA 1VQPA 5DY9A 1Y07A 4J7IA 1VQLA 3BDUA 4M7AD 5CQXA 2LNVA 2FG0A 4B9WA 4C8QF 3G6EQ 5GJVB 5FW9A 1BK2A 3SB2A 1TWBA 3I56A 2LQKA 3MEVA 4RUGA 4A54A 1UHFA 2XI9A 4OMQA 4VUBA 3FDRA 3UA7A 1YHQA 3N5BB 1QVFS 2DL5A 4HCBA 3RESA 2O4XA 2JNGA 4RTVA 1S72A 1WX6A 4CRIA 3PIPA 2H8HA 2QQSA 4LUDA 3M4YA 5IHIA 2MWPA 3P8DA 1T3LA 4J5YA 3JB9D 1WA7A 3HSBA 1YI2Q 4EMGA 2RI5A 2F5TX 1AWWA 1H641 4FYVB 4F04B 1PD1A 4LD6A 1YITQ 1OZ3A 3SDZA 2E12A 2W10A 2GFAA 1WXUA 3OYYA 3TSZA 5GMKe 3TU4K 1ARKA 2Y90A 2W0ZA 1BBZA 1PD0A 1UGVA 2CP3A 3DLMA 1GCQA 3M0QA 1SF9A 1X69A 3SWNC 1N27A 2RHIA 1KQ2A 2CH4W 4FT4A 2OTLT 1WXTA 3CC7A 4NS5A 2P0QA 2F5KA 3OB9A 3CCLT 2DL3A 1Q95G 3CCEQ 1R0BG 3CCQA 1M9SA 1FX7A 2ZCFB 1QWFA 1VIEA 1WQ7A 1LNXA 2HAXA 1ZX6A 3OS1A 1BYMA 2HD0A 4JJDA 2ZPEB 2AKKA 5HY6A 3AHUA 1VQNT 4OMOA 2JMAA 1BIBA 1AOJA 2GQVA 4N4GA 3V7RA 3CCST 2ECZA 1RAFB 2KI7A 4M77F 3M57A 4C5EA 1SSFA 3MCAB 5IH2A 3H0HA 5HK3A 3CCRQ 1VQ4T 5LJ3h 4C8QA 4GY5A 1M30A 1M1KC 3CCUQ 4OP0A 4NL3A 3QDRB 3H6ZA 3S3NA 3CCJT 5IXFA 5GAMf 1QW1A 4M75G 2V8IA 3LX7A 2O2OA 1K9MC 4XTYA 2AIRB 3KFVA 2CSIA 4BY6C 1EZZB 3THKA 3L2QA 1GFCA 1TSFA 1IGQA 2DZ9A 1UGQB 1KC8C 2BTTA 3E9GA 3M0PA 2CP2A 1MNDA 2EQJA 3PMTA 2AZSA 2QDLA 4MZPA 1J3TA 4F17A 5GAN3 4IUTA 1QVPA 2COYA 3J7AF 3ME9A 3AT1B 1X27A 3HFNA 2QI2A 3O8VA 5FRMA 2K7AA 1WJRA 2YLBA 4M7AG 1QVFP 3VS2A 2J6KA 3I9QA 4YTLA 1NZ9A 3CBPA 2L3SA 2RQVA 1Q86U 1I4K1 5LJ5h 5I11A 3LWIA 4IUPA 1G5VA 2HQXA 1OV3A 3LH5A 2ZPIB 4HXJA 3M4GA 3CMAA 3EGUA 5FU6C 1BI3A 3TREA 2I2LA 4IKFA 5GAOm 2LJ0A 1WFWA 3MJXA 3JB9G 1MV3A 1H3ZA 4BY6B 3A8GB 1WLPB 2EQMA 3A1PA 1YIJA 3VJPA 3CXCS 1RI0A 3SFMA 2B8AA 2EYZA 3JCMh 4AFQC 1K73R 1KQSA 4E6RA 3H0FA 3DLLA 2MPXC 2J7IA 2C0OA 1T0HA 1X43A 3JB9H 2LX7A 5FROA 2DKGA 1G3SA 4CC7A 4KBMB 4XAXB 2K6DA 1VQPT 2YT6A 4DEYA 1VQLT 5I22A 2HKNA 2KYMA 3A98A 4XK8E 1W1FA 5LL6S 4M7AA 1NEBA 4QQ6A 5FU6B 3OYAA 5C0MA 2HBPA 2R5MA 4PJOC 2R58A 2CP6A 3QJYA 2RPNA 1Q81R 4DOVA 4IUUA 2JN0A 4OVAA 2EW3A 1RL2A 1PHTA 5L23A 2QASA 2MMPA 4M78G 5LJ3d 2IIMA 1VQNQ 2HSEB 2K57A 2HL5C 2MAMA 4BE1A 5GAN5 2HNIA 1W70A 4F16A 1S72T 2XIDA 2KRNA 2HEQA 1D1CA 1NLPC 1CKBA 1ZSZC 3QHSA 3MPUB 1VQ4Q 3UF4A 2HQHA 3QDFA 5KYWB 1VQOA 5M9OA 1BB9A 2LT1A 2X4WA 3MEUA 3ZL7C 2E5QA 2PU9B 2JXBA 3FJ5A 5A0GA 5CCAA 3X25B 5CIUA 3PVLA 2FPEA 3RMSA 1PG5B 2DIQA 5GANh 2QXFA 3MP1A 1RUWA 1M3BA 3KXTA 2DEQA 5CKBA 4X9DA 3HRTA 1D1BA 1N6AA 4ZTJA 4N4IA 5LJ3e 4M7DG 3REBB 2DZCA 4KGXB 2NUZA 5EG2A 3CEYA 5IHKA 1IHWA 1X6GA 2C0IA 1UEBA 1DJ7B 2RMOA 3L2WA 2QQAA 2KROA 3ULRB 2DAQA 2XDPA 2HL3A 4ELYC 1C0MA 2CP7A 1PC0A 1UGSB 3NGPA 2KSSA 3RBBB 3CXCP 2XDBA 1RLPC 4D8KA 2GCXA 3A8MB 1JEGA 2EKOA 2D1XA 4CC2A 4JRIA 5FWBA 3NTKA 1N8RC 2FZCB 5J3BA 2P4TA 2XG8D 4JLGA 4PLLA 1B34A 2ABLA 2FPDA 1VQ7Q 3RERA 1YCYA 3M0TA 2QYZA 3CPWS 1I8FA 1MMNA 4M78E 4PLIA 5KCOA 1M1GA 2RI2A 1M1KU 1WYXA 3EGDA 4C0ZA 4A63B 1TS9A 2X4XA 4J9HA 1VQ5T 4QVZA 3CC2T 1U1SA 3LYIA 2YUQA 2RK1A 2V8JA 3M0SA 1Q7YR 1WHMA 3CCVT 1XQHA 1PNJA 3QZ9B 3G4SA 4C92D 1KHCA 3C94A 1C1AA 2YLCA 3WVDB 1K8AR 4X9CA 2JUFA 4XTXA 1AHJB 4DEXA 3QIIA 3EFSA 3INZA 3VS5A 3I5SA 3OS5A 4DBHA 3EH1A 1PSEA 1YJNQ 2DRKA 4M4ZA 5GAN8 2EQUA 2JW4A 3X26B 2X4YA 3I35A 4M7DE 1VUBA 4QT7A 3JCMe 2WSFE 5DM7R 1NE8A 1JQQA 3NTIA 3CMAT 8ATCB 4KH0B 3OW2S 1AWJA 3D7SB 2DJQA 2EYYA 1NPPA 2M02A 2OAUA 2MOXA 4C8QD 1TXQA 1O75A 4F7UA 2F2XA 2HCKA 1X01A 2K5IA 1WHKA 1YIJT 2MF2A 1PSFA 2XICA 1FXXA 1WHLA 2RQTA 1EX4A 4M75C 1MV0B 4O5VA 2K2VA 3GP8A 1U3OA 2M51A 4LDVA 2PZ1A 1XTDA 2ROTA 1I5LA 3ZFJA 1TTHB 2F69A 4A53A 2KDSA 2F1LA 3LGFA 4J9FA 1R77A 1NYGA 3L2ZA 4L59A 3JCMP 2LJ3A 2YSQA 2KR3A 4QVDA 1Q86C 3CCMT 2J6FA 4J6YA 4ZGEB 3SD4A 2XD0A 1KSWA 2CREA 4M7AC 1K4US 3I55Q 3CPWP 1Y7XA 2E10A 1ABQA 3CC4T 2DILA 1KD1U 2DPPB 2JM9A 1TUCA 4E2FB 4Y91A 4HCZA 1T0JA 2Y4XA 2DD4A 2RJEA 2XK0A 2HDAA 5KH6A 1O9SA 3NFCA 5I2MA 1M1KR 1VQOT 1K9AA 2YHTA 1I1JA 3OYEA 3NPFA 4M77D 1VQ6A 1K9MR 2KAFA 1YWPA 1W2BA 2D0QB 1QCFA 1MNEA 2RO0A 1Y0MA 1M90U 3LLRA 1VQ5Q 1HSQA 4L6V5 4J83A 1KC8R 4FU6A 3Q1JA 4LUEA 3CC2Q 2RM4A 5CKFA 2OX7A 1GFDA 3RNJA 3CCVQ 2VVKA 1JBMA 2JJ9A 4RTTA 2K3YA 2LRQA 3OYCA 2BZXA 4PFZA 2NLUA 2YRDA 1K0SA 1P92A 1FYNA 4BI4A 5FU7C 2EQKA 3NMZC 3OYIA 2XMFA 2X3WD 2RH2A 4N0AC 8AT1B 3EG9A 2YXYA 1YJ9A 3R6OA 1Q82U 1Y96B 3OYJA 4KH1B 4IUQA 4C0GA 4PJOE 3CMEA 3OMGA 3VYHB 3QBYA 2BZYA 2QAZA 3CD6A 3V8JA 4EDUA 3CMAQ 3V8KA 2QEXA 3G71A 4C8QG 4LDYA 3C12A 1N8RU 1RAAB 4M78C 1D0XA 3FIFA 3OYKA 5LJ3j 2EYWA 1QVGA 2RN8A 3OYHA 5KYXA 2HMAA 3RKWA 5KE2A 2X9HA 4IIOA 4ANJA 1RADB 3FJPA 5GAN7 4ZGDB 3ASKA 2QA4A 1OZ2A 3G7ZA 2DL4A 2BE9B 2QG9B 2YUNA 1GXIE 3META 3G4ST 2DXBA 3OSVA 3HKSA 1I81A 2QTVA 4FSSA 2QDYB 4C92A 5CKDA 2K2MA 2EKHA 4Z88A 2O9VA 1VQ8A 1VQ9Q 2QGGA 4JPBW 3CBMA 1HK9A 1D3BB 1ZUYA 5CK9A 5A2QE 1VQKQ 1M2OA 4M7DC 2VWFA 1E6GA 1JRIA 2X3XD 2A08A 3CCMQ 1KJWA 1UGRB 1NJIU 4FYXB 3OBWA 3X24B 2ED1A 2JTFA 3MEAA 1YJWA 5IAYA 4XTZA 4RTYA 3RKXA 3X28B 5LJ5j 2SEMA 2KEAA 4WCIA 2LQWA 2JTMA 1T3SA 4M78B 1KIKA 2CKKA 3TCJA 3CC4Q 1UTIA 2X51A 1KQSS 1N9RA 1UGPB 3EFOB 4DBFA 3OY9A 3GBQA 1PRMC 1ZA2B 2LJ1A 1IB8A 2GGRA 4Q5WA 2VC8A 3JCMV 5HKCA 4RKUE 2K79A 