2JM8A

R21a spc-sh3 free
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
62
structure length
62
Chain Sequence
MDETGKELVLALYDYQEKSPAEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The high-resolution NMR structure of the R21A Spc-SH3:P41 complex: Understanding the determinants of binding affinity by comparison with Abl-SH3
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Spectrin alpha chain, brain
total genus 14
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jm8A00
4ESRA 2HEQA 1W70A 3I9QA 1I0CA 1HSQA 1YNZA 3EG2A 2ECZA 5L23A 2EYZA 1KFZA 1YWPA 3M0TA 3LH5A 2L3SA 5IHNA 1YN8A 2RQRA 2HDAA 1UTIA 1PKSA 2K7AA 3KFVA 1SHGA 2GQIA 2JM9A 4D8KA 3TSWA 3VS4A 4Z88A 2P4RA 1UFFA 1QLYA 2J6OA 2O88A 4GBQA 1MV0B 4A63B 1UHFA 4CC7A 2J6KA 2LX7A 2RQVA 2NWMA 2RNAA 2YUOA 1I1JA 1ZUUA 1V1CA 2F2VA 2K79A 1GCQA 2DL4A 1GRIA 2W10A 4X1VA 2KNBB 2AKLA 2OI3A 2CDTA 4LUEA 4OMLA 1WI7A 2C0OA 2L2PA 2FO0A 1A0NB 1NLPC 1PKTA 4E6RA 2VKNA 2L0AA 1T3LA 4AFZC 2ROTA 3H41A 1WXTA 4JZ4A 2CSIA 2YUQA 2EKHA 2LQNA 2KGTA 2LJ0A 1KIKA 1M3AA 2EGEA 4R0KA 2O9SA 4LNPA 1H8KA 3ZL7C 3U23A 2EW3A 1JU5C 2EGAA 4J9FA 1NEBA 4J9DA 2W0ZA 4HVUA 1VYUA 2FPFA 2DBMA 1OPLA 1M8MA 3UA6A 1AWXA 2JW4A 1S1NA 4RTTA 1OEBA 2JS0A 2A37A 4Y92A 1AZEA 4ORZA 2RPNA 2YDLA 2HSPA 1M3CA 2ENMA 1TUCA 4RTZA 1M27C 2DM1A 1OV3A 5IH2A 4OMNA 1KJWA 1SRLA 5I11A 2H8HA 3NGPA 3TVTA 2K2MA 4IIMA 1UECA 2NUZA 3NPFA 1AD5A 3QWYA 4F16A 4OMOA 2LJ3A 4RTWA 1T0JA 1E6HA 1MV3A 2DL7A 2V1QA 3VS2A 2D8JA 2LMJA 1NLOC 1CKAA 1PRLC 3VS0A 2DMOA 1M3BA 2FRYA 2LP5A 2KR3A 1PWTA 1Y0MA 2K6DA 1W1FA 2SRCA 1K4US 1KSWA 1UJ0A 2ROLA 3TSZA 2A36A 2SEMA 1VYVA 1WIEA 2JMCA 2EPDA 1HJDA 4HVVA 4OMQA 1UJYA 2FPDA 2EBPA 4RUGA 4WCIA 3RBBB 1WLPB 1TG0A 2DF6A 2K9GA 2V1RA 1SHFA 2BZ8A 1G83A 2KE9A 4CC2A 2F2WA 1E6GA 2C0TA 3SHWA 1H92A 2ABLA 1U06A 1WDXA 1X69A 2G6FX 2KT8A 2DX1A 2EYXA 1TUDA 2FEIA 3NHNA 2ESWA 1UDLA 2JM8A 5IXFA 2FG0A 1NEGA 4D8DA 3M0PA 2BZXA 4RTXA 4RTVA 1WXUA 1PHTA 1T0HA 1OPKA 4J9HA 3VS1A 4J9IA 1YWOA 1GFDA 1PRMC 2GBQA 2OJ2A 1Y57A 1X2KA 4M4ZA 2DA9A 3RNJA 4JPBW 2JMAA 2PNIA 2KROA 3THKA 1RI9A 1WA7A 4J9BA 5I22A 1LCKA 2DL8A 4K11A 2O31A 2F2XA 2JXBA 3M0SA 1H3HA 2EVRA 1K76A 2RF0A 2AZVA 2M51A 2VVKA 1BB9A 3I5SA 2PZ1A 4J9EA 2DL5A 5IXBA 3EHQA 1UG1A 2D1XA 1UE9A 4RTUA 2XMFA 4HVWA 3I35A 2RQWA 2KRMA 1SPKA 5GJVB 2KRNA 1GBRA 2AZSA 2DNUA 1GBQA 3M0UA 1ZLMA 1SEMA 2RN8A 1ZUKA 4LN2A 3PVQA 2X3XD 2YUNA 2CUBA 2LZ6B 2M0YA 2GNCA 3EGUA 3PVLA 2GTJA 3EG3A 3H0FA 2KEAA 3EHRA 1K0SA 1AEYA 4OMPA 2X3WD 2HBWA 4IIOA 4CC3A 4DEXA 1VYTA 2E5KA 2D0NA 2KT1A 2RMOA 3C0CA 2KRSA 2CH4A 4GLMA 2CUDA 2QDLA 1X43A 1AOJA 3A98A 1FYNA 3JV3A 2BTTA 2D8HA 2DBKA 3SEMA 4RTYA 4KRTA 4ZNXA 5FW9A 2DILA 3REAB 1SRMA 1WXBA 1JEGA 2J6FA 3CQTA 4JJBA 1NYFA 2A28A 2LCSA 3VS5A 2O9VA 2DYBA 1W6XA 4OMMA 2C0IA 3R6NA 4EIKA 2J7IA 4JJDA 1J3TA 2OAWA 5EC7A 2DL3A 4AFQC 1NM7A 1UUEA 3NMZC 4J9GA 1AWJA 1RLPC 1AWWA 1N5ZA 1BK2A 1WFWA 1B3QA 2AK5A 2KXDA 2O2OA 1I07A 1NG2A 1T3SA 2CH4W 2YSQA 1AVZC 2RQUA 1GCQC 2AKKA 3FJ5A 4Z8AA 1QCFA 2RQTA 2CT3A 4F14A 3UATA 2ED1A 5HCKA 1E7OA 1QKWA 4JZ3A 4CC4B 1GCPA 3VS3A 1UHCA 4AFSC 2L3PA 1VA7A 2CREA 4Z89A 2KBTA 3UF4A 5IHIA 4JJCA 1Z9ZA 3QWXX 3VRZA 1ZX6A 2DE0X 2YT6A 1ABQA 1ABOA 2B86A 2FRWA 1PNJA 2GGRA 1QWFA 2FPEA 2EQIA 5FWCA 3VS6A 2JT4A 1QWEA 2MIOA 1ZUYA 1NYGA 2VWFA 3PE0A 5ECAA 4AG2C 2J06A 1CKBA 4QT7A 3VS7A 1BBZA 4HCKA 1GFCA 3M0RA 3VRYA 3I5RA 2LNHB 1WYXA 4DEYA 1X6BA 1MUZA 2HCKA 1AZGB 1WX6A 1JXOA 1XOVA 1CSKA 3EG0A 2DLPA 1X2QA 2KYBA 2MCNA 1UGVA 3ULRB 4FSSA 1YP5A 2ED0A 2IIMA 2LJ1A 4LE9A 3O5ZA 1YCSB 2YUPA 1EFNA 3EG1A 4F17A 1JQQA 5FWBA 2KYMA 1SSHA 4AFUC 1K0XA 3GBQA 1RUWA 1X6GA 4LUDA 1G2BA 5IHKA 2I0NA 2MOXA 1X27A 4HXJA 2CT4A 2L3QA 1ZSGA 1GL5A 2KXCA 1JO8A 1K1ZA 1JXMA 1IO6A 2DJQA 2EYWA 1M30A 5GJWB 2LQWA 1Z9QA 4J9CA 2PTKA 1ARKA 2J05A 2DRMA 2EYYA 1AWOA 3H0IA 4AG1C 1K9AA 3IQLA 1U3OA 2A08A 3M0QA 3REBB 2EGCA 2JTEA 1QKXA 2CSQA 2BZYA 1FMKA 2DVJA 1HD3A 1BU1A 2K3BA 1OOTA 2DRKA 3H0HA 1B07A 3UA7A 1RLQC 1U5SA 1ZBJA 2GTOA 2JS2A
chains in the Genus database with same CATH superfamily
3EGXA 3VUBA 2HEQA 4J7FA 1W70A 3I56A 4BE1A 2DIQA 1HSQA 1YNZA 5IN1A 2KMTA 2EYZA 1VQ8A 3CC7Q 1KFZA 4FYWB 4BE2A 3QO3A 3PIOA 1VQ5T 5IHNA 3I55T 3EFOB 5GAN4 3KFVA 1TU0B 3G4SA 2GQIA 4M77B 4M75C 4Z88A 4IUQA 4XU0A 2P4RA 1UFFA 2XICA 1QLYA 2M1HA 2J6OA 2RB6A 2CZ1B 3OYNA 5D6WA 3CMEQ 4O6JA 3HFNA 2L89A 2J6KA 2RQVA 1U8RA 2DXUA 1V1CA 4LDUA 4B9XA 2KNBB 2AKLA 4R56A 2OI3A 2CDTA 3OBWA 3CCLA 3QHSA 1A0NB 4HT9A 1T3LA 4M77E 2DZ9A 4JZ4A 5GAOr 1IHVA 1K73C 2CS7A 1VQ6T 2KGTA 4EMGA 2QA4A 1TH7A 2O9SA 3CC4T 4GY5A 4C8QC 1JU5C 1NEBA 3RERA 4J9DA 4M7DG 4A4GA 2C06A 4FSXA 4PJOC 3JCMJ 2FPFA 2DBMA 3SFMA 2CP7A 1OPLA 1M8MA 3P8BB 3HKSA 3UA6A 1AWXA 4RTTA 5LJ3f 1VQNQ 4BUGA 1OEBA 3CCJT 2O4XB 3PMTA 3A8HB 5GMKh 2HSPA 1XNIA 4FIBA 1TUCA 3C12A 1I81A 4RTZA 