2VV5A 3KUFA 3SWNB 2FHDA 1SPKA 1SRMA 4PKCC 2Z0WA 4PL6A 4P5NA 4OMMA 2HSPA 2E3IA 3G1JA 3MHXA 2D8JA 3ZEHA 3HHTB 2EAYA 1VQMT 4M7DB 3GPLA 3MKDA 2AK5A 4OGEA 2OTJA 1RLQC 5CKHA 4JRPA 2RD1A 1NBEB 2ATCB 1U1TA 1B7TA 3EGXA 1QP2A 1SKUB 4KGVB 3UA6A 3L2VA 2K3BA 3REAB 3L1AA 2JM8A 1MHNA 1PM3A 4O6JA 1I0CA 2BE7D 1KG1A 4MDXA 4OB1B 2D0NA 4EMKC 1KFZA 3VUBA 1MMAA 2FRWA 2DK3A 1ABOA 4C0FA 2X35A 4DOWA 4KUIA 3M59A 5LJ3g 3H8ZA 1A0NB 1N8RR 1B3QA 3QXEB 3EHRA 3JV3A 2DL7A 2ZAEA 3E9FA 2M0OA 1TG0A 3CQTA 3URGA 1TH7A 2NYSA 3M55A 1HXDA 2WSCE 3E2UA 1VQ6T 4DA4A 2CYZB 4FYYB 4M77A 1YI2A 2KQWA 4OMFB 4M75E 1TU0B 4XU2A 5CVIA 2EJGA 1YITA 1JO8A 2D6FA 1IZ6A 5GANj 1UB4A 1OYXA 1D1AA 2X4JA 4ELZC 2COWA 5KYUB 2E64A 2NUPB 2DD5A 1FWZA 1KQSP 2OTLQ 5FWCA 4XQ3A 3CCLQ 4EMKB 4Y28E 4R0KA 5A0DA 2FB7A 1UG1A 1KD1C 4XTVA 4LDUA 1YJ9T 3A8HB 2RA2A 3I56T 2EWNA 4DQ2A 3CMET 5AYFA 3CCEA 4M7AE 5CQYA 3JB9J 1W4SA 1VIFA 1EIFA 3CD6T 4M78F 4KUDK 1RACB 1YHQT 3G71T 4JJCA 1UJ0A 3H41A 4MMKA 2G3RA 3CCSQ 2EQIA 4FL6A 1M8VA 2KXCA 2YWWA 5KE3A 2DERA 2RHUA 3EAEA 4XU3A 1WHJA 1Z9QA 2CUDA 4A4KA 2YUOA 3JCMg 1RAGB 5KCHA 5AT1B 3CCRA 3CCJQ 2DXTA 2V1RA 3JCMQ 2L0AA 4E7JA 3CCUA 1M90C 4V2SA 2LDMA 4HT9A 2COZA 4HCKA 3PIOA 2XU8A 4BE2A 4TVRA 4LN2A 2CP0A 1S1NA 3GF5A 2KT8A 2E3HA 5GMKl 1GCQC 3CC7T 4M7DF 4MDWA 4E7IA 4RTXA 1VQ8T 3CCQT 4PJOB 5FRNA 1VQMQ 1WNLA 4C5IA 5LJ5d 1NLOC 1RAEB 1Q82C 1H3HA 1Q86R 4X34A 3PFSA 2QQRA 2AT1B 1YJWT 1LCKA 1IGUA 4AFZC 3PMIA 4HKEA 1PKTA 3J80E 2L3RA 1OX9A 2L3QA 2O4XB 1M3CA 1ZSZB 3OS0A 3RDVA 4LXCA 1WDXA 4JJBA 4F7UG 2E6ZA 1MGQA 3A8LB 4BI3A 2FL7A 5J39A 2WACA 5IXBA 2FO0A 4LD9K 1VYUA 1XOVA 2EGEA 1HJDA 4AFSC 4B6MA 4MMLA 2ZPBB 4XTWA 4C8QC 3JCMd 1UHCA 1TOVA 2A0FB 2RF0A 4J9GA 3VUZA 3MEWA 3TEEA 2PUOB 1M3AA 5LJ5e 1QQJA 4A4EA 2KRMA 2PUKB 4RG2A 2DXCA 4AFUC 1M4ZA 2DBKA 1NG2A 5D6WA 1PRLC 4OB3B 1VOMA 1YP5A 4BDZA 2VUBA 2E1HA 4WTOB 3RKYA 1I07A 4D6WA 4II1A 2DXUA 3SWNA 2EVRA 2JTEA 1VQPQ 1NYFA 3C95A 1G83A 1VQLQ 3VS4A 1NJIC 1JJ2A 1WZOA 2OJ2A 4CC4B 1OEBA 2EGAA 5GAMj 4ESRA 3QKJA 1E7OA 1YJ9Q 1VYVA 4PJNA 2KYBA 3I56Q 3BFMA 4ATOA 3JCMJ 2FYKA 2EGCA 5IHNA 1YHQQ 1W2BS 3QUIA 3QO3A 4HCCA 3VV0A 1S72Q 2V1QA 5CKEA 4F14A 2MYSA 4RCBA 4KULA 5IT9E 2L2PA 2OI3A 1VQNA 2CDTA 4ZGJB 1UJYA 4HVWA 5L8RE 3S6WA 2DA9A 2CT3A 2AZVA 3QZ5B 4BDYA 1AWOA 3ER0A 1YI2T 5GANd 1LVKA 4QW2A 1VQ4A 4OMPA 1BI1A 2DL8A 3FEOA 3DKMA 1XNIA 1ZBXA 2NUTB 1Y57A 1NEGA 2RJCA 3L2RA 1UFFA 1WHGA 2QQ9A 4PJOF 3CC7Q 2DRMA 4R56A 3JCMb 2ROLA 3CCQQ 1FMVA 5GAMh 2L3PA 1YN8A 1X2KA 3V8LA 3P8BB
chains in the Genus database with same CATH topology
1WLPB 3VS3A 4FSSA 3I5RA 2EYZA 2K2MA 2EKHA 4Z88A 2O9VA 2YDLA 2DYBA 2PNIA 4AFQC 4E6RA 4JPBW 3H0FA 2DX1A 2GTOA 3VS1A 2J7IA 1JXMA 2C0OA 1T0HA 1X43A 1ZUYA 2LX7A 2VWFA 1E6GA 2X3XD 2A08A 4Z89A 2LNHB 1RI9A 1KJWA 2G6FX 4Z8AA 4CC7A 2RQRA 2ED1A 2DM1A 2K6DA 2KRSA 1AD5A 4RTYA 5ECAA 2YT6A 2SEMA 2KEAA 4WCIA 2LQWA 3SHWA 4DEYA 3VS6A 1T3SA 5I22A 1KIKA 2KYMA 3A98A 1UTIA 1ZBJA 1X2QA 1GRIA 1W1FA 1JXOA 1NEBA 1SRLA 1UECA 3H0IA 4X1VA 5EC7A 3GBQA 1PRMC 2LJ1A 2JS2A 2RPNA 3VS0A 1K1ZA 3QWYA 1M8MA 1M27C 2SRCA 2GGRA 3SEMA 2EW3A 2DE0X 2K79A 1PHTA 4LNPA 5L23A 1B07A 4J9CA 2FRYA 2IIMA 2CSQA 1SPKA 1SRMA 1TUDA 1W70A 4F16A 1ZUUA 1QWEA 4OMMA 2KRNA 2HEQA 2HSPA 2RNAA 4ORZA 1NLPC 1CKBA 1CKAA 1ZSGA 1UDLA 3EG0A 2D8JA 1W6XA 3UF4A 2VKNA 4KRTA 1BB9A 1E6HA 2AK5A 3PE0A 3ZL7C 1RLQC 1U06A 2KT1A 2JXBA 3FJ5A 1SEMA 1PWTA 3UA6A 2J05A 2ENMA 2K3BA 2MCNA 1H8KA 3REAB 3PVLA 2FPEA 2DLPA 2EYXA 2JM8A 2C0TA 2ED0A 5GJWB 1I0CA 2F2WA 1RUWA 1M3BA 2D0NA 2LP5A 2GTJA 2OAWA 1KFZA 2DNUA 4RTZA 2O31A 3REBB 2FRWA 2NUZA 1ABOA 2O88A 4D8DA 5IHKA 1A0NB 1X6GA 4GBQA 2C0IA 1B3QA 2D8HA 2RMOA 3EHRA 3JV3A 2DL7A 2KROA 3ULRB 4Y92A 1Z9ZA 4IIMA 2B86A 2AKLA 1TG0A 3NGPA 3CQTA 3RBBB 4J9IA 1RLPC 2J06A 4JZ3A 4D8KA 1JEGA 2D1XA 4CC2A 5FWBA 3EG3A 1BU1A 2LZ6B 2P4RA 3R6NA 4J9BA 3IQLA 1EFNA 2ABLA 1QKXA 2FPDA 1JU5C 1AWXA 2JS0A 1YCSB 3EHQA 3M0TA 1K0XA 1U5SA 1UUEA 4OMLA 1JO8A 1WYXA 3TVTA 1K76A 3QWXX 2KE9A 4A63B 2HBWA 2JT4A 4J9HA 2KNBB 2DVJA 1OPKA 2MIOA 5FWCA 1CSKA 2YUQA 4R0KA 1MUZA 1UG1A 1GCPA 3M0SA 2A36A 2J6OA 4J9DA 2CUBA 1PNJA 3EG2A 2EPDA 2CH4A 4ZNXA 4HVVA 4GLMA 2LCSA 2A37A 2GNCA 2RQWA 3M0UA 4JJCA 4DEXA 1AVZC 1UJ0A 3H41A 2GBQA 1PKSA 3VS5A 3I5SA 3M0RA 2DRKA 2EQIA 4M4ZA 1WI7A 2JW4A 2M0YA 1WIEA 1NM7A 3I35A 1H92A 1ZUKA 4QT7A 1YWOA 2KXCA 3C0CA 2RQUA 1JQQA 1OOTA 1Z9QA 2E5KA 2CUDA 4RTWA 2YUOA 1AWJA 2DJQA 2FPFA 1AZGB 2EYYA 2V1RA 2MOXA 2L0AA 2FG0A 4HCKA 5GJVB 5FW9A 2YUPA 1SSHA 2F2XA 4LN2A 1BK2A 1S1NA 2HCKA 3VRYA 2JMCA 2F2VA 1HD3A 2KT8A 4RUGA 1GCQC 1UHFA 4OMQA 4RTXA 3UA7A 1QLYA 2DL5A 4HVUA 2RQTA 4RTVA 2LMJA 1MV0B 1NLOC 1WX6A 2H8HA 3PVQA 4LUDA 5IHIA 1U3OA 1AZEA 2M51A 1H3HA 1T3LA 2PZ1A 2ROTA 1WA7A 1LCKA 3TSWA 1AWWA 4AFZC 2PTKA 2NWMA 1SHFA 4J9FA 1NYGA 1PKTA 2LJ3A 2YSQA 2L3QA 2W10A 1M3CA 2KR3A 4K11A 1WXUA 2J6FA 3TSZA 1ARKA 2GQIA 2W0ZA 1BBZA 1WDXA 1YNZA 1UGVA 4JJBA 1GCQA 2EBPA 2KXDA 3M0QA 1X69A 3NHNA 4CC3A 1KSWA 2CREA 5IXBA 5HCKA 2FO0A 1K4US 1VA7A 2CH4W 1VYUA 1XOVA 1ABQA 2EGEA 1HJDA 4AFSC 2DILA 1OPLA 1WXTA 2BZ8A 2JM9A 1UHCA 1TUCA 4J9EA 1V1CA 2RF0A 2DL3A 4J9GA 4RTUA 1X6BA 1QWFA 3EG1A 1M3AA 1T0JA 2KRMA 1ZX6A 4JJDA 1WXBA 4AFUC 2AKKA 2DBKA 2HDAA 1NG2A 1PRLC 1GBRA 1VYTA 2I0NA 1YP5A 2A28A 4OMOA 1ZLMA 1K9AA 2JMAA 3U23A 2KGTA 2DBMA 1AOJA 1I1JA 3VS7A 1I07A 2LQNA 4JZ4A 3NPFA 2ECZA 2EVRA 2JTEA 1NYFA 5IH2A 1G83A 1YWPA 3H0HA 3VS4A 1QCFA 2DF6A 2OJ2A 4CC4B 1OEBA 1M30A 1Y0MA 2EGAA 1HSQA 1G2BA 4LUEA 4ESRA 1GFDA 3RNJA 1E7OA 5IXFA 2VVKA 1VYVA 2O2OA 2KYBA 4RTTA 1UE9A 2DMOA 2BZXA 3KFVA 2CSIA 3THKA 1GFCA 2EGCA 1K0SA 5IHNA 1GL5A 1FYNA 1SHGA 2BTTA 3M0PA 3NMZC 2XMFA 2X3WD 3VRZA 2K9GA 1AEYA 2AZSA 2QDLA 1J3TA 4F17A 2KBTA 2V1QA 4F14A 2L2PA 2OI3A 3UATA 1X27A 2CDTA 1UJYA 2K7AA 4HVWA 2BZYA 1FMKA 2DA9A 3VS2A 2CT3A 4EIKA 2AZVA 2J6KA 3I9QA 1AWOA 2L3SA 2RQVA 3O5ZA 4OMPA 2DL8A 5I11A 2EYWA 1OV3A 3LH5A 1GBQA 1QKWA 2RN8A 4HXJA 3EGUA 1Y57A 1NEGA 1UFFA 4OMNA 4LE9A 1N5ZA 4IIOA 4AG2C 2ESWA 2DRMA 2O9SA 2ROLA 1IO6A 2L3PA 1YN8A 1X2KA 2CT4A 2LJ0A 1WFWA 2DL4A 2YUNA 4AG1C 1MV3A 2FEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WLP B;  3VS3 A;  4FSS A;  3I5R A;  2EYZ A;  2K2M A;  2EKH A;  4Z88 A;  2O9V A;  2YDL A;  2DYB A;  2PNI A;  4AFQ C;  4E6R A;  4JPB W;  3H0F A;  2DX1 A;  2GTO A;  3VS1 A;  2J7I A;  1JXM A;  2C0O A;  1T0H A;  1X43 A;  1ZUY A;  2LX7 A;  2VWF A;  1E6G A;  2X3X D;  2A08 A;  4Z89 A;  2LNH B;  1RI9 A;  1KJW A;  2G6F X;  4Z8A A;  4CC7 A;  2RQR A;  2ED1 A;  2DM1 A;  2K6D A;  2KRS A;  1AD5 A;  4RTY A;  5ECA A;  2YT6 A;  2SEM A;  2KEA A;  4WCI A;  2LQW A;  3SHW A;  4DEY A;  3VS6 A;  1T3S A;  5I22 A;  1KIK A;  2KYM A;  3A98 A;  1UTI A;  1ZBJ A;  1X2Q A;  1GRI A;  1W1F A;  1JXO A;  1NEB A;  1SRL A;  1UEC A;  3H0I A;  4X1V A;  5EC7 A;  3GBQ A;  1PRM C;  2LJ1 A;  2JS2 A;  2RPN A;  3VS0 A;  1K1Z A;  3QWY A;  1M8M A;  1M27 C;  2SRC A;  2GGR A;  3SEM A;  2EW3 A;  2DE0 X;  2K79 A;  1PHT A;  4LNP A;  5L23 A;  1B07 A;  4J9C A;  2FRY A;  2IIM A;  2CSQ A;  1SPK A;  1SRM A;  1TUD A;  1W70 A;  4F16 A;  1ZUU A;  1QWE A;  4OMM A;  2KRN A;  2HEQ A;  2HSP A;  2RNA A;  4ORZ A;  1NLP C;  1CKB A;  1CKA A;  1ZSG A;  1UDL A;  3EG0 A;  2D8J A;  1W6X A;  3UF4 A;  2VKN A;  4KRT A;  1BB9 A;  1E6H A;  2AK5 A;  3PE0 A;  3ZL7 C;  1RLQ C;  1U06 A;  2KT1 A;  2JXB A;  3FJ5 A;  1SEM A;  1PWT A;  3UA6 A;  2J05 A;  2ENM A;  2K3B A;  2MCN A;  1H8K A;  3REA B;  3PVL A;  2FPE A;  2DLP A;  2EYX A;  2JM8 A;  2C0T A;  2ED0 A;  5GJW B;  1I0C A;  2F2W A;  1RUW A;  1M3B A;  2D0N A;  2LP5 A;  2GTJ A;  2OAW A;  1KFZ A;  2DNU A;  4RTZ A;  2O31 A;  3REB B;  2FRW A;  2NUZ A;  1ABO A;  2O88 A;  4D8D A;  5IHK A;  1A0N B;  1X6G A;  4GBQ A;  2C0I A;  1B3Q A;  2D8H A;  2RMO A;  3EHR A;  3JV3 A;  2DL7 A;  2KRO A;  3ULR B;  4Y92 A;  1Z9Z A;  4IIM A;  2B86 A;  2AKL A;  1TG0 A;  3NGP A;  3CQT A;  3RBB B;  4J9I A;  1RLP C;  2J06 A;  4JZ3 A;  4D8K A;  1JEG A;  2D1X A;  4CC2 A;  5FWB A;  3EG3 A;  1BU1 A;  2LZ6 B;  2P4R A;  3R6N A;  4J9B A;  3IQL A;  1EFN A;  2ABL A;  1QKX A;  2FPD A;  1JU5 C;  1AWX A;  2JS0 A;  1YCS B;  3EHQ A;  3M0T A;  1K0X A;  1U5S A;  1UUE A;  4OML A;  1JO8 A;  1WYX A;  3TVT A;  1K76 A;  3QWX X;  2KE9 A;  4A63 B;  2HBW A;  2JT4 A;  4J9H A;  2KNB B;  2DVJ A;  1OPK A;  2MIO A;  5FWC A;  1CSK A;  2YUQ A;  4R0K A;  1MUZ A;  1UG1 A;  1GCP A;  3M0S A;  2A36 A;  2J6O A;  4J9D A;  2CUB A;  1PNJ A;  3EG2 A;  2EPD A;  2CH4 A;  4ZNX A;  4HVV A;  4GLM A;  2LCS A;  2A37 A;  2GNC A;  2RQW A;  3M0U A;  4JJC A;  4DEX A;  1AVZ C;  1UJ0 A;  3H41 A;  2GBQ A;  1PKS A;  3VS5 A;  3I5S A;  3M0R A;  2DRK A;  2EQI A;  4M4Z A;  1WI7 A;  2JW4 A;  2M0Y A;  1WIE A;  1NM7 A;  3I35 A;  1H92 A;  1ZUK A;  4QT7 A;  1YWO A;  2KXC A;  3C0C A;  2RQU A;  1JQQ A;  1OOT A;  1Z9Q A;  2E5K A;  2CUD A;  4RTW A;  2YUO A;  1AWJ A;  2DJQ A;  2FPF A;  1AZG B;  2EYY A;  2V1R A;  2MOX A;  2L0A A;  2FG0 A;  4HCK A;  5GJV B;  5FW9 A;  2YUP A;  1SSH A;  2F2X A;  4LN2 A;  1BK2 A;  1S1N A;  2HCK A;  3VRY A;  2JMC A;  2F2V A;  1HD3 A;  2KT8 A;  4RUG A;  1GCQ C;  1UHF A;  4OMQ A;  4RTX A;  3UA7 A;  1QLY A;  2DL5 A;  4HVU A;  2RQT A;  4RTV A;  2LMJ A;  1MV0 B;  1NLO C;  1WX6 A;  2H8H A;  3PVQ A;  4LUD A;  5IHI A;  1U3O A;  1AZE A;  2M51 A;  1H3H A;  1T3L A;  2PZ1 A;  2ROT A;  1WA7 A;  1LCK A;  3TSW A;  1AWW A;  4AFZ C;  2PTK A;  2NWM A;  1SHF A;  4J9F A;  1NYG A;  1PKT A;  2LJ3 A;  2YSQ A;  2L3Q A;  2W10 A;  1M3C A;  2KR3 A;  4K11 A;  1WXU A;  2J6F A;  3TSZ A;  1ARK A;  2GQI A;  2W0Z A;  1BBZ A;  1WDX A;  1YNZ A;  1UGV A;  4JJB A;  1GCQ A;  2EBP A;  2KXD A;  3M0Q A;  1X69 A;  3NHN A;  4CC3 A;  1KSW A;  2CRE A;  5IXB A;  5HCK A;  2FO0 A;  1K4U S;  1VA7 A;  2CH4 W;  1VYU A;  1XOV A;  1ABQ A;  2EGE A;  1HJD A;  4AFS C;  2DIL A;  1OPL A;  1WXT A;  2BZ8 A;  2JM9 A;  1UHC A;  1TUC A;  4J9E A;  1V1C A;  2RF0 A;  2DL3 A;  4J9G A;  4RTU A;  1X6B A;  1QWF A;  3EG1 A;  1M3A A;  1T0J A;  2KRM A;  1ZX6 A;  4JJD A;  1WXB A;  4AFU C;  2AKK A;  2DBK A;  2HDA A;  1NG2 A;  1PRL C;  1GBR A;  1VYT A;  2I0N A;  1YP5 A;  2A28 A;  