1OV3A 4OMNA 1SRLA 4ELZC 1M1KU 3NGPA 3VUZA 1YJWQ 2DEUA 1Q81R 5A0LA 3UWNA 2FHDA 3MEVA 4XTXA 2V8IA 4FYXB 1E6HA 1MV3A 3M57A 4E7HA 2FVUA 3HPWA 2CYZB 1R8OB 5M9OA 3MP1A 3VS0A 4QW2A 1Q82U 4OGCA 2FRYA 1WHLA 2LP5A 4M7AC 4XU2A 1Y0MA 5DLOA 3FJPA 4FYVB 4M7AD 3A8MB 1VQPT 1KC8U 4C92F 1WIEA 2DD4A 2EBPA 3ZEHA 1WLPB 3QPHA 1TG0A 3I55A 4Q5WA 2K9GA 1BI3A 2BZ8A 1PSFA 2F5TX 1H92A 2ZPBB 5AT1B 5KH6A 1WQWA 1WDXA 1EZZB 2R58A 2KT8A 5LJ5j 1VQLT 2RK1A 2DXCA 1TUDA 3OW2P 1M90U 5IXFA 3I55Q 3RKWA 2EQJA 1RAHB 4RTVA 1WXUA 1T0HA 4ZTFA 5KYWA 4M75B 1BIBA 2MWPA 1KK7A 4MMLA 2GBQA 2OJ2A 3L2UA 1Y57A 2JN0A 5LJ5e 5KYNA 2DA9A 2JJ9A 2JMAA 1R0CB 5HK0A 1WA7A 4J9BA 3SB2A 1D0XA 2DL8A 3V7SA 2O31A 3M0SA 4BI4A 1FX7A 4LDWA 1Q7YR 3OW2S 5GAN3 1BB9A 3I5SA 1WJSA 4J9EA 2DL5A 3JSCA 1SKUB 2DEQA 3JB9G 2ZPEB 1UE9A 2XDPA 1YJWA 3GIBA 4JRPA 3EG9A 3I35A 2IG0A 3MPUB 1SPKA 4L5GA 1GBRA 3OBYA 3S3OA 5GAOp 4EDUA 4DQ2A 3M0UA 5FU6B 1ZSZB 3M59A 2CUBA 2LZ6B 4JS4A 2CP2A 2GNCA 1K73U 1K8AU 3H0FA 3L2RA 2DIGA 1KHCA 2EJ9A 1VIEA 1K0SA 4OMPA 2QXFA 2LVMA 4M77F 1X01A 2M9UA 4DEXA 3CMEA 1VYTA 2D0NA 1OYXA 2PUKB 2KRSA 2CH4A 4M77D 2VC8A 2DKGA 2VXEA 5FROA 5A0DA 4M78E 3LH0A 3JAME 4Z02A 2ZPFB 1Y96A 3VJPA 4TVRA 2RHZA 3CCLQ 3JV3A 2HBPA 4E47A 2COZA 2QAZA 3SEMA 4ZNXA 2GFUA 5FW9A 3T9NA 3PMIA 1LJOA 1P92A 5CQYA 2E64A 1SRMA 1WXBA 1JEGA 4E7KA 8AT1B 5D6XA 2ZPIB 4N0AC 2CP6A 4M75G 3R6NA 4BB7A 3BW1A 2LRQA 1J3TA 5EC7A 1UUEA 3HHTB 1PM3A 3NMZC 3CXCA 4M77A 5CKFA 4J9GA 4A53A 4QVZA 1AWJA 3M4YA 3QJ6A 3OYIA 1AWWA 1VQ9A 3AT1B 1WFWA 2Y90A 4ZN3A 2JVVA 1IHWA 1BYMA 3RIRA 3CC7A 2PVDB 1K9MC 4Z8AA 1QCFA 3META 4F14A 3UATA 4ME7A 5FU7B 2P0QA 3VS3A 1D1AA 2L3PA 1WHMA 1ZBXA 4L6V5 3UF4A 3GLXA 1Q86U 3OYAA 1Z9ZA 2EFIA 4OMFB 3QUIA 3FRNA 2DE0X 4ZGJB 2L8DA 3FIFA 4ATOA 2DETA 2EQIA 1TS9A 3CC4Q 1QWEA 2OTLA 3FDRA 4AG2C 5GAOm 4QT7A 3VS7A 4RG8A 1GFCA 1N9SA 4OB0B 1NPRA 3I5RA 5FLXE 2LNHB 5I2SA 1WYXA 3G7ZA 3CCRA 1AZGB 1WX6A 1XOVA 3KUFA 4VUBA 3CPWA 1CSKA 3EG0A 4FW2A 1M8VA 1YBYA 3X25B 1KHIA 2HL3A 3ULRB 4F7UE 4FSSA 4LE9A 1JJ2S 3EG1A 4F17A 2RH2A 4QQ6A 2QASA 2VB6A 2KYMA 2DD5A 3A5ZB 5KYUA 3MP6A 5GMKj 1I8FA 5DM7R 3SWNB 2GFAA 5L8RE 4HXJA 2YWWA 1B7TA 3QDRB 2KXCA 5GAN7 3JB9D 1OX8A 2EYWA 2LQWA 1Q81C 1Z9QA 4E7ZA 2PTKA 3ME9A 1VQKQ 2QQ9A 1OQKA 1QVGP 3CC2Q 2E5QA 2QEXQ 4IUTA 3M0QA 2OTJT 3G4ST 1QVFP 3A1PA 5CKEA 2EQMA 4PFZA 1NJIR 1YJNQ 3QKJA 5CO7A 3JRZA 1HD3A 4BY6B 3OMCA 1D1CA 1FXXA 1YHQA 1VQ6Q 2RI3A 1VQ4A 5CVIA 3JCMg 2E41A 3L2QA 5IT9E 2D6FA 1I0CA 1JRIA 1PD1A 2X51A 4M78A 1YWPA 4GLKA 2K3XA 1BKBA 1QW1A 3M0TA 3EFRA 2E3HA 3VYHB 3CPFA 1M1GA 2RQRA 2M16A 2I2LA 1SHGA 2JM9A 4D8KA 2MMPA 3TSWA 3VS4A 2OAUA 3LWIA 1BCOA 2YRCA 2O88A 5DLQE 4GBQA 1MV0B 1YITQ 2VV5A 3DKMA 2OTLQ 1ACMB 1Q86C 2NWMA 3GOXA 5A2QE 4XU3A 3KBGA 2QQAA 4PJJA 2L5QA 3PFSA 1GCQA 2W10A 1K9MR 4X1VA 2YXYA 4FW1A 4EMHA 3L1AA 3ASKA 2C0OA 2L2PA 5CCAA 3QDFA 4C92G 1PSEA 3V8LA 2GCXA 3H41A 2E70A 1PCXA 1BCMA 3WXMB 2EKHA 4OB3B 1M3AA 2EGEA 4IUVA 1NBEB 4LNPA 4QVCA 2KAFA 2LQ8A 3CCLT 4J9FA 4C92C 4MZMA 4HVUA 4ZGDB 3M5AA 4M7AB 4KGVB 1S1NA 1FWZA 2LCLA 2JS0A 3TCJA 4Y92A 4NL3A 3FC3A 4ORZA 2RPNA 1YITT 2HKQB 4J6WA 3TU4K 4XTWA 5CKHA 1I4K1 1Q86R 5IH2A 5CAIA 1KJWA 2H8HA 1WJRA 4XK8E 2OTJA 2NUZA 5LJ5d 2M0OA 2RO0A 4F16A 4OMOA 3OYKA 2GQVA 1T0JA 1WNLA 2HQEA 1PC0A 1NLOC 1VQKT 1TOVA 1VQ7A 3I56T 1AT1B 3OB9A 2DMOA 1M3BA 3URGA 1PWTA 2K6DA 2SRCA 1K4US 4BDYA 1KQSA 2YLBA 3NTKA 1UJ0A 2ROLA 2WSFE 2XI9A 2A36A 2SEMA 1VYVA 1HJDA 2EPDA 4HVVA 1Y71A 4M78B 2H3EB 2DF6A 2P0KA 1RL2A 3PIPA 2YLCA 4KUIA 2COWA 2LT1A 2K4YA 2KE9A 4CC2A 2F2WA 4KH1B 5GANd 3JB9I 3OYCA 2QGFB 4M75A 3CCMA 1X69A 1KC8C 2DX1A 2KVQG 3G6EA 1BI0A 4XTZA 1VQMT 5HKCA 4C92A 2XHCA 3E9GA 9ATCB 2AIRB 1NEGA 4HCZA 4RMOA 2DTOA 4D8DA 8ATCB 1PHTA 2PVOB 1OPKA 3VS1A 4J9IA 1YWOA 4OGEA 3RDVA 2HAXA 1D3BB 1PRMC 4FU6A 1X2KA 1MGQA 3CC2T 3RNJA 4JPBW 4A4HA 2PNIA 1RI9A 1LCKA 2RJFA 2NLUA 2F2XA 2DK3A 2EVRA 1R0BG 2M51A 5LL6S 2QYZA 1I5LA 4XQ3A 4M75F 1UG1A 2AHJB 1NJIU 1ZHIA 2ZAEA 5GJVB 1VQOT 1M1FA 3F70A 3JCMh 2AZSA 1WGSA 4JRIA 1W2BS 4M78G 2EQUA 4JS5A 2AT1B 4LN2A 1U1TA 3PVQA 3OYYA 3J81E 2M0YA 1RACB 1TWBA 1K9MU 3PVLA 1G5VA 1RAAB 1U1SA 4C0ZA 3HRTA 4C0DC 5LJ5g 3EHRA 3EFOA 1M9SA 2HBWA 3A8LB 4CC3A 1OI1A 2QTXA 3RR6A 2CUDA 3CMAA 1W2BP 4C92E 1X43A 1FYNA 1KG1A 1EIFA 4RTYA 4KRTA 5GANg 3GP8A 2JOYA 3V8KA 3PNWC 5KCOA 4DOWA 3QBYA 2YRDA 3REAB 2E65A 2PU9B 2XKOC 4JJBA 4XU1A 5I21A 5GAOn 1PD0A 5KE2A 2EJGA 1QVGS 3VS5A 1W6XA 4OMMA 4C8QB 4PJLA 1V76A 2HQXA 2J7IA 3AHUA 5GAMj 3CCUQ 2DL3A 1NM7A 2V8JA 5GAN5 2ZZDA 3H6ZA 2HL5C 2B8AA 3M53A 3BDLA 1MNDA 2KXDA 1VQNA 1I07A 3JCMP 4J83A 2HQHA 1K8AC 2VASA 1AVZC 1GCQC 3RKYA 3FJ5A 2R5MA 2RQTA 2CT3A 3CCQQ 3NFCA 5HCKA 3MKDA 2QA4Q 3CCJQ 2RD1A 1YJ9A 2VYTA 4HKEA 4Z89A 3EH2A 4EMKB 3EGDA 3QWXX 2DTIA 3ZBDA 4JRQA 1VQPQ 1ZX6A 1YI2Q 2O4XA 5J26A 1LVKA 4B9WA 1ABQA 3N5BB 1ABOA 2Z0WA 