4OMO A;  1ZLM A;  1K9A A;  2JMA A;  3U23 A;  2KGT A;  2DBM A;  1AOJ A;  1I1J A;  3VS7 A;  1I07 A;  2LQN A;  4JZ4 A;  3NPF A;  2ECZ A;  2EVR A;  2JTE A;  1NYF A;  5IH2 A;  1G83 A;  1YWP A;  3H0H A;  3VS4 A;  1QCF A;  2DF6 A;  2OJ2 A;  4CC4 B;  1OEB A;  1M30 A;  1Y0M A;  2EGA A;  1HSQ A;  1G2B A;  4LUE A;  4ESR A;  1GFD A;  3RNJ A;  1E7O A;  5IXF A;  2VVK A;  1VYV A;  2O2O A;  2KYB A;  4RTT A;  1UE9 A;  2DMO A;  2BZX A;  3KFV A;  2CSI A;  3THK A;  1GFC A;  2EGC A;  1K0S A;  5IHN A;  1GL5 A;  1FYN A;  1SHG A;  2BTT A;  3M0P A;  3NMZ C;  2XMF A;  2X3W D;  3VRZ A;  2K9G A;  1AEY A;  2AZS A;  2QDL A;  1J3T A;  4F17 A;  2KBT A;  2V1Q A;  4F14 A;  2L2P A;  2OI3 A;  3UAT A;  1X27 A;  2CDT A;  1UJY A;  2K7A A;  4HVW A;  2BZY A;  1FMK A;  2DA9 A;  3VS2 A;  2CT3 A;  4EIK A;  2AZV A;  2J6K A;  3I9Q A;  1AWO A;  2L3S A;  2RQV A;  3O5Z A;  4OMP A;  2DL8 A;  5I11 A;  2EYW A;  1OV3 A;  3LH5 A;  1GBQ A;  1QKW A;  2RN8 A;  4HXJ A;  3EGU A;  1Y57 A;  1NEG A;  1UFF A;  4OMN A;  4LE9 A;  1N5Z A;  4IIO A;  4AG2 C;  2ESW A;  2DRM A;  2O9S A;  2ROL A;  1IO6 A;  2L3P A;  1YN8 A;  1X2K A;  2CT4 A;  2LJ0 A;  1WFW A;  2DL4 A;  2YUN A;  4AG1 C;  1MV3 A;  2FEI A; 
#chains in the Genus database with same CATH topology
 3BY7 A;  1QVG S;  5GAN 4;  4OF1 A;  5IN1 A;  3I5R A;  4IUV A;  4FM4 B;  2YDL A;  4FW2 A;  2HQE A;  1D0Y A;  2PNI A;  4PFO A;  1WHH A;  4QVC A;  1JXM A;  2R5A A;  2JZ2 A;  3BE3 A;  5GAN e;  1N9S A;  2MK5 A;  4OB0 B;  2RK2 A;  4JRQ A;  2LNH B;  2RQR A;  3VYG A;  2VGM A;  4M75 B;  2VYT A;  3SHW A;  4E7L A;  3CCR T;  2K3X A;  1ZBJ A;  2CZ1 B;  1X2Q A;  4PJL A;  1BI2 A;  4B9X A;  3CCU T;  1VQ7 A;  1AT1 B;  5GAN 2;  1JXO A;  2ZPH B;  2DTI A;  4X1V A;  1YBY A;  5EC7 A;  4FSX A;  1M2V B;  2M16 A;  4J7F A;  3QWY A;  1M8M A;  3M53 A;  2XDD A;  2D9T A;  4ME7 A;  4C92 G;  1G3T A;  5KYW A;  1B07 A;  4J9C A;  1X6O A;  2FRY A;  2L89 A;  1BCO A;  1QMC A;  4M7A B;  1U8R A;  1TUD A;  4MZM A;  2BUD A;  2LT4 A;  1M1F A;  2V8K A;  3S3M A;  1R8O B;  2RB6 A;  3C4S A;  1W2B P;  2VB6 A;  2QQB A;  4ORZ A;  3KBG A;  1PCX A;  1YFN A;  1CKA A;  4NL2 A;  1IXD A;  3QYG B;  1W6X A;  4FW1 A;  2RHX A;  1WPY A;  3PE0 A;  1YJN A;  3L2U A;  4PJO A;  1U06 A;  3QYH B;  1SEM A;  1PWT A;  1D0Z A;  2J05 A;  2ENM A;  2MCN A;  4ZN1 A;  2DLP A;  2RJF A;  2C0T A;  2ED0 A;  2CZ0 B;  2ZPF B;  4UC4 A;  5GJW B;  2PVO B;  4PNO A;  2F2W A;  2LP5 A;  2YRC A;  3VKI A;  4A4G A;  3J81 E;  2DNU A;  2LCC A;  1OI1 A;  1I5O B;  1YIJ Q;  2H3E B;  2O88 A;  3MP8 A;  2LTO A;  1D09 B;  3UT1 A;  1ZSZ A;  4GBQ A;  2RHZ A;  3HPW A;  2Y4Y A;  3PTA A;  1F1B B;  1Z9Z A;  4IIM A;  2B86 A;  2AKL A;  4PFP A;  3QPH A;  4FIB A;  1QVG P;  1BI0 A;  4J9I A;  3FC3 A;  2J06 A;  2DIG A;  2JOY A;  4JZ3 A;  5FU7 B;  5GAM d;  2VAS A;  3L42 A;  1BU1 A;  1K73 U;  4C5G A;  2P4R A;  4J9B A;  3IQL A;  5GMK m;  1EFN A;  1WGS A;  7AT1 B;  4C92 E;  1G3W A;  3NTH A;  3OBY A;  1KD1 R;  3QG1 A;  1K76 A;  2E4H A;  2WSE E;  3UDC A;  4PK4 A;  1ACM B;  2EJ9 A;  3QSU A;  2E6N A;  2HBW A;  2DET A;  1B34 B;  2DVJ A;  4RCC A;  3HP9 A;  3I55 A;  2EYQ A;  1CSK A;  4IUR A;  1MUZ A;  1GCP A;  3OQ5 A;  2J6O A;  4N4H A;  1OU8 A;  1IRX A;  5I2S A;  1Q81 U;  4JDS A;  2M9U A;  2EPD A;  3EGD B;  4ZNX A;  3RIR A;  4HVV A;  4M75 F;  4GLM A;  4M78 D;  5GAM e;  3OYN A;  4C8Q E;  2A37 A;  2VXE A;  2GNC A;  3M56 A;  3M0U A;  1VQO Q;  4M77 G;  2GBQ A;  4JLI A;  1PKS A;  3OS2 A;  3M0R A;  1ZQ1 A;  1WI7 A;  1M90 R;  3RUX A;  2M0Y A;  4J6X A;  1YWO A;  1R0C B;  4R55 A;  2XHC A;  1RAI B;  4E7Z A;  1OOT A;  4RG8 A;  2E5K A;  4XTU A;  1LOJ A;  5HK0 A;  2H3J A;  2K5F A;  3GNF B;  2FPF A;  1QVF A;  1AZG B;  1QCN A;  3JRZ A;  4QQD A;  5D6Y A;  2LVM A;  5KYY B;  4M7A F;  5CO7 A;  1VQ5 A;  2E41 A;  1IRE B;  1LPL A;  5I21 A;  3CC2 A;  2RI3 A;  3BW1 A;  2YUP A;  1SSH A;  2P84 A;  3CCV A;  1V76 A;  4J6W A;  1Q82 R;  3VRY A;  2JMC A;  2F2V A;  4ZTF A;  1HD3 A;  4BI8 B;  1NPR A;  4M7D D;  4OGC A;  2NUT A;  4L5G A;  3JSC A;  1QLY A;  4Z02 A;  2K5L A;  5D7U A;  2XKO C;  4HVU A;  3G6E A;  3LGL A;  2M1H A;  3WXM B;  2LMJ A;  3PVQ A;  2CP5 A;  4F7U B;  1AZE A;  2QGF B;  3DB3 A;  3JB9 F;  2ZPG B;  5KYN A;  3H9N A;  3TSW A;  2E70 A;  2PTK A;  5GMK i;  1SHF A;  4J8O A;  3UWN A;  1VQ7 T;  2YRV A;  3S3O A;  4K11 A;  3CBO A;  3M58 A;  4C5H A;  2GQI A;  1YNZ A;  2DTO A;  2EBP A;  2KXD A;  4CC3 A;  3NHN A;  4LDW A;  2GF7 A;  5HCK A;  1VA7 A;  1OQK A;  2VXF A;  1OUL A;  2AHJ B;  4M77 E;  1OPL A;  2BZ8 A;  4J9E A;  4M75 A;  1V1C A;  5A0L A;  3G4S Q;  4RTU A;  3X20 B;  1X6B A;  3RMQ A;  3EG1 A;  2DJZ A;  2DYI A;  2KVQ G;  2FZG B;  2KY9 A;  2E65 A;  1Q7Y U;  1WXB A;  2DTH A;  5LJ5 g;  1NJI R;  2PVD B;  3GOX A;  1GBR A;  2MI6 A;  1VYT A;  1TUG B;  2I0N A;  3HRU A;  2A28 A;  1M2V A;  1ZLM A;  1VQ9 A;  1LJO A;  3U23 A;  2KGT A;  5GAO r;  2DBM A;  3VS7 A;  1YJN T;  2LQN A;  3FB9 A;  3P8H A;  1K8A U;  4JZ4 A;  5GAN 6;  2K4Y A;  1VQK A;  2QEX T;  