1QP3A 1B34B 4PJOA 2FPEA 1VIFA 1YJ9Q 4PJOF 1NYGA 3PE0A 5ECAA 1W2BA 5EG2A 1MNEA 3RESA 4HCKA 1D0YA 2E6ZA 4L59A 3M0RA 4RKUE 4J7IA 5KYXB 4RG2A 1X6BA 2X4JA 4II1A 2RJEA 1VOMA 2DLPA 5D7UA 2M02A 1RAIB 2EQKA 5LJ3h 4LDYA 5CKDA 3OYDA 1YP5A 2IIMA 3OS2A 4CRIA 2LTOA 3M55A 3MEWA 3J80E 3I56Q 4QVDA 1JQQA 1YI2T 1S72A 3EG9B 3GBQA 4C5EA 2X4YA 4C0DB 1SSFA 3UT1A 1RUWA 1I5OB 3CBOA 1X6GA 4PKCC 4PL6A 2R5AA 2CT4A 5GAOq 2A3LA 4JLIA 2QG9B 1TUGB 1TXQA 5GJWB 3DLLA 4M7DF 4J5YA 1VQ9T 5CR2A 5GAMe 5KYWB 4AG1C 3CCVA 3OQ5A 1K9AA 3CCEA 1U3OA 2A08A 3REBB 1N9RA 2EGCA 2JTEA 3ZFJA 5KYYB 1QKXA 1BI2A 1FMKA 3E19A 2DVJA 3RMSA 3OSVA 2CP5A 4PLIA 4LXCA 4FYYB 2R57A 3X26B 4HCBA 3JCMX 1HK9A 3G71Q 2JS2A 1HYOA 1MHNA 3CD6A 3OW2A 5KYYA 1YIJA 4KULA 3QJYA 4X9DA 3EG2A 4M7AA 2ECZA 5L23A 2JZ2A 4C92B 3L2VA 1NPPA 1N8RR 4F7UF 3EGDB 1BI1A 2DERA 2X9HA 3LH5A 2MF2A 2L3SA 1YN8A 2FB7A 4OB2B 2HKNA 1UTIA 1O75A 2Y4YA 2WACA 1YCYA 1QP2A 4M7DC 3OYLA 3S6WA 4A63B 3VKIA 2HNIA 1UHFA 4CC7A 2LX7A 3CC7T 2RNAA 2YUOA 4A4EA 4PJNA 1ZQ1A 2F2VA 2K79A 1QVFS 2DFUA 5GAOl 3HTRA 3UDCA 3JCMd 3CXCP 3G6EQ 4LUEA 2QGGA 1WI7A 1G3YA 1NLPC 1PKTA 2FL7A 4E6RA 3J7AF 2VKNA 2ROTA 1M1KC 3OYEA 1JJ2A 2CSIA 2YUQA 2E6NA 2LQNA 2LJ0A 3JCMQ 4R0KA 4AMCA 1H8KA 3ZL7C 2CZ7B 2EGAA 3SDZA 3CCUT 1VYUA 2QQRA 3EAEA 1VQ7T 3A8OB 3TREA 4QQDA 1IGQA 2KI7A 4MDWA 3OYFA 1ZA1B 4A4FA 1W4SA 4M78D 3SD4A 3LWHA 1VQ7Q 1N27A 1B34A 2EWNA 1M3CA 2V8KA 4MZPA 4N4IA 2QQBA 1M27C 2DM1A 4F04B 2JTFA 2EJFA 1Y7XA 3VU3C 4XTVA 2GF7A 3HFOA 1UEBA 3TVTA 1UECA 3NPFA 4EMKA 1AD5A 1Q82C 4PK4A 3QSUA 1K8AR 4F7UA 3CCMT 2DL7A 4KT0E 2V1QA 3C95A 4J6XA 2D8JA 4MMKA 1Q7YC 2BE7D 1CKAA 1PRLC 3E9FA 3CCQT 4BACA 4E7IA 4C0FA 3M56A 4PJOE 4RCCA 2BUDA 3QZ5B 1C6VX 1VQLQ 1KSWA 2E12A 2RJDA 1VQMQ 4M7DD 4Y91A 2CKKA 3LW5E 2O01E 5KYUB 4RUGA 3MO8A 1MMGA 3OMGA 3HP9A 5KCHA 2X4XA 2MWOA 2FZCB 2NUTB 3O8VA 2IVWA 1G83A 1G3TA 5GANe 1VQLA 1QCNA 2QTVA 1QMCA 2ZGWA 1E6GA 2C0TA 4C0GA 4C8QD 1JJ2P 1U06A 5KYXA 2BIVA 2G6FX 3C4SA 4E7SA 5A0GA 2XDDA 4LD6A 3NHNA 3V8JA 1UDLA 2JM8A 2YRVA 3R6OA 1QVFA 1WHKA 3S3NA 5CQXA 1VQ5A 2MI6A 4NS5A 1OU9A 1VQMA 2MAMA 3CPWP 3EH1A 1WQ7A 4M4ZA 2QEXT 2ZPGB 2OTLT 3L2WA 5I22A 3G71T 4K11A 2EKOA 4M7AF 3QIIA 2P4TA 2VGNA 1XQHA 1QQJA 2RF0A 2K5LA 2DXTA 1M2VB 2LX9A 3GF5A 4PJOG 1O9SA 2PZ1A 2RHIA 5J3BA 4D6WA 4KGXB 5IAYA 2G3RA 4RTUA 2XMFA 4HVWA 2RQWA 3X20B 2KRNA 1VQ4Q 2RHYA 1BIAA 4E2FB 1HXDA 4ZGEB 1YHQQ 1VQ6A 2Y4XA 3V7CA 3CCST 3Q1JA 4O5VA 4E7JA 2RN8A 2KY9A 3OYGA 5LJ3d 2X3XD 2ZPHB 1KD1R 3SWNC 3C94A 4C5HA 4XTYA 2GTJA 3EG3A 4OP0A 3LGLA 2CP0A 1RABB 2KEAA 1AEYA 3NTIA 3FB9A 1VQKA 3M4GA 4E7LA 2KT1A 2K5IA 3S3MA 4GLMA 3M58A 4C5IA 2KK4A 1VQNT 2FYKA 2D8HA 4NOYA 2DBKA 5FU6C 1WJQA 4DBFA 2EIFA 1FMWA 3OYMA 2L3RA 3JB9H 2J6FA 1NYFA 2F5KA 4JUVA 2LCSA 2DYBA 2O9VA 2C0IA 3LYIA 2XIDA 4BE0A 4JJDA 3CD6Q 1V29B 3BY7A 3OYJA 1KD1C 5GAMf 4AFQC 3OSSC 1WHJA 2EYQA 2V26A 3CD6T 3BFMA 4CI0C 1BK2A 1B3QA 2AK5A 2RHUA 1LNXA 3CCRQ 3OS1A 1ZSZA 4EMKC 5GMKm 4C8QG 1XTDA 2CH4W 2YSQA 2AKKA 3CCVQ 4V2SA 4JJNK 5LJ3e 4BI8B 1E7OA 4JZ3A 3G71A 4AFSC 1VA7A 1IREB 2HD0A 1UB4A 2CREA 3LX7A 4M7DA 4JJCA 3GNGA 2K2VA 4C5GA 3VRZA 5CK9A 1ZSZC 1N8RU 5GAN6 2VGMA 1Q81U 1H641 5GAN2 2K57A 1PNJA 4C8QF 3RKXA 3CCEQ 2E1HA 1XJWB 3VS6A 2JT4A 4M75D 2MIOA 1X75C 1ZUYA 2XDBA 2VWFA 3QYGB 3P8HA 1YFNA 1CKBA 3OS5A 4N0AA 5GANf 4DEYA 5FRMA 3H9NA 2PQWA 1VQ9Q 5D6YA 2RI2A 2DYIA 1QVPA 2KYBA 1GXIE 3GNFB 3RMQA 3CCRT 2IPOB 2MCNA 2NUPB 1S72Q 1YJNT 3INZA 2ED0A 2EAYA 3JB9F 2YUPA 4HT8A 1SSHA 4AFUC 1K0XA 4PJOB 4M7DE 2BKDN 3OYHA 1AHJB 2QA4T 4ANJA 1G2BA 4BY6C 1YI2A 3SWNA 2L3QA 1VQPA 1NJIC 1ZA2B 3TQ7P 1UGPB 1JO8A 1K1ZA 1IRXA 1JXMA 1IO6A 4PFOA 3D7SB 2WSEE 3CCJA 3G1JA 2PUOB 4X34A 3CCQA 1ARKA 2KQWA 3CEYA 2DRMA 2NUPA 1MMDA 3M54A 5DY9A 2MYSA 2E3IA 3IQLA 1Q7YU 1M1KR 2CSQA 4BD3A 5HK3A 4P5NA 4KGZB 5GMKe 3V7RA 1OX9A 1Y96B 1OOTA 2DRKA 3H0HA 1B07A 1RLQC 3E1SA 2GTOA 2DJZA 3JCMb 1MMNA 4OVAA 4ESRA 4X9CA 4DBHA 3I9QA 2HMAA 2WSCE 1KD1U 2MPXC 4M7DB 3CPWS 2X35A 2RM4A 2A7YA 3FLGA 4LDXA 4XAXB 1RAGB 5LJ3j 2NUTA 3OS0A 2HDAA 2K7AA 1PKSA 2CGHA 2LC4A 3OY9A 4MDXA 1LOJA 3PT9A 3CCUA 2F1LA 2XG8D 5C0MA 4M77G 2XK0A 1WZOA 2E10A 3X24B 2LQKA 1I1JA 1ZUUA 4DBQA 2P0PA 2XD0A 2DL4A 4OB1B 1GRIA 3TEEA 4OMLA 3VYGA 1VQ8T 2FO0A 4HA8A 2HZYA 2L0AA 2RI5A 4AFZC 3LLRA 1WXTA 1N6AA 1SF9A 2H3JA 5GAN8 3CMAQ 1KIKA 1UGRB 2DAQA 3CBPA 2CP3A 3U23A 2EW3A 3MCAB 4IUPA 3H8ZA 3M9QA 4EPCA 4KBMB 2W0ZA 1M4ZA 5I2MA 4BI3A 4N4GA 2COYA 2JW4A 4KUDK 2LCCA 4DBRA 3EGXB 2LDMA 2A37A 1AZEA 3MP8A 7AT1B 1KQSS 3DLMA 5LJ3g 2YDLA 2ENMA 3CMAT 4ZN1A 3CCVT 4FT4A 1D3BA 2PVGB 1SG5A 5I11A 5FU7C 2F69A 2K2MA 4IIMA 3QWYA 4IKFA 3JB9J 2LJ3A 4RTWA 2D0QB 4M78F 3QZ9B 3VS2A 2LMJA 4PJOD 1S72T 5AYFA 3CCMQ 2VUBA 1YIJT 1EX4A 2NYSA 4LD9K 4FM4B 2KR3A 1W1FA 4IURA 1PG5B 2KDSA 3TSZA 2ATCB 1OZ3A 1M2VA 5GAMd 4ZTJA 2JMCA 3VV0A 4UC4A 4OMQA 4PNOA 1UJYA 2FPDA 4WCIA 3RBBB 4IUUA 3EFSA 1MMAA 1WHGA 1D0ZA 2V1RA 3UPUA 1YHQT 1SHFA 4BDZA 3CXCS 4JRKA 3A8GB 3SHWA 1G8XA 2ABLA 4C8QE 2EYXA 2FEIA 2JNGA 4FCYA 2ESWA 2LNVA 2VXFA 3JCMW 2FG0A 3GPLA 3QYHB 1R77A 2XU8A 2X4WA 3M0PA 2BZXA 4RTXA 4YTLA 4QQGA 5GANj 3MEUA 4J9HA 3PGGA 5FRNA 1QCOA 2KSSA 1GFDA 4PFPA 3ER0A 4M78C 4F7UG 2K3YA 4M7AE 2KROA 3THKA 3G4SQ 1JB0E 2JXBA 1H3HA 1RAFB 1K76A 2CZ6B 3HRUA 3HSBA 2AZVA 1M5Q1 2VVKA 1IZ6A 1VQ8Q 2MK5A 5IXBA 3EHQA 4FT2A 2A0FB 2D1XA 1VQ5Q 2QI2A 4MZTA 2OTJQ 2KRMA 5GANh 2FZKB 1Q95G 2DNUA 1GBQA 1ZLMA 1SEMA 2JUFA 1ZUKA 3DB4A 2HSEB 2YUNA 2CZ0B 1NZ9A 3EGUA 1F1BB 2X3WD 4IIOA 2E4HA 3KXTA 1YITA 2E5KA 2RMOA 1Q82R 3C0CA 3JCMc 2RK2A 1IGUA 3FEOA 5CKBA 4R55A 3CCSQ 1OU8A 1YJWT 2QDLA 2DZCA 3CBMA 1AOJA 2LT4A 3A98A 2BTTA 4B6MA 5GMKi 1WHHA 2K5FA 4A4KA 1TSFA 2DILA 1JBMA 4LDVA 3BDUA 3CQTA 2A28A 1VUBA 4EIKA 3PTAA 3RUXA 2OAWA 2QK0A 1H3ZA 3X28B 1NE8A 5C6SA 1VQOQ 4M77C 4WTOB 1UGQB 4C92D 5LJ5h 4KH0B 3CMET 3MHXA 1RLPC 1N5ZA 4J6YA 2D9TA 2O2OA 2OX7A 3L42A 4A54A 5GAMh 1NG2A 1T3SA 2RQUA 3L2ZA 2QEXA 1C1AA 2ZCFB 1YJ9T 1G3SA 2ED1A 4OF1A 2JTMA 4DA4A 1QKWA 4CC4B 1X6OA 1GCPA 3HRSA 1UHCA 2DXBA 1K73R 1WPYA 2KBTA 3WVDB 1RI0A 5IHIA 3MJXA 5KE3A 1YJNA 2YT6A 3JCMe 2QQSA 4NL2A 2B86A 2FRWA 4WF2A 2GGRA 2RHXA 3E2UA 1QWFA 5FWCA 4RCBA 5HY6A 6AT1B 3CC2A 3LGFA 4C8QA 3OA6A 3MEAA 3QXEB 2YHTA 1N8RC 2J06A 3P8DA 1BBZA 1C0MA 5CIUA 4JDSA 4PLLA 1IXDA 1Y07A 4Y28E 3VRYA 2FZGB 5J39A 3OYBA 1KQ1A 1KC8R 1D09B 1M2OA 2P84A 1MUZA 2HCKA 5GAMg 3WVEB 3QG1A 1JXOA 5GMKl 1QVGA 4N4HA 1X2QA 4XTUA 4HCCA 1VQOA 3HL8A 3JCMf 1UGVA 1LPLA 4FL6A 2BE9B 2QDYB 2LJ1A 1KQ2A 3O5ZA 1YCSB 1YIJQ 1EFNA 5FWBA 1KQSP 3CC4A 2DVEA 1M90R 2RA2A 1DJ7B 4DOVA 4LUDA 5IHKA 2DTHA 2I0NA 2MOXA 1X27A 2RJCA 1RADB 3BE3A 2DPPB 1ZSGA 4F7UB 2DO3A 4J8OA 1UGSB 1GL5A 3CCSA 1OULA 1TTHB 2DJQA 1M30A 1FMVA 3CCET 1OZ2A 4J9CA 4AT1B 4QKUA 2J05A 2EYYA 1AWOA 3H0IA 4M75E 3JCMV 3G6ET 4JLGA 2BZYA 1VQ4T 1D1BA 5LJ5f 4M7AG 4PJMA 1IB8A 1BU1A 2K3BA 1RAEB 4ELYC 3UA7A 1M90C 1U5SA 1ZBJA 3DB3A 3NTHA 1G3WA
chains in the Genus database with same CATH topology
4ESRA 2HEQA 1W70A 3I9QA 1I0CA 1HSQA 1YNZA 3EG2A 2ECZA 5L23A 2EYZA 1KFZA 1YWPA 3M0TA 3LH5A 2L3SA 5IHNA 1YN8A 2RQRA 2HDAA 1UTIA 1PKSA 2K7AA 3KFVA 1SHGA 2GQIA 2JM9A 4D8KA 3TSWA 3VS4A 4Z88A 2P4RA 1UFFA 1QLYA 2J6OA 2O88A 4GBQA 1MV0B 4A63B 1UHFA 4CC7A 2J6KA 2LX7A 2RQVA 2NWMA 2RNAA 2YUOA 1I1JA 1ZUUA 1V1CA 2F2VA 2K79A 1GCQA 2DL4A 1GRIA 2W10A 4X1VA 2KNBB 2AKLA 2OI3A 2CDTA 4LUEA 4OMLA 1WI7A 2C0OA 2L2PA 2FO0A 1A0NB 1NLPC 1PKTA 4E6RA 2VKNA 2L0AA 1T3LA 4AFZC 2ROTA 3H41A 1WXTA 4JZ4A 2CSIA 2YUQA 2EKHA 2LQNA 2KGTA 2LJ0A 1KIKA 1M3AA 2EGEA 4R0KA 2O9SA 4LNPA 1H8KA 3ZL7C 3U23A 2EW3A 1JU5C 2EGAA 4J9FA 1NEBA 4J9DA 2W0ZA 4HVUA 1VYUA 2FPFA 2DBMA 1OPLA 1M8MA 3UA6A 1AWXA 2JW4A 1S1NA 4RTTA 1OEBA 2JS0A 2A37A 4Y92A 1AZEA 4ORZA 2RPNA 2YDLA 2HSPA 1M3CA 2ENMA 1TUCA 4RTZA 1M27C 2DM1A 1OV3A 5IH2A 4OMNA 1KJWA 1SRLA 5I11A 2H8HA 3NGPA 3TVTA 2K2MA 4IIMA 1UECA 2NUZA 3NPFA 1AD5A 3QWYA 4F16A 4OMOA 2LJ3A 4RTWA 1T0JA 1E6HA 1MV3A 2DL7A 2V1QA 3VS2A 2D8JA 2LMJA 1NLOC 1CKAA 1PRLC 3VS0A 2DMOA 1M3BA 2FRYA 2LP5A 2KR3A 1PWTA 1Y0MA 2K6DA 1W1FA 2SRCA 1K4US 1KSWA 1UJ0A 2ROLA 3TSZA 2A36A 2SEMA 1VYVA 1WIEA 2JMCA 2EPDA 1HJDA 4HVVA 4OMQA 1UJYA 2FPDA 2EBPA 4RUGA 4WCIA 3RBBB 1WLPB 1TG0A 2DF6A 2K9GA 2V1RA 1SHFA 2BZ8A 1G83A 2KE9A 4CC2A 2F2WA 1E6GA 2C0TA 3SHWA 1H92A 2ABLA 1U06A 1WDXA 1X69A 2G6FX 2KT8A 2DX1A 2EYXA 1TUDA 2FEIA 3NHNA 2ESWA 1UDLA 2JM8A 5IXFA 2FG0A 1NEGA 4D8DA 3M0PA 2BZXA 4RTXA 4RTVA 1WXUA 1PHTA 1T0HA 1OPKA 4J9HA 3VS1A 4J9IA 1YWOA 1GFDA 1PRMC 2GBQA 2OJ2A 1Y57A 1X2KA 4M4ZA 2DA9A 3RNJA 4JPBW 2JMAA 2PNIA 2KROA 3THKA 1RI9A 1WA7A 4J9BA 5I22A 1LCKA 2DL8A 4K11A 2O31A 2F2XA 2JXBA 3M0SA 1H3HA 2EVRA 1K76A 2RF0A 2AZVA 2M51A 2VVKA 1BB9A 3I5SA 2PZ1A 4J9EA 2DL5A 5IXBA 3EHQA 1UG1A 2D1XA 1UE9A 4RTUA 2XMFA 4HVWA 3I35A 2RQWA 2KRMA 1SPKA 5GJVB 2KRNA 1GBRA 2AZSA 2DNUA 1GBQA 3M0UA 1ZLMA 1SEMA 2RN8A 1ZUKA 4LN2A 3PVQA 2X3XD 2YUNA 2CUBA 2LZ6B 2M0YA 2GNCA 3EGUA 3PVLA 2GTJA 3EG3A 3H0FA 2KEAA 3EHRA 1K0SA 1AEYA 4OMPA 2X3WD 2HBWA 4IIOA 4CC3A 4DEXA 1VYTA 2E5KA 2D0NA 2KT1A 2RMOA 3C0CA 2KRSA 2CH4A 4GLMA 2CUDA 2QDLA 1X43A 1AOJA 3A98A 1FYNA 3JV3A 2BTTA 2D8HA 2DBKA 3SEMA 4RTYA 4KRTA 4ZNXA 5FW9A 2DILA 3REAB 1SRMA 1WXBA 1JEGA 2J6FA 3CQTA 4JJBA 1NYFA 2A28A 2LCSA 3VS5A 2O9VA 2DYBA 1W6XA 4OMMA 2C0IA 3R6NA 4EIKA 2J7IA 4JJDA 1J3TA 2OAWA 5EC7A 2DL3A 4AFQC 1NM7A 1UUEA 3NMZC 4J9GA 1AWJA 1RLPC 1AWWA 1N5ZA 1BK2A 1WFWA 1B3QA 2AK5A 2KXDA 2O2OA 1I07A 1NG2A 1T3SA 2CH4W 2YSQA 1AVZC 2RQUA 1GCQC 2AKKA 3FJ5A 4Z8AA 1QCFA 2RQTA 2CT3A 4F14A 3UATA 2ED1A 5HCKA 1E7OA 1QKWA 4JZ3A 4CC4B 1GCPA 3VS3A 1UHCA 4AFSC 2L3PA 1VA7A 2CREA 4Z89A 2KBTA 3UF4A 5IHIA 4JJCA 1Z9ZA 3QWXX 3VRZA 1ZX6A 2DE0X 2YT6A 1ABQA 1ABOA 2B86A 2FRWA 1PNJA 2GGRA 1QWFA 2FPEA 