3MP6 A;  4C0D C;  3CCM A;  1KK7 A;  1WQW A;  2DF6 A;  1BKB A;  1G2B A;  3JCM X;  2O01 E;  3CC4 A;  1Y96 A;  3PT9 A;  3V7S A;  4BB7 A;  1UE9 A;  2DMO A;  4GLK A;  5GAO q;  1GL5 A;  2QA4 T;  3BDL A;  1SHG A;  4AT1 B;  1JJ2 S;  3VRZ A;  2K9G A;  1AEY A;  5J26 A;  1MMG A;  3LWH A;  2KBT A;  1ZHI A;  2DFU A;  4OB2 B;  2MWO A;  3PNW C;  3UAT A;  1QP3 A;  1SG5 A;  1FMK A;  2PQW A;  4EIK A;  2P0P A;  4LDX A;  4C92 C;  3O5Z A;  4HT8 A;  3EG9 B;  3TQ7 P;  4KT0 E;  2L8D A;  2DEU A;  1GBQ A;  1QKW A;  4C0D B;  3CXC A;  3M54 A;  5LJ3 f;  5FLX E;  4OMN A;  4JRK A;  1G8X A;  4LE9 A;  4FYW B;  4PJO D;  1N5Z A;  4AG2 C;  2ESW A;  1KQ1 A;  4N0A A;  5GAO p;  3E19 A;  4FCY A;  2O9S A;  3I55 T;  4JS5 A;  1D3B A;  1JB0 E;  4F7U F;  1IO6 A;  2CT4 A;  1WJS A;  4AG1 C;  3QJ6 A;  2NWM A;  4BE0 A;  2FEI A;  2P0K A;  2CZ6 B;  3VS3 A;  4BUG A;  5KYX B;  3ZBD A;  5GMK j;  2PVG B;  3A5Z B;  1Y71 A;  4JJN K;  2DYB A;  4M78 A;  3JB9 I;  2DX1 A;  2GTO A;  3VS1 A;  2R57 A;  2BIV A;  2ZZD A;  1VQ6 Q;  2CGH A;  3EFO A;  1HYO A;  2EJF A;  4QKU A;  4XU1 A;  3OYD A;  4Z89 A;  1RI9 A;  2G6F X;  4Z8A A;  5GAN g;  3OSS C;  1FMW A;  2DM1 A;  3CPF A;  3EH2 A;  2KRS A;  1AD5 A;  5ECA A;  4C92 B;  1K73 C;  3VS6 A;  2FZK B;  2IVW A;  3JCM c;  2OTJ T;  5LJ5 f;  2GFU A;  1K9M U;  1GRI A;  5DLO A;  3OA6 A;  3OMC A;  4A4H A;  3JAM E;  1SRL A;  3FRN A;  1UEC A;  3H0I A;  1RAH B;  3VU3 C;  4XU0 A;  2JS2 A;  4PJM A;  4JUV A;  1KC8 U;  3VS0 A;  3OYG A;  2KMT A;  1K1Z A;  2FVU A;  1M27 C;  2SRC A;  3SEM A;  2DE0 X;  4LNP A;  5D6X A;  2OTL A;  1KHI A;  4M7D A;  3CME Q;  2CSQ A;  3G6E T;  3CCL A;  3HFO A;  5KYY A;  1ZUU A;  2A7Y A;  5DLQ E;  1QWE A;  1M5Q 1;  3CD6 Q;  4C8Q B;  4E7S A;  2JVV A;  2QEX Q;  1Q81 C;  3G71 Q;  3RR6 A;  1JJ2 P;  2RNA A;  4HA8 A;  3OYB A;  3EFR A;  1XJW B;  3GLX A;  1ZSG A;  2LX9 A;  1UDL A;  3JCM f;  5GMK h;  3EG0 A;  4EPC A;  2ZGW A;  4E47 A;  2VKN A;  5GAO l;  3V7C A;  4KRT A;  2LCL A;  1OU9 A;  1BCM A;  1E6H A;  2DO3 A;  4A4F A;  9ATC B;  3CCS A;  1ZA1 B;  4F7U E;  2C06 A;  3MO8 A;  2KT1 A;  2EIF A;  2L5Q A;  4DBQ A;  3A8O B;  1H8K A;  4CI0 C;  2EYX A;  3LW5 E;  2VGN A;  4M77 C;  1G3Y A;  2QA4 Q;  4EMH A;  2A3L A;  1YIT T;  6AT1 B;  1X75 C;  3CCJ A;  2GTJ A;  2OAW A;  3M9Q A;  4RTZ A;  2O31 A;  2HKQ B;  4D8D A;  3WVE B;  3EGX B;  3GIB A;  2IPO B;  1VQ8 Q;  2HZY A;  5CR2 A;  2D8H A;  2EFI A;  2BKD N;  3CPW A;  4Y92 A;  2QTX A;  3DB4 A;  1V29 B;  4QQG A;  2LC4 A;  3CCE T;  1VQ9 T;  2RHY A;  4KGZ B;  3T9N A;  1VQM A;  1YJW Q;  1VQK T;  3M5A A;  3EG3 A;  2LZ6 B;  4PJO G;  4JS4 A;  2LQ8 A;  3R6N A;  3OYF A;  5KYU A;  2NUP A;  1QKX A;  3OYL A;  2CS7 A;  1JU5 C;  1AWX A;  2JS0 A;  1YCS B;  4MZT A;  3EHQ A;  2RJD A;  1K0X A;  4EMK A;  1U5S A;  4E7K A;  1UUE A;  4OML A;  2KK4 A;  1RAB B;  3GNG A;  4PJJ A;  3LH0 A;  3F70 A;  3TVT A;  3QWX X;  3FLG A;  2KE9 A;  1OX8 A;  4WF2 A;  4M77 B;  5GAN f;  2JT4 A;  4AMC A;  2KNB B;  1OPK A;  2MIO A;  1MMD A;  1WJQ A;  3HRS A;  2A36 A;  1IHV A;  4J9D A;  2CUB A;  3EG2 A;  2CH4 A;  3HL8 A;  4C92 F;  2CZ7 B;  3OW2 A;  4M75 D;  1BIA A;  1C6V X;  2LCS A;  5CAI A;  4RMO A;  2RQW A;  4FT2 A;  1AVZ C;  1Q7Y C;  5GAM g;  4DBR A;  3UPU A;  1QCO A;  3OYM A;  2IG0 A;  2OTJ Q;  3HTR A;  2V26 A;  1WIE A;  1NM7 A;  1H92 A;  4BD3 A;  1ZUK A;  2DVE A;  3PGG A;  5C6S A;  3C0C A;  4BAC A;  2RQU A;  1K8A C;  3E1S A;  3JCM W;  2QK0 A;  4ZN3 A;  4E7H A;  4NOY A;  5GAO n;  3OW2 P;  4RTW A;  1VQP A;  5DY9 A;  1Y07 A;  4J7I A;  1VQL A;  3BDU A;  4M7A D;  5CQX A;  2LNV A;  2FG0 A;  4B9W A;  4C8Q F;  3G6E Q;  5GJV B;  5FW9 A;  1BK2 A;  3SB2 A;  1TWB A;  3I56 A;  2LQK A;  3MEV A;  4RUG A;  4A54 A;  1UHF A;  2XI9 A;  4OMQ A;  4VUB A;  3FDR A;  3UA7 A;  1YHQ A;  3N5B B;  1QVF S;  2DL5 A;  4HCB A;  3RES A;  2O4X A;  2JNG A;  4RTV A;  1S72 A;  1WX6 A;  4CRI A;  3PIP A;  2H8H A;  2QQS A;  4LUD A;  3M4Y A;  5IHI A;  2MWP A;  3P8D A;  1T3L A;  4J5Y A;  3JB9 D;  1WA7 A;  3HSB A;  1YI2 Q;  4EMG A;  2RI5 A;  2F5T X;  1AWW A;  1H64 1;  4FYV B;  4F04 B;  1PD1 A;  4LD6 A;  1YIT Q;  1OZ3 A;  3SDZ A;  2E12 A;  2W10 A;  2GFA A;  1WXU A;  3OYY A;  3TSZ A;  5GMK e;  3TU4 K;  1ARK A;  2Y90 A;  2W0Z A;  1BBZ A;  1PD0 A;  1UGV A;  2CP3 A;  3DLM A;  1GCQ A;  3M0Q A;  1SF9 A;  1X69 A;  3SWN C;  1N27 A;  2RHI A;  1KQ2 A;  2CH4 W;  4FT4 A;  2OTL T;  1WXT A;  3CC7 A;  4NS5 A;  2P0Q A;  2F5K A;  3OB9 A;  3CCL T;  2DL3 A;  1Q95 G;  3CCE Q;  1R0B G;  3CCQ A;  1M9S A;  1FX7 A;  2ZCF B;  1QWF A;  1VIE A;  1WQ7 A;  1LNX A;  2HAX A;  1ZX6 A;  3OS1 A;  1BYM A;  2HD0 A;  4JJD A;  2ZPE B;  2AKK A;  5HY6 A;  3AHU A;  1VQN T;  4OMO A;  2JMA A;  1BIB A;  1AOJ A;  2GQV A;  4N4G A;  3V7R A;  3CCS T;  2ECZ A;  1RAF B;  2KI7 A;  4M77 F;  3M57 A;  4C5E A;  1SSF A;  3MCA B;  5IH2 A;  3H0H A;  5HK3 A;  3CCR Q;  1VQ4 T;  5LJ3 h;  4C8Q A;  4GY5 A;  1M30 A;  1M1K C;  3CCU Q;  4OP0 A;  4NL3 A;  3QDR B;  3H6Z A;  3S3N A;  3CCJ T;  5IXF A;  5GAM f;  