2EQIA 5FWCA 3VS6A 2JT4A 1QWEA 2MIOA 1ZUYA 1NYGA 2VWFA 3PE0A 5ECAA 4AG2C 2J06A 1CKBA 4QT7A 3VS7A 1BBZA 4HCKA 1GFCA 3M0RA 3VRYA 3I5RA 2LNHB 1WYXA 4DEYA 1X6BA 1MUZA 2HCKA 1AZGB 1WX6A 1JXOA 1XOVA 1CSKA 3EG0A 2DLPA 1X2QA 2KYBA 2MCNA 1UGVA 3ULRB 4FSSA 1YP5A 2ED0A 2IIMA 2LJ1A 4LE9A 3O5ZA 1YCSB 2YUPA 1EFNA 3EG1A 4F17A 1JQQA 5FWBA 2KYMA 1SSHA 4AFUC 1K0XA 3GBQA 1RUWA 1X6GA 4LUDA 1G2BA 5IHKA 2I0NA 2MOXA 1X27A 4HXJA 2CT4A 2L3QA 1ZSGA 1GL5A 2KXCA 1JO8A 1K1ZA 1JXMA 1IO6A 2DJQA 2EYWA 1M30A 5GJWB 2LQWA 1Z9QA 4J9CA 2PTKA 1ARKA 2J05A 2DRMA 2EYYA 1AWOA 3H0IA 4AG1C 1K9AA 3IQLA 1U3OA 2A08A 3M0QA 3REBB 2EGCA 2JTEA 1QKXA 2CSQA 2BZYA 1FMKA 2DVJA 1HD3A 1BU1A 2K3BA 1OOTA 2DRKA 3H0HA 1B07A 3UA7A 1RLQC 1U5SA 1ZBJA 2GTOA 2JS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ESR A;  2HEQ A;  1W70 A;  3I9Q A;  1I0C A;  1HSQ A;  1YNZ A;  3EG2 A;  2ECZ A;  5L23 A;  2EYZ A;  1KFZ A;  1YWP A;  3M0T A;  3LH5 A;  2L3S A;  5IHN A;  1YN8 A;  2RQR A;  2HDA A;  1UTI A;  1PKS A;  2K7A A;  3KFV A;  1SHG A;  2GQI A;  2JM9 A;  4D8K A;  3TSW A;  3VS4 A;  4Z88 A;  2P4R A;  1UFF A;  1QLY A;  2J6O A;  2O88 A;  4GBQ A;  1MV0 B;  4A63 B;  1UHF A;  4CC7 A;  2J6K A;  2LX7 A;  2RQV A;  2NWM A;  2RNA A;  2YUO A;  1I1J A;  1ZUU A;  1V1C A;  2F2V A;  2K79 A;  1GCQ A;  2DL4 A;  1GRI A;  2W10 A;  4X1V A;  2KNB B;  2AKL A;  2OI3 A;  2CDT A;  4LUE A;  4OML A;  1WI7 A;  2C0O A;  2L2P A;  2FO0 A;  1A0N B;  1NLP C;  1PKT A;  4E6R A;  2VKN A;  2L0A A;  1T3L A;  4AFZ C;  2ROT A;  3H41 A;  1WXT A;  4JZ4 A;  2CSI A;  2YUQ A;  2EKH A;  2LQN A;  2KGT A;  2LJ0 A;  1KIK A;  1M3A A;  2EGE A;  4R0K A;  2O9S A;  4LNP A;  1H8K A;  3ZL7 C;  3U23 A;  2EW3 A;  1JU5 C;  2EGA A;  4J9F A;  1NEB A;  4J9D A;  2W0Z A;  4HVU A;  1VYU A;  2FPF A;  2DBM A;  1OPL A;  1M8M A;  3UA6 A;  1AWX A;  2JW4 A;  1S1N A;  4RTT A;  1OEB A;  2JS0 A;  2A37 A;  4Y92 A;  1AZE A;  4ORZ A;  2RPN A;  2YDL A;  2HSP A;  1M3C A;  2ENM A;  1TUC A;  4RTZ A;  1M27 C;  2DM1 A;  1OV3 A;  5IH2 A;  4OMN A;  1KJW A;  1SRL A;  5I11 A;  2H8H A;  3NGP A;  3TVT A;  2K2M A;  4IIM A;  1UEC A;  2NUZ A;  3NPF A;  1AD5 A;  3QWY A;  4F16 A;  4OMO A;  2LJ3 A;  4RTW A;  1T0J A;  1E6H A;  1MV3 A;  2DL7 A;  2V1Q A;  3VS2 A;  2D8J A;  2LMJ A;  1NLO C;  1CKA A;  1PRL C;  3VS0 A;  2DMO A;  1M3B A;  2FRY A;  2LP5 A;  2KR3 A;  1PWT A;  1Y0M A;  2K6D A;  1W1F A;  2SRC A;  1K4U S;  1KSW A;  1UJ0 A;  2ROL A;  3TSZ A;  2A36 A;  2SEM A;  1VYV A;  1WIE A;  2JMC A;  2EPD A;  1HJD A;  4HVV A;  4OMQ A;  1UJY A;  2FPD A;  2EBP A;  4RUG A;  4WCI A;  3RBB B;  1WLP B;  1TG0 A;  2DF6 A;  2K9G A;  2V1R A;  1SHF A;  2BZ8 A;  1G83 A;  2KE9 A;  4CC2 A;  2F2W A;  1E6G A;  2C0T A;  3SHW A;  1H92 A;  2ABL A;  1U06 A;  1WDX A;  1X69 A;  2G6F X;  2KT8 A;  2DX1 A;  2EYX A;  1TUD A;  2FEI A;  3NHN A;  2ESW A;  1UDL A;  2JM8 A;  5IXF A;  2FG0 A;  1NEG A;  4D8D A;  3M0P A;  2BZX A;  4RTX A;  4RTV A;  1WXU A;  1PHT A;  1T0H A;  1OPK A;  4J9H A;  3VS1 A;  4J9I A;  1YWO A;  1GFD A;  1PRM C;  2GBQ A;  2OJ2 A;  1Y57 A;  1X2K A;  4M4Z A;  2DA9 A;  3RNJ A;  4JPB W;  2JMA A;  2PNI A;  2KRO A;  3THK A;  1RI9 A;  1WA7 A;  4J9B A;  5I22 A;  1LCK A;  2DL8 A;  4K11 A;  2O31 A;  2F2X A;  2JXB A;  3M0S A;  1H3H A;  2EVR A;  1K76 A;  2RF0 A;  2AZV A;  2M51 A;  2VVK A;  1BB9 A;  3I5S A;  2PZ1 A;  4J9E A;  2DL5 A;  5IXB A;  3EHQ A;  1UG1 A;  2D1X A;  1UE9 A;  4RTU A;  2XMF A;  4HVW A;  3I35 A;  2RQW A;  2KRM A;  1SPK A;  5GJV B;  2KRN A;  1GBR A;  2AZS A;  2DNU A;  1GBQ A;  3M0U A;  1ZLM A;  1SEM A;  2RN8 A;  1ZUK A;  4LN2 A;  3PVQ A;  2X3X D;  2YUN A;  2CUB A;  2LZ6 B;  2M0Y A;  2GNC A;  3EGU A;  3PVL A;  2GTJ A;  3EG3 A;  3H0F A;  2KEA A;  3EHR A;  1K0S A;  1AEY A;  4OMP A;  2X3W D;  2HBW A;  4IIO A;  4CC3 A;  4DEX A;  1VYT A;  2E5K A;  2D0N A;  2KT1 A;  2RMO A;  3C0C A;  2KRS A;  2CH4 A;  4GLM A;  2CUD A;  2QDL A;  1X43 A;  1AOJ A;  3A98 A;  1FYN A;  3JV3 A;  2BTT A;  2D8H A;  2DBK A;  3SEM A;  4RTY A;  4KRT A;  4ZNX A;  5FW9 A;  2DIL A;  3REA B;  1SRM A;  1WXB A;  1JEG A;  2J6F A;  3CQT A;  4JJB A;  1NYF A;  2A28 A;  2LCS A;  3VS5 A;  2O9V A;  2DYB A;  1W6X A;  4OMM A;  2C0I A;  3R6N A;  4EIK A;  2J7I A;  4JJD A;  1J3T A;  2OAW A;  5EC7 A;  2DL3 A;  4AFQ C;  1NM7 A;  1UUE A;  3NMZ C;  4J9G A;  1AWJ A;  1RLP C;  1AWW A;  1N5Z A;  1BK2 A;  1WFW A;  1B3Q A;  2AK5 A;  2KXD A;  2O2O A;  1I07 A;  1NG2 A;  1T3S A;  2CH4 W;  2YSQ A;  1AVZ C;  2RQU A;  1GCQ C;  2AKK A;  3FJ5 A;  4Z8A A;  1QCF A;  2RQT A;  2CT3 A;  4F14 A;  3UAT A;  2ED1 A;  5HCK A;  1E7O A;  1QKW A;  4JZ3 A;  4CC4 B;  1GCP A;  3VS3 A;  1UHC A;  4AFS C;  2L3P A;  1VA7 A;  2CRE A;  4Z89 A;  2KBT A;  3UF4 A;  5IHI A;  4JJC A;  1Z9Z A;  3QWX X;  3VRZ A;  1ZX6 A;  2DE0 X;  2YT6 A;  1ABQ A;  1ABO A;  2B86 A;  2FRW A;  1PNJ A;  2GGR A;  1QWF A;  2FPE A;  2EQI A;  5FWC A;  3VS6 A;  2JT4 A;  1QWE A;  2MIO A;  1ZUY A;  1NYG A;  2VWF A;  3PE0 A;  5ECA A;  4AG2 C;  2J06 A;  1CKB A;  4QT7 A;  3VS7 A;  1BBZ A;  4HCK A;  1GFC A;  3M0R A;  3VRY A;  3I5R A;  2LNH B;  1WYX A;  4DEY A;  1X6B A;  1MUZ A;  2HCK A;  1AZG B;  1WX6 A;  1JXO A;  1XOV A;  1CSK A;  3EG0 A;  2DLP A;  1X2Q A;  2KYB A;  2MCN A;  1UGV A;  3ULR B;  4FSS A;  1YP5 A;  2ED0 A;  2IIM A;  2LJ1 A;  4LE9 A;  3O5Z A;  1YCS B;  2YUP A;  1EFN A;  3EG1 A;  4F17 A;  1JQQ A;  5FWB A;  2KYM A;  1SSH A;  4AFU C;  1K0X A;  3GBQ A;  1RUW A;  1X6G A;  4LUD A;  1G2B A;  5IHK A;  2I0N A;  2MOX A;  1X27 A;  4HXJ A;  2CT4 A;  2L3Q A;  1ZSG A;  1GL5 A;  2KXC A;  1JO8 A;  1K1Z A;  1JXM A;  1IO6 A;  2DJQ A;  2EYW A;  1M30 A;  5GJW B;  2LQW A;  1Z9Q A;  4J9C A;  2PTK A;  1ARK A;  2J05 A;  2DRM A;  2EYY A;  1AWO A;  3H0I A;  4AG1 C;  1K9A A;  3IQL A;  1U3O A;  2A08 A;  3M0Q A;  3REB B;  2EGC A;  2JTE A;  1QKX A;  2CSQ A;  2BZY A;  1FMK A;  2DVJ A;  1HD3 A;  1BU1 A;  2K3B A;  1OOT A;  2DRK A;  3H0H A;  1B07 A;  3UA7 A;  1RLQ C;  1U5S A;  1ZBJ A;  2GTO A;  2JS2 A; 
#chains in the Genus database with same CATH topology
 3EGX A;  3VUB A;  2HEQ A;  4J7F A;  1W70 A;  3I56 A;  4BE1 A;  2DIQ A;  1HSQ A;  1YNZ A;  5IN1 A;  2KMT A;  2EYZ A;  1VQ8 A;  3CC7 Q;  1KFZ A;  4FYW B;  4BE2 A;  3QO3 A;  3PIO A;  1VQ5 T;  5IHN A;  3I55 T;  3EFO B;  5GAN 4;  3KFV A;  1TU0 B;  3G4S A;  2GQI A;  4M77 B;  4M75 C;  4Z88 A;  4IUQ A;  4XU0 A;  2P4R A;  1UFF A;  2XIC A;  1QLY A;  2M1H A;  2J6O A;  2RB6 A;  2CZ1 B;  3OYN A;  5D6W A;  3CME Q;  4O6J A;  3HFN A;  2L89 A;  2J6K A;  2RQV A;  1U8R A;  2DXU A;  1V1C A;  4LDU A;  4B9X A;  2KNB B;  2AKL A;  4R56 A;  2OI3 A;  2CDT A;  3OBW A;  3CCL A;  3QHS A;  1A0N B;  4HT9 A;  1T3L A;  4M77 E;  2DZ9 A;  4JZ4 A;  5GAO r;  1IHV A;  1K73 C;  2CS7 A;  1VQ6 T;  2KGT A;  4EMG A;  2QA4 A;  1TH7 A;  2O9S A;  3CC4 T;  4GY5 A;  4C8Q C;  1JU5 C;  1NEB A;  3RER A;  4J9D A;  4M7D G;  4A4G A;  2C06 A;  4FSX A;  4PJO C;  3JCM J;  2FPF A;  2DBM A;  3SFM A;  2CP7 A;  1OPL A;  1M8M A;  3P8B B;  3HKS A;  3UA6 A;  1AWX A;  4RTT A;  5LJ3 f;  1VQN Q;  4BUG A;  1OEB A;  3CCJ T;  2O4X B;  3PMT A;  3A8H B;  5GMK h;  2HSP A;  1XNI A;  4FIB A;  1TUC A;  3C12 A;  1I81 A;  4RTZ A;  1OV3 A;  4OMN A;  1SRL A;  4ELZ C;  1M1K U;  3NGP A;  3VUZ A;  1YJW Q;  2DEU A;  1Q81 R;  5A0L A;  3UWN A;  2FHD A;  3MEV A;  4XTX A;  2V8I A;  4FYX B;  1E6H A;  1MV3 A;  3M57 A;  4E7H A;  2FVU A;  3HPW A;  2CYZ B;  1R8O B;  5M9O A;  3MP1 A;  3VS0 A;  4QW2 A;  1Q82 U;  4OGC A;  2FRY A;  1WHL A;  2LP5 A;  4M7A C;  4XU2 A;  1Y0M A;  5DLO A;  3FJP A;  4FYV B;  4M7A D;  3A8M B;  1VQP T;  1KC8 U;  4C92 F;  1WIE A;  2DD4 A;  2EBP A;  3ZEH A;  1WLP B;  3QPH A;  1TG0 A;  3I55 A;  4Q5W A;  2K9G A;  1BI3 A;  2BZ8 A;  1PSF A;  2F5T X;  1H92 A;  2ZPB B;  5AT1 B;  5KH6 A;  1WQW A;  1WDX A;  1EZZ B;  2R58 A;  2KT8 A;  5LJ5 j;  1VQL T;  2RK1 A;  2DXC A;  1TUD A;  3OW2 P;  1M90 U;  5IXF A;  3I55 Q;  3RKW A;  2EQJ A;  1RAH B;  4RTV A;  1WXU A;  1T0H A;  4ZTF A;  5KYW A;  4M75 B;  1BIB A;  2MWP A;  1KK7 A;  4MML A;  2GBQ A;  2OJ2 A;  3L2U A;  1Y57 A;  2JN0 A;  5LJ5 e;  5KYN A;  2DA9 A;  2JJ9 A;  2JMA A;  1R0C B;  5HK0 A;  1WA7 A;  4J9B A;  3SB2 A;  1D0X A;  2DL8 A;  3V7S A;  2O31 A;  3M0S A;  4BI4 A;  1FX7 A;  4LDW A;  1Q7Y R;  3OW2 S;  5GAN 3;  1BB9 A;  3I5S A;  1WJS A;  4J9E A;  2DL5 A;  3JSC A;  1SKU B;  2DEQ A;  3JB9 G;  2ZPE B;  1UE9 A;  2XDP A;  1YJW A;  3GIB A;  4JRP A;  3EG9 A;  3I35 A;  2IG0 A;  3MPU B;  1SPK A;  4L5G A;  1GBR A;  3OBY A;  3S3O A;  5GAO p;  4EDU A;  4DQ2 A;  3M0U A;  5FU6 B;  1ZSZ B;  3M59 A;  2CUB A;  2LZ6 B;  4JS4 A;  2CP2 A;  2GNC A;  1K73 U;  1K8A U;  3H0F A;  3L2R A;  2DIG A;  1KHC A;  2EJ9 A;  1VIE A;  1K0S A;  4OMP A;  2QXF A;  2LVM A;  4M77 F;  1X01 A;  2M9U A;  4DEX A;  3CME A;  1VYT A;  2D0N A;  1OYX A;  2PUK B;  2KRS A;  2CH4 A;  4M77 D;  2VC8 A;  2DKG A;  2VXE A;  5FRO A;  5A0D A;  4M78 E;  3LH0 A;  3JAM E;  4Z02 A;  2ZPF B;  1Y96 A;  3VJP A;  4TVR A;  2RHZ A;  3CCL Q;  3JV3 A;  2HBP A;  4E47 A;  2COZ A;  2QAZ A;  3SEM A;  4ZNX A;  2GFU A;  5FW9 A;  3T9N A;  3PMI A;  1LJO A;  1P92 A;  5CQY A;  2E64 A;  1SRM A;  1WXB A;  1JEG A;  4E7K A;  8AT1 B;  5D6X A;  2ZPI B;  4N0A C;  2CP6 A;  4M75 G;  3R6N A;  4BB7 A;  3BW1 A;  2LRQ A;  1J3T A;  5EC7 A;  1UUE A;  3HHT B;  1PM3 A;  3NMZ C;  3CXC A;  4M77 A;  5CKF A;  4J9G A;  4A53 A;  4QVZ A;  1AWJ A;  3M4Y A;  3QJ6 A;  3OYI A;  1AWW A;  1VQ9 A;  3AT1 B;  1WFW A;  2Y90 A;  4ZN3 A;  2JVV A;  1IHW A;  1BYM A;  3RIR A;  3CC7 A;  2PVD B;  1K9M C;  4Z8A A;  1QCF A;  3MET A;  4F14 A;  3UAT