1QW1 A;  4M75 G;  2V8I A;  3LX7 A;  2O2O A;  1K9M C;  4XTY A;  2AIR B;  3KFV A;  2CSI A;  4BY6 C;  1EZZ B;  3THK A;  3L2Q A;  1GFC A;  1TSF A;  1IGQ A;  2DZ9 A;  1UGQ B;  1KC8 C;  2BTT A;  3E9G A;  3M0P A;  2CP2 A;  1MND A;  2EQJ A;  3PMT A;  2AZS A;  2QDL A;  4MZP A;  1J3T A;  4F17 A;  5GAN 3;  4IUT A;  1QVP A;  2COY A;  3J7A F;  3ME9 A;  3AT1 B;  1X27 A;  3HFN A;  2QI2 A;  3O8V A;  5FRM A;  2K7A A;  1WJR A;  2YLB A;  4M7A G;  1QVF P;  3VS2 A;  2J6K A;  3I9Q A;  4YTL A;  1NZ9 A;  3CBP A;  2L3S A;  2RQV A;  1Q86 U;  1I4K 1;  5LJ5 h;  5I11 A;  3LWI A;  4IUP A;  1G5V A;  2HQX A;  1OV3 A;  3LH5 A;  2ZPI B;  4HXJ A;  3M4G A;  3CMA A;  3EGU A;  5FU6 C;  1BI3 A;  3TRE A;  2I2L A;  4IKF A;  5GAO m;  2LJ0 A;  1WFW A;  3MJX A;  3JB9 G;  1MV3 A;  1H3Z A;  4BY6 B;  3A8G B;  1WLP B;  2EQM A;  3A1P A;  1YIJ A;  3VJP A;  3CXC S;  1RI0 A;  3SFM A;  2B8A A;  2EYZ A;  3JCM h;  4AFQ C;  1K73 R;  1KQS A;  4E6R A;  3H0F A;  3DLL A;  2MPX C;  2J7I A;  2C0O A;  1T0H A;  1X43 A;  3JB9 H;  2LX7 A;  5FRO A;  2DKG A;  1G3S A;  4CC7 A;  4KBM B;  4XAX B;  2K6D A;  1VQP T;  2YT6 A;  4DEY A;  1VQL T;  5I22 A;  2HKN A;  2KYM A;  3A98 A;  4XK8 E;  1W1F A;  5LL6 S;  4M7A A;  1NEB A;  4QQ6 A;  5FU6 B;  3OYA A;  5C0M A;  2HBP A;  2R5M A;  4PJO C;  2R58 A;  2CP6 A;  3QJY A;  2RPN A;  1Q81 R;  4DOV A;  4IUU A;  2JN0 A;  4OVA A;  2EW3 A;  1RL2 A;  1PHT A;  5L23 A;  2QAS A;  2MMP A;  4M78 G;  5LJ3 d;  2IIM A;  1VQN Q;  2HSE B;  2K57 A;  2HL5 C;  2MAM A;  4BE1 A;  5GAN 5;  2HNI A;  1W70 A;  4F16 A;  1S72 T;  2XID A;  2KRN A;  2HEQ A;  1D1C A;  1NLP C;  1CKB A;  1ZSZ C;  3QHS A;  3MPU B;  1VQ4 Q;  3UF4 A;  2HQH A;  3QDF A;  5KYW B;  1VQO A;  5M9O A;  1BB9 A;  2LT1 A;  2X4W A;  3MEU A;  3ZL7 C;  2E5Q A;  2PU9 B;  2JXB A;  3FJ5 A;  5A0G A;  5CCA A;  3X25 B;  5CIU A;  3PVL A;  2FPE A;  3RMS A;  1PG5 B;  2DIQ A;  5GAN h;  2QXF A;  3MP1 A;  1RUW A;  1M3B A;  3KXT A;  2DEQ A;  5CKB A;  4X9D A;  3HRT A;  1D1B A;  1N6A A;  4ZTJ A;  4N4I A;  5LJ3 e;  4M7D G;  3REB B;  2DZC A;  4KGX B;  2NUZ A;  5EG2 A;  3CEY A;  5IHK A;  1IHW A;  1X6G A;  2C0I A;  1UEB A;  1DJ7 B;  2RMO A;  3L2W A;  2QQA A;  2KRO A;  3ULR B;  2DAQ A;  2XDP A;  2HL3 A;  4ELY C;  1C0M A;  2CP7 A;  1PC0 A;  1UGS B;  3NGP A;  2KSS A;  3RBB B;  3CXC P;  2XDB A;  1RLP C;  4D8K A;  2GCX A;  3A8M B;  1JEG A;  2EKO A;  2D1X A;  4CC2 A;  4JRI A;  5FWB A;  3NTK A;  1N8R C;  2FZC B;  5J3B A;  2P4T A;  2XG8 D;  4JLG A;  4PLL A;  1B34 A;  2ABL A;  2FPD A;  1VQ7 Q;  3RER A;  1YCY A;  3M0T A;  2QYZ A;  3CPW S;  1I8F A;  1MMN A;  4M78 E;  4PLI A;  5KCO A;  1M1G A;  2RI2 A;  1M1K U;  1WYX A;  3EGD A;  4C0Z A;  4A63 B;  1TS9 A;  2X4X A;  4J9H A;  1VQ5 T;  4QVZ A;  3CC2 T;  1U1S A;  3LYI A;  2YUQ A;  2RK1 A;  2V8J A;  3M0S A;  1Q7Y R;  1WHM A;  3CCV T;  1XQH A;  1PNJ A;  3QZ9 B;  3G4S A;  4C92 D;  1KHC A;  3C94 A;  1C1A A;  2YLC A;  3WVD B;  1K8A R;  4X9C A;  2JUF A;  4XTX A;  1AHJ B;  4DEX A;  3QII A;  3EFS A;  3INZ A;  3VS5 A;  3I5S A;  3OS5 A;  4DBH A;  3EH1 A;  1PSE A;  1YJN Q;  2DRK A;  4M4Z A;  5GAN 8;  2EQU A;  2JW4 A;  3X26 B;  2X4Y A;  3I35 A;  4M7D E;  1VUB A;  4QT7 A;  3JCM e;  2WSF E;  5DM7 R;  1NE8 A;  1JQQ A;  3NTI A;  3CMA T;  8ATC B;  4KH0 B;  3OW2 S;  1AWJ A;  3D7S B;  2DJQ A;  2EYY A;  1NPP A;  2M02 A;  2OAU A;  2MOX A;  4C8Q D;  1TXQ A;  1O75 A;  4F7U A;  2F2X A;  2HCK A;  1X01 A;  2K5I A;  1WHK A;  1YIJ T;  2MF2 A;  1PSF A;  2XIC A;  1FXX A;  1WHL A;  2RQT A;  1EX4 A;  4M75 C;  1MV0 B;  4O5V A;  2K2V A;  3GP8 A;  1U3O A;  2M51 A;  4LDV A;  2PZ1 A;  1XTD A;  2ROT A;  1I5L A;  3ZFJ A;  1TTH B;  2F69 A;  4A53 A;  2KDS A;  2F1L A;  3LGF A;  4J9F A;  1R77 A;  1NYG A;  3L2Z A;  4L59 A;  3JCM P;  2LJ3 A;  2YSQ A;  2KR3 A;  4QVD A;  1Q86 C;  3CCM T;  2J6F A;  4J6Y A;  4ZGE B;  3SD4 A;  2XD0 A;  1KSW A;  2CRE A;  4M7A C;  1K4U S;  3I55 Q;  3CPW P;  1Y7X A;  2E10 A;  1ABQ A;  3CC4 T;  2DIL A;  1KD1 U;  2DPP B;  2JM9 A;  1TUC A;  4E2F B;  4Y91 A;  4HCZ A;  1T0J A;  2Y4X A;  2DD4 A;  2RJE A;  2XK0 A;  2HDA A;  5KH6 A;  1O9S A;  3NFC A;  5I2M A;  1M1K R;  1VQO T;  1K9A A;  2YHT A;  1I1J A;  3OYE A;  3NPF A;  4M77 D;  1VQ6 A;  1K9M R;  2KAF A;  1YWP A;  1W2B A;  2D0Q B;  1QCF A;  1MNE A;  2RO0 A;  1Y0M A;  1M90 U;  3LLR A;  1VQ5 Q;  1HSQ A;  4L6V 5;  4J83 A;  1KC8 R;  4FU6 A;  3Q1J A;  4LUE A;  3CC2 Q;  2RM4 A;  5CKF A;  2OX7 A;  1GFD A;  3RNJ A;  3CCV Q;  2VVK A;  1JBM A;  2JJ9 A;  4RTT A;  2K3Y A;  2LRQ A;  3OYC A;  2BZX A;  4PFZ A;  2NLU A;  2YRD A;  1K0S A;  1P92 A;  1FYN A;  4BI4 A;  5FU7 C;  2EQK A;  3NMZ C;  3OYI A;  2XMF A;  2X3W D;  2RH2 A;  4N0A C;  8AT1 B;  3EG9 A;  2YXY A;  1YJ9 A;  3R6O A;  1Q82 U;  1Y96 B;  3OYJ A;  4KH1 B;  4IUQ A;  4C0G A;  4PJO E;  3CME A;  3OMG A;  3VYH B;  3QBY A;  2BZY A;  2QAZ A;  3CD6 A;  3V8J A;  4EDU A;  3CMA Q;  3V8K A;  2QEX A;  3G71 A;  4C8Q G;  4LDY A;  3C12 A;  1N8R U;  1RAA B;  4M78 C;  1D0X A;  3FIF A;  3OYK A;  5LJ3 j;  2EYW A;  1QVG A;  2RN8 A;  3OYH A;  5KYX A;  2HMA A;  3RKW A;  5KE2 A;  2X9H A;  4IIO A;  4ANJ A;  1RAD B;  3FJP A;  5GAN 7;  4ZGD B;  3ASK A;  2QA4 A;  1OZ2 A;  3G7Z A;  2DL4 A;  2BE9 B;  2QG9 B;  2YUN A;  1GXI E;  3MET A;  3G4S T;  2DXB A;  3OSV A;  3HKS A;  1I81 A;  2QTV A;  4FSS A;  2QDY B;  4C92 A;  5CKD A;  2K2M A;  2EKH A;  4Z88 A;  2O9V A;  1VQ8 A;  1VQ9 Q;  2QGG A;  4JPB W;  3CBM A;  1HK9 A;  1D3B B;  1ZUY A;  5CK9 A;  5A2Q E;  1VQK Q;  1M2O A;  4M7D C;  2VWF A;  1E6G A;  1JRI A;  2X3X D;  2A08 A;  3CCM Q;  1KJW A;  1UGR B;  1NJI U;  4FYX B;  3OBW A;  3X24 B;  2ED1 A;  2JTF A;  3MEA A;  1YJW A;  5IAY A;  4XTZ A;  4RTY A;  3RKX A;  3X28 B;  5LJ5 j;  2SEM A;  2KEA A;  4WCI A;  2LQW A;  2JTM A;  1T3S A;  4M78 B;  1KIK A;  2CKK A;  3TCJ A;  3CC4 Q;  1UTI A;  2X51 A;  1KQS S;  1N9R A;  1UGP B;  3EFO B;  4DBF A;  3OY9 A;  3GBQ A;  1PRM C;  1ZA2 B;  2LJ1 A;  1IB8 A;  2GGR A;  4Q5W A;  2VC8 A;  3JCM V;  5HKC A;  4RKU E;  2K79 A;  2VV5 A;  3KUF A;  3SWN B;  2FHD A;  1SPK A;  1SRM A;  4PKC C;  2Z0W A;  4PL6 A;  4P5N A;  4OMM A;  2HSP A;  2E3I A;  3G1J A;  3MHX A;  2D8J A;  3ZEH A;  3HHT B;  2EAY A;  1VQM T;  4M7D B;  3GPL A;  3MKD A;  2AK5 A;  4OGE A;  2OTJ A;  1RLQ C;  5CKH A;  4JRP A;  2RD1 A;  1NBE B;  2ATC B;  1U1T A;  1B7T A;  3EGX A;  1QP2 A;  1SKU B;  4KGV B;  3UA6 A;  3L2V A;  2K3B A;  3REA B;  3L1A A;  2JM8 A;  1MHN A;  1PM3 A;  4O6J A;  1I0C A;  2BE7 D;  1KG1 A;  4MDX A;  4OB1 B;  2D0N A;  4EMK C;  1KFZ A;  3VUB A;  1MMA A;  2FRW A;  2DK3 A;  1ABO A;  4C0F A;  2X35 A;  4DOW A;  4KUI A;  3M59 A;  5LJ3 g;  3H8Z A;  1A0N B;  1N8R R;  1B3Q A;  3QXE B;  3EHR A;  3JV3 A;  2DL7 A;  2ZAE A;  3E9F A;  2M0O A;  1TG0 A;  3CQT A;  3URG A;  1TH7 A;  2NYS A;  3M55 A;  1HXD A;  2WSC E;  3E2U A;  1VQ6 T;  4DA4 A;  2CYZ B;  4FYY B;  4M77 A;  1YI2 A;  2KQW A;  4OMF B;  4M75 E;  1TU0 B;  4XU2 A;  5CVI A;  2EJG A;  1YIT A;  1JO8 A;  2D6F A;  1IZ6 A;  5GAN j;  1UB4 A;  1OYX A;  1D1A A;  2X4J A;  4ELZ C;  2COW A;  5KYU B;  2E64 A;  2NUP B;  2DD5 A;  1FWZ A;  1KQS P;  2OTL Q;  5FWC A;  4XQ3 A;  3CCL Q;  4EMK B;  4Y28 E;  4R0K A;  5A0D A;  2FB7 A;  1UG1 A;  1KD1 C;  4XTV A;  4LDU A;  1YJ9 T;  3A8H B;  2RA2 A;  3I56 T;  2EWN A;  4DQ2 A;  3CME T;  5AYF A;  3CCE A;  4M7A E;  5CQY A;  3JB9 J;  1W4S A;  1VIF A;  1EIF A;  3CD6 T;  4M78 F;  4KUD K;  1RAC B;  1YHQ T;  3G71 T;  4JJC A;  1UJ0 A;  3H41 A;  4MMK A;  2G3R A;  3CCS Q;  2EQI A;  4FL6 A;  1M8V A;  2KXC A;  2YWW A;  5KE3 A;  2DER A;  2RHU A;  3EAE A;  4XU3 A;  1WHJ A;  1Z9Q A;  2CUD A;  4A4K A;  2YUO A;  3JCM g;  1RAG B;  5KCH A;  5AT1 B;  3CCR A;  3CCJ Q;  2DXT A;  2V1R A;  3JCM Q;  2L0A A;  4E7J A;  3CCU A;  1M90 C;  4V2S A;  2LDM A;  4HT9 A;  2COZ A;  4HCK A;  3PIO A;  2XU8 A;  4BE2 A;  4TVR A;  4LN2 A;  2CP0 A;  1S1N A;  3GF5 A;  2KT8 A;  2E3H A;  5GMK l;  1GCQ C;  3CC7 T;  4M7D F;  4MDW A;  4E7I A;  4RTX A;  1VQ8 T;  3CCQ T;  4PJO B;  5FRN A;  1VQM Q;  1WNL A;  4C5I A;  5LJ5 d;  1NLO C;  1RAE B;  1Q82 C;  1H3H A;  1Q86 R;  4X34 A;  3PFS A;  2QQR A;  2AT1 B;  1YJW T;  1LCK A;  1IGU A;  4AFZ C;  3PMI A;  4HKE A;  1PKT A;  3J80 E;  2L3R A;  1OX9 A;  2L3Q A;  2O4X B;  1M3C A;  1ZSZ B;  3OS0 A;  3RDV A;  4LXC A;  1WDX A;  4JJB A;  4F7U G;  2E6Z A;  1MGQ A;  3A8L B;  4BI3 A;  2FL7 A;  5J39 A;  2WAC A;  5IXB A;  2FO0 A;  4LD9 K;  1VYU A;  1XOV A;  2EGE A;  1HJD A;  4AFS C;  4B6M A;  4MML A;  2ZPB B;  4XTW A;  4C8Q C;  3JCM d;  1UHC A;  1TOV A;  2A0F B;  2RF0 A;  4J9G A;  3VUZ A;  3MEW A;  3TEE A;  2PUO B;  1M3A A;  5LJ5 e;  1QQJ A;  4A4E A;  2KRM A;  2PUK B;  4RG2 A;  2DXC A;  4AFU C;  1M4Z A;  2DBK A;  1NG2 A;  5D6W A;  1PRL C;  4OB3 B;  1VOM A;  1YP5 A;  4BDZ A;  2VUB A;  2E1H A;  4WTO B;  3RKY A;  1I07 A;  4D6W A;  4II1 A;  2DXU A;  3SWN A;  2EVR A;  2JTE A;  1VQP Q;  1NYF A;  3C95 A;  1G83 A;  1VQL Q;  3VS4 A;  1NJI C;  1JJ2 A;  1WZO A;  2OJ2 A;  4CC4 B;  1OEB A;  2EGA A;  5GAM j;  4ESR A;  3QKJ A;  1E7O A;  1YJ9 Q;  1VYV A;  4PJN A;  2KYB A;  3I56 Q;  3BFM A;  4ATO A;  3JCM J;  2FYK A;  2EGC A;  5IHN A;  1YHQ Q;  1W2B S;  3QUI A;  3QO3 A;  4HCC A;  3VV0 A;  1S72 Q;  2V1Q A;  5CKE A;  4F14 A;  2MYS A;  4RCB A;  4KUL A;  5IT9 E;  2L2P A;  2OI3 A;  1VQN A;  2CDT A;  4ZGJ B;  1UJY A;  4HVW A;  5L8R E;  3S6W A;  2DA9 A;  2CT3 A;  2AZV A;  3QZ5 B;  4BDY A;  1AWO A;  3ER0 A;  1YI2 T;  5GAN d;  1LVK A;  4QW2 A;  1VQ4 A;  4OMP A;  1BI1 A;  2DL8 A;  3FEO A;  3DKM A;  1XNI A;  1ZBX A;  2NUT B;  1Y57 A;  1NEG A;  2RJC A;  3L2R A;  1UFF A;  1WHG A;  2QQ9 A;  4PJO F;  3CC7 Q;  2DRM A;  4R56 A;  3JCM b;  2ROL A;  3CCQ Q;  1FMV A;  5GAM h;  2L3P A;  1YN8 A;  1X2K A;  3V8L A;  3P8B B; 
#chains in the Genus database with same CATH homology