A;  4ME7 A;  5FU7 B;  2P0Q A;  3VS3 A;  1D1A A;  2L3P A;  1WHM A;  1ZBX A;  4L6V 5;  3UF4 A;  3GLX A;  1Q86 U;  3OYA A;  1Z9Z A;  2EFI A;  4OMF B;  3QUI A;  3FRN A;  2DE0 X;  4ZGJ B;  2L8D A;  3FIF A;  4ATO A;  2DET A;  2EQI A;  1TS9 A;  3CC4 Q;  1QWE A;  2OTL A;  3FDR A;  4AG2 C;  5GAO m;  4QT7 A;  3VS7 A;  4RG8 A;  1GFC A;  1N9S A;  4OB0 B;  1NPR A;  3I5R A;  5FLX E;  2LNH B;  5I2S A;  1WYX A;  3G7Z A;  3CCR A;  1AZG B;  1WX6 A;  1XOV A;  3KUF A;  4VUB A;  3CPW A;  1CSK A;  3EG0 A;  4FW2 A;  1M8V A;  1YBY A;  3X25 B;  1KHI A;  2HL3 A;  3ULR B;  4F7U E;  4FSS A;  4LE9 A;  1JJ2 S;  3EG1 A;  4F17 A;  2RH2 A;  4QQ6 A;  2QAS A;  2VB6 A;  2KYM A;  2DD5 A;  3A5Z B;  5KYU A;  3MP6 A;  5GMK j;  1I8F A;  5DM7 R;  3SWN B;  2GFA A;  5L8R E;  4HXJ A;  2YWW A;  1B7T A;  3QDR B;  2KXC A;  5GAN 7;  3JB9 D;  1OX8 A;  2EYW A;  2LQW A;  1Q81 C;  1Z9Q A;  4E7Z A;  2PTK A;  3ME9 A;  1VQK Q;  2QQ9 A;  1OQK A;  1QVG P;  3CC2 Q;  2E5Q A;  2QEX Q;  4IUT A;  3M0Q A;  2OTJ T;  3G4S T;  1QVF P;  3A1P A;  5CKE A;  2EQM A;  4PFZ A;  1NJI R;  1YJN Q;  3QKJ A;  5CO7 A;  3JRZ A;  1HD3 A;  4BY6 B;  3OMC A;  1D1C A;  1FXX A;  1YHQ A;  1VQ6 Q;  2RI3 A;  1VQ4 A;  5CVI A;  3JCM g;  2E41 A;  3L2Q A;  5IT9 E;  2D6F A;  1I0C A;  1JRI A;  1PD1 A;  2X51 A;  4M78 A;  1YWP A;  4GLK A;  2K3X A;  1BKB A;  1QW1 A;  3M0T A;  3EFR A;  2E3H A;  3VYH B;  3CPF A;  1M1G A;  2RQR A;  2M16 A;  2I2L A;  1SHG A;  2JM9 A;  4D8K A;  2MMP A;  3TSW A;  3VS4 A;  2OAU A;  3LWI A;  1BCO A;  2YRC A;  2O88 A;  5DLQ E;  4GBQ A;  1MV0 B;  1YIT Q;  2VV5 A;  3DKM A;  2OTL Q;  1ACM B;  1Q86 C;  2NWM A;  3GOX A;  5A2Q E;  4XU3 A;  3KBG A;  2QQA A;  4PJJ A;  2L5Q A;  3PFS A;  1GCQ A;  2W10 A;  1K9M R;  4X1V A;  2YXY A;  4FW1 A;  4EMH A;  3L1A A;  3ASK A;  2C0O A;  2L2P A;  5CCA A;  3QDF A;  4C92 G;  1PSE A;  3V8L A;  2GCX A;  3H41 A;  2E70 A;  1PCX A;  1BCM A;  3WXM B;  2EKH A;  4OB3 B;  1M3A A;  2EGE A;  4IUV A;  1NBE B;  4LNP A;  4QVC A;  2KAF A;  2LQ8 A;  3CCL T;  4J9F A;  4C92 C;  4MZM A;  4HVU A;  4ZGD B;  3M5A A;  4M7A B;  4KGV B;  1S1N A;  1FWZ A;  2LCL A;  2JS0 A;  3TCJ A;  4Y92 A;  4NL3 A;  3FC3 A;  4ORZ A;  2RPN A;  1YIT T;  2HKQ B;  4J6W A;  3TU4 K;  4XTW A;  5CKH A;  1I4K 1;  1Q86 R;  5IH2 A;  5CAI A;  1KJW A;  2H8H A;  1WJR A;  4XK8 E;  2OTJ A;  2NUZ A;  5LJ5 d;  2M0O A;  2RO0 A;  4F16 A;  4OMO A;  3OYK A;  2GQV A;  1T0J A;  1WNL A;  2HQE A;  1PC0 A;  1NLO C;  1VQK T;  1TOV A;  1VQ7 A;  3I56 T;  1AT1 B;  3OB9 A;  2DMO A;  1M3B A;  3URG A;  1PWT A;  2K6D A;  2SRC A;  1K4U S;  4BDY A;  1KQS A;  2YLB A;  3NTK A;  1UJ0 A;  2ROL A;  2WSF E;  2XI9 A;  2A36 A;  2SEM A;  1VYV A;  1HJD A;  2EPD A;  4HVV A;  1Y71 A;  4M78 B;  2H3E B;  2DF6 A;  2P0K A;  1RL2 A;  3PIP A;  2YLC A;  4KUI A;  2COW A;  2LT1 A;  2K4Y A;  2KE9 A;  4CC2 A;  2F2W A;  4KH1 B;  5GAN d;  3JB9 I;  3OYC A;  2QGF B;  4M75 A;  3CCM A;  1X69 A;  1KC8 C;  2DX1 A;  2KVQ G;  3G6E A;  1BI0 A;  4XTZ A;  1VQM T;  5HKC A;  4C92 A;  2XHC A;  3E9G A;  9ATC B;  2AIR B;  1NEG A;  4HCZ A;  4RMO A;  2DTO A;  4D8D A;  8ATC B;  1PHT A;  2PVO B;  1OPK A;  3VS1 A;  4J9I A;  1YWO A;  4OGE A;  3RDV A;  2HAX A;  1D3B B;  1PRM C;  4FU6 A;  1X2K A;  1MGQ A;  3CC2 T;  3RNJ A;  4JPB W;  4A4H A;  2PNI A;  1RI9 A;  1LCK A;  2RJF A;  2NLU A;  2F2X A;  2DK3 A;  2EVR A;  1R0B G;  2M51 A;  5LL6 S;  2QYZ A;  1I5L A;  4XQ3 A;  4M75 F;  1UG1 A;  2AHJ B;  1NJI U;  1ZHI A;  2ZAE A;  5GJV B;  1VQO T;  1M1F A;  3F70 A;  3JCM h;  2AZS A;  1WGS A;  4JRI A;  1W2B S;  4M78 G;  2EQU A;  4JS5 A;  2AT1 B;  4LN2 A;  1U1T A;  3PVQ A;  3OYY A;  3J81 E;  2M0Y A;  1RAC B;  1TWB A;  1K9M U;  3PVL A;  1G5V A;  1RAA B;  1U1S A;  4C0Z A;  3HRT A;  4C0D C;  5LJ5 g;  3EHR A;  3EFO A;  1M9S A;  2HBW A;  3A8L B;  4CC3 A;  1OI1 A;  2QTX A;  3RR6 A;  2CUD A;  3CMA A;  1W2B P;  4C92 E;  1X43 A;  1FYN A;  1KG1 A;  1EIF A;  4RTY A;  4KRT A;  5GAN g;  3GP8 A;  2JOY A;  3V8K A;  3PNW C;  5KCO A;  4DOW A;  3QBY A;  2YRD A;  3REA B;  2E65 A;  2PU9 B;  2XKO C;  4JJB A;  4XU1 A;  5I21 A;  5GAO n;  1PD0 A;  5KE2 A;  2EJG A;  1QVG S;  3VS5 A;  1W6X A;  4OMM A;  4C8Q B;  4PJL A;  1V76 A;  2HQX A;  2J7I A;  3AHU A;  5GAM j;  3CCU Q;  2DL3 A;  1NM7 A;  2V8J A;  5GAN 5;  2ZZD A;  3H6Z A;  2HL5 C;  2B8A A;  3M53 A;  3BDL A;  1MND A;  2KXD A;  1VQN A;  1I07 A;  3JCM P;  4J83 A;  2HQH A;  1K8A C;  2VAS A;  1AVZ C;  1GCQ C;  3RKY A;  3FJ5 A;  2R5M A;  2RQT A;  2CT3 A;  3CCQ Q;  3NFC A;  5HCK A;  3MKD A;  2QA4 Q;  3CCJ Q;  2RD1 A;  1YJ9 A;  2VYT A;  4HKE A;  4Z89 A;  3EH2 A;  4EMK B;  3EGD A;  3QWX X;  2DTI A;  3ZBD A;  4JRQ A;  1VQP Q;  1ZX6 A;  1YI2 Q;  2O4X A;  5J26 A;  1LVK A;  4B9W A;  1ABQ A;  3N5B B;  1ABO A;  2Z0W A;  1QP3 A;  