 1WLP B;  3VS3 A;  4FSS A;  3I5R A;  2EYZ A;  2K2M A;  2EKH A;  4Z88 A;  2O9V A;  2YDL A;  2DYB A;  2PNI A;  4AFQ C;  4E6R A;  4JPB W;  3H0F A;  2DX1 A;  2GTO A;  3VS1 A;  2J7I A;  1JXM A;  2C0O A;  1T0H A;  1X43 A;  1ZUY A;  2LX7 A;  2VWF A;  1E6G A;  2X3X D;  2A08 A;  4Z89 A;  2LNH B;  1RI9 A;  1KJW A;  2G6F X;  4Z8A A;  4CC7 A;  2RQR A;  2ED1 A;  2DM1 A;  2K6D A;  2KRS A;  1AD5 A;  4RTY A;  5ECA A;  2YT6 A;  2SEM A;  2KEA A;  4WCI A;  2LQW A;  3SHW A;  4DEY A;  3VS6 A;  1T3S A;  5I22 A;  1KIK A;  2KYM A;  3A98 A;  1UTI A;  1ZBJ A;  1X2Q A;  1GRI A;  1W1F A;  1JXO A;  1NEB A;  1SRL A;  1UEC A;  3H0I A;  4X1V A;  5EC7 A;  3GBQ A;  1PRM C;  2LJ1 A;  2JS2 A;  2RPN A;  3VS0 A;  1K1Z A;  3QWY A;  1M8M A;  1M27 C;  2SRC A;  2GGR A;  3SEM A;  2EW3 A;  2DE0 X;  2K79 A;  1PHT A;  4LNP A;  5L23 A;  1B07 A;  4J9C A;  2FRY A;  2IIM A;  2CSQ A;  1SPK A;  1SRM A;  1TUD A;  1W70 A;  4F16 A;  1ZUU A;  1QWE A;  4OMM A;  2KRN A;  2HEQ A;  2HSP A;  2RNA A;  4ORZ A;  1NLP C;  1CKB A;  1CKA A;  1ZSG A;  1UDL A;  3EG0 A;  2D8J A;  1W6X A;  3UF4 A;  2VKN A;  4KRT A;  1BB9 A;  1E6H A;  2AK5 A;  3PE0 A;  3ZL7 C;  1RLQ C;  1U06 A;  2KT1 A;  2JXB A;  3FJ5 A;  1SEM A;  1PWT A;  3UA6 A;  2J05 A;  2ENM A;  2K3B A;  2MCN A;  1H8K A;  3REA B;  3PVL A;  2FPE A;  2DLP A;  2EYX A;  2JM8 A;  2C0T A;  2ED0 A;  5GJW B;  1I0C A;  2F2W A;  1RUW A;  1M3B A;  2D0N A;  2LP5 A;  2GTJ A;  2OAW A;  1KFZ A;  2DNU A;  4RTZ A;  2O31 A;  3REB B;  2FRW A;  2NUZ A;  1ABO A;  2O88 A;  4D8D A;  5IHK A;  1A0N B;  1X6G A;  4GBQ A;  2C0I A;  1B3Q A;  2D8H A;  2RMO A;  3EHR A;  3JV3 A;  2DL7 A;  2KRO A;  3ULR B;  4Y92 A;  1Z9Z A;  4IIM A;  2B86 A;  2AKL A;  1TG0 A;  3NGP A;  3CQT A;  3RBB B;  4J9I A;  1RLP C;  2J06 A;  4JZ3 A;  4D8K A;  1JEG A;  2D1X A;  4CC2 A;  5FWB A;  3EG3 A;  1BU1 A;  2LZ6 B;  2P4R A;  3R6N A;  4J9B A;  3IQL A;  1EFN A;  2ABL A;  1QKX A;  2FPD A;  1JU5 C;  1AWX A;  2JS0 A;  1YCS B;  3EHQ A;  3M0T A;  1K0X A;  1U5S A;  1UUE A;  4OML A;  1JO8 A;  1WYX A;  3TVT A;  1K76 A;  3QWX X;  2KE9 A;  4A63 B;  2HBW A;  2JT4 A;  4J9H A;  2KNB B;  2DVJ A;  1OPK A;  2MIO A;  5FWC A;  1CSK A;  2YUQ A;  4R0K A;  1MUZ A;  1UG1 A;  1GCP A;  3M0S A;  2A36 A;  2J6O A;  4J9D A;  2CUB A;  1PNJ A;  3EG2 A;  2EPD A;  2CH4 A;  4ZNX A;  4HVV A;  4GLM A;  2LCS A;  2A37 A;  2GNC A;  2RQW A;  3M0U A;  4JJC A;  4DEX A;  1AVZ C;  1UJ0 A;  3H41 A;  2GBQ A;  1PKS A;  3VS5 A;  3I5S A;  3M0R A;  2DRK A;  2EQI A;  4M4Z A;  1WI7 A;  2JW4 A;  2M0Y A;  1WIE A;  1NM7 A;  3I35 A;  1H92 A;  1ZUK A;  4QT7 A;  1YWO A;  2KXC A;  3C0C A;  2RQU A;  1JQQ A;  1OOT A;  1Z9Q A;  2E5K A;  2CUD A;  4RTW A;  2YUO A;  1AWJ A;  2DJQ A;  2FPF A;  1AZG B;  2EYY A;  2V1R A;  2MOX A;  2L0A A;  2FG0 A;  4HCK A;  5GJV B;  5FW9 A;  2YUP A;  1SSH A;  2F2X A;  4LN2 A;  1BK2 A;  1S1N A;  2HCK A;  3VRY A;  2JMC A;  2F2V A;  1HD3 A;  2KT8 A;  4RUG A;  1GCQ C;  1UHF A;  4OMQ A;  4RTX A;  3UA7 A;  1QLY A;  2DL5 A;  4HVU A;  2RQT A;  4RTV A;  2LMJ A;  1MV0 B;  1NLO C;  1WX6 A;  2H8H A;  3PVQ A;  4LUD A;  5IHI A;  1U3O A;  1AZE A;  2M51 A;  1H3H A;  1T3L A;  2PZ1 A;  2ROT A;  1WA7 A;  1LCK A;  3TSW A;  1AWW A;  4AFZ C;  2PTK A;  2NWM A;  1SHF A;  4J9F A;  1NYG A;  1PKT A;  2LJ3 A;  2YSQ A;  2L3Q A;  2W10 A;  1M3C A;  2KR3 A;  4K11 A;  1WXU A;  2J6F A;  3TSZ A;  1ARK A;  2GQI A;  2W0Z A;  1BBZ A;  1WDX A;  1YNZ A;  1UGV A;  4JJB A;  1GCQ A;  2EBP A;  2KXD A;  3M0Q A;  1X69 A;  3NHN A;  4CC3 A;  1KSW A;  2CRE A;  5IXB A;  5HCK A;  2FO0 A;  1K4U S;  1VA7 A;  2CH4 W;  1VYU A;  1XOV A;  1ABQ A;  2EGE A;  1HJD A;  4AFS C;  2DIL A;  1OPL A;  1WXT A;  2BZ8 A;  2JM9 A;  1UHC A;  1TUC A;  4J9E A;  1V1C A;  2RF0 A;  2DL3 A;  4J9G A;  4RTU A;  1X6B A;  1QWF A;  3EG1 A;  1M3A A;  1T0J A;  2KRM A;  1ZX6 A;  4JJD A;  1WXB A;  4AFU C;  2AKK A;  2DBK A;  2HDA A;  1NG2 A;  1PRL C;  1GBR A;  1VYT A;  2I0N A;  1YP5 A;  2A28 A;  4OMO A;  1ZLM A;  1K9A A;  2JMA A;  3U23 A;  2KGT A;  2DBM A;  1AOJ A;  1I1J A;  3VS7 A;  1I07 A;  2LQN A;  4JZ4 A;  3NPF A;  2ECZ A;  2EVR A;  2JTE A;  1NYF A;  5IH2 A;  1G83 A;  1YWP A;  3H0H A;  3VS4 A;  1QCF A;  2DF6 A;  2OJ2 A;  4CC4 B;  1OEB A;  1M30 A;  1Y0M A;  2EGA A;  1HSQ A;  1G2B A;  4LUE A;  4ESR A;  1GFD A;  3RNJ A;  1E7O A;  5IXF A;  2VVK A;  1VYV A;  2O2O A;  2KYB A;  4RTT A;  1UE9 A;  2DMO A;  2BZX A;  3KFV A;  2CSI A;  3THK A;  1GFC A;  2EGC A;  1K0S A;  5IHN A;  1GL5 A;  1FYN A;  1SHG A;  2BTT A;  3M0P A;  3NMZ C;  2XMF A;  2X3W D;  3VRZ A;  2K9G A;  1AEY A;  2AZS A;  2QDL A;  1J3T A;  4F17 A;  2KBT A;  2V1Q A;  4F14 A;  2L2P A;  2OI3 A;  3UAT A;  1X27 A;  2CDT A;  1UJY A;  2K7A A;  4HVW A;  2BZY A;  1FMK A;  2DA9 A;  3VS2 A;  2CT3 A;  4EIK A;  2AZV A;  2J6K A;  3I9Q A;  1AWO A;  2L3S A;  2RQV A;  3O5Z A;  4OMP A;  2DL8 A;  5I11 A;  2EYW A;  1OV3 A;  3LH5 A;  1GBQ A;  1QKW A;  2RN8 A;  4HXJ A;  3EGU A;  1Y57 A;  1NEG A;  1UFF A;  4OMN A;  4LE9 A;  1N5Z A;  4IIO A;  4AG2 C;  2ESW A;  2DRM A;  2O9S A;  2ROL A;  1IO6 A;  2L3P A;  1YN8 A;  1X2K A;  2CT4 A;  2LJ0 A;  1WFW A;  2DL4 A;  2YUN A;  4AG1 C;  1MV3 A;  2FEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...