1B34 B;  4PJO A;  2FPE A;  1VIF A;  1YJ9 Q;  4PJO F;  1NYG A;  3PE0 A;  5ECA A;  1W2B A;  5EG2 A;  1MNE A;  3RES A;  4HCK A;  1D0Y A;  2E6Z A;  4L59 A;  3M0R A;  4RKU E;  4J7I A;  5KYX B;  4RG2 A;  1X6B A;  2X4J A;  4II1 A;  2RJE A;  1VOM A;  2DLP A;  5D7U A;  2M02 A;  1RAI B;  2EQK A;  5LJ3 h;  4LDY A;  5CKD A;  3OYD A;  1YP5 A;  2IIM A;  3OS2 A;  4CRI A;  2LTO A;  3M55 A;  3MEW A;  3J80 E;  3I56 Q;  4QVD A;  1JQQ A;  1YI2 T;  1S72 A;  3EG9 B;  3GBQ A;  4C5E A;  2X4Y A;  4C0D B;  1SSF A;  3UT1 A;  1RUW A;  1I5O B;  3CBO A;  1X6G A;  4PKC C;  4PL6 A;  2R5A A;  2CT4 A;  5GAO q;  2A3L A;  4JLI A;  2QG9 B;  1TUG B;  1TXQ A;  5GJW B;  3DLL A;  4M7D F;  4J5Y A;  1VQ9 T;  5CR2 A;  5GAM e;  5KYW B;  4AG1 C;  3CCV A;  3OQ5 A;  1K9A A;  3CCE A;  1U3O A;  2A08 A;  3REB B;  1N9R A;  2EGC A;  2JTE A;  3ZFJ A;  5KYY B;  1QKX A;  1BI2 A;  1FMK A;  3E19 A;  2DVJ A;  3RMS A;  3OSV A;  2CP5 A;  4PLI A;  4LXC A;  4FYY B;  2R57 A;  3X26 B;  4HCB A;  3JCM X;  1HK9 A;  3G71 Q;  2JS2 A;  1HYO A;  1MHN A;  3CD6 A;  3OW2 A;  5KYY A;  1YIJ A;  4KUL A;  3QJY A;  4X9D A;  3EG2 A;  4M7A A;  2ECZ A;  5L23 A;  2JZ2 A;  4C92 B;  3L2V A;  1NPP A;  1N8R R;  4F7U F;  3EGD B;  1BI1 A;  2DER A;  2X9H A;  3LH5 A;  2MF2 A;  2L3S A;  1YN8 A;  2FB7 A;  4OB2 B;  2HKN A;  1UTI A;  1O75 A;  2Y4Y A;  2WAC A;  1YCY A;  1QP2 A;  4M7D C;  3OYL A;  3S6W A;  4A63 B;  3VKI A;  2HNI A;  1UHF A;  4CC7 A;  2LX7 A;  3CC7 T;  2RNA A;  2YUO A;  4A4E A;  4PJN A;  1ZQ1 A;  2F2V A;  2K79 A;  1QVF S;  2DFU A;  5GAO l;  3HTR A;  3UDC A;  3JCM d;  3CXC P;  3G6E Q;  4LUE A;  2QGG A;  1WI7 A;  1G3Y A;  1NLP C;  1PKT A;  2FL7 A;  4E6R A;  3J7A F;  2VKN A;  2ROT A;  1M1K C;  3OYE A;  1JJ2 A;  2CSI A;  2YUQ A;  2E6N A;  2LQN A;  2LJ0 A;  3JCM Q;  4R0K A;  4AMC A;  1H8K A;  3ZL7 C;  2CZ7 B;  2EGA A;  3SDZ A;  3CCU T;  1VYU A;  2QQR A;  3EAE A;  1VQ7 T;  3A8O B;  3TRE A;  4QQD A;  1IGQ A;  2KI7 A;  4MDW A;  3OYF A;  1ZA1 B;  4A4F A;  1W4S A;  4M78 D;  3SD4 A;  3LWH A;  1VQ7 Q;  1N27 A;  1B34 A;  2EWN A;  1M3C A;  2V8K A;  4MZP A;  4N4I A;  2QQB A;  1M27 C;  2DM1 A;  4F04 B;  2JTF A;  2EJF A;  1Y7X A;  3VU3 C;  4XTV A;  2GF7 A;  3HFO A;  1UEB A;  3TVT A;  1UEC A;  3NPF A;  4EMK A;  1AD5 A;  1Q82 C;  4PK4 A;  3QSU A;  1K8A R;  4F7U A;  3CCM T;  2DL7 A;  4KT0 E;  2V1Q A;  3C95 A;  4J6X A;  2D8J A;  4MMK A;  1Q7Y C;  2BE7 D;  1CKA A;  1PRL C;  3E9F A;  3CCQ T;  4BAC A;  4E7I A;  4C0F A;  3M56 A;  4PJO E;  4RCC A;  2BUD A;  3QZ5 B;  1C6V X;  1VQL Q;  1KSW A;  2E12 A;  2RJD A;  1VQM Q;  4M7D D;  4Y91 A;  2CKK A;  3LW5 E;  2O01 E;  5KYU B;  4RUG A;  3MO8 A;  1MMG A;  3OMG A;  3HP9 A;  5KCH A;  2X4X A;  2MWO A;  2FZC B;  2NUT B;  3O8V A;  2IVW A;  1G83 A;  1G3T A;  5GAN e;  1VQL A;  1QCN A;  2QTV A;  1QMC A;  2ZGW A;  1E6G A;  2C0T A;  4C0G A;  4C8Q D;  1JJ2 P;  1U06 A;  5KYX A;  2BIV A;  2G6F X;  3C4S A;  4E7S A;  5A0G A;  2XDD A;  4LD6 A;  3NHN A;  3V8J A;  1UDL A;  2JM8 A;  2YRV A;  3R6O A;  1QVF A;  1WHK A;  3S3N A;  5CQX A;  1VQ5 A;  2MI6 A;  4NS5 A;  1OU9 A;  1VQM A;  2MAM A;  3CPW P;  3EH1 A;  1WQ7 A;  4M4Z A;  2QEX T;  2ZPG B;  2OTL T;  3L2W A;  5I22 A;  3G71 T;  4K11 A;  2EKO A;  4M7A F;  3QII A;  2P4T A;  2VGN A;  1XQH A;  1QQJ A;  2RF0 A;  2K5L A;  2DXT A;  1M2V B;  2LX9 A;  3GF5 A;  4PJO G;  1O9S A;  2PZ1 A;  2RHI A;  5J3B A;  4D6W A;  4KGX B;  5IAY A;  2G3R A;  4RTU A;  2XMF A;  4HVW A;  2RQW A;  3X20 B;  2KRN A;  1VQ4 Q;  2RHY A;  1BIA A;  4E2F B;  1HXD A;  4ZGE B;  1YHQ Q;  1VQ6 A;  2Y4X A;  3V7C A;  3CCS T;  3Q1J A;  4O5V A;  4E7J A;  2RN8 A;  2KY9 A;  3OYG A;  5LJ3 d;  2X3X D;  2ZPH B;  1KD1 R;  3SWN C;  3C94 A;  4C5H A;  4XTY A;  2GTJ A;  3EG3 A;  4OP0 A;  3LGL A;  2CP0 A;  1RAB B;  2KEA A;  1AEY A;  3NTI A;  3FB9 A;  1VQK A;  3M4G A;  4E7L A;  2KT1 A;  2K5I A;  3S3M A;  4GLM A;  3M58 A;  4C5I A;  2KK4 A;  1VQN T;  2FYK A;  2D8H A;  4NOY A;  2DBK A;  5FU6 C;  1WJQ A;  4DBF A;  2EIF A;  1FMW A;  3OYM A;  2L3R A;  3JB9 H;  2J6F A;  1NYF A;  2F5K A;  4JUV A;  2LCS A;  2DYB A;  2O9V A;  2C0I A;  3LYI A;  2XID A;  4BE0 A;  4JJD A;  3CD6 Q;  1V29 B;  3BY7 A;  3OYJ A;  1KD1 C;  5GAM f;  4AFQ C;  3OSS C;  1WHJ A;  2EYQ A;  2V26 A;  3CD6 T;  3BFM A;  4CI0 C;  1BK2 A;  1B3Q A;  2AK5 A;  2RHU A;  1LNX A;  3CCR Q;  3OS1 A;  1ZSZ A;  4EMK C;  5GMK m;  4C8Q G;  1XTD A;  2CH4 W;  2YSQ A;  2AKK A;  3CCV Q;  4V2S A;  4JJN K;  5LJ3 e;  4BI8 B;  1E7O A;  4JZ3 A;  3G71 A;  4AFS C;  1VA7 A;  1IRE B;  2HD0 A;  1UB4 A;  2CRE A;  3LX7 A;  4M7D A;  4JJC A;  3GNG A;  2K2V A;  4C5G A;  3VRZ A;  5CK9 A;  1ZSZ C;  1N8R U;  5GAN 6;  2VGM A;  1Q81 U;  1H64 1;  5GAN 2;  2K57 A;  1PNJ A;  4C8Q F;  3RKX A;  3CCE Q;  2E1H A;  1XJW B;  3VS6 A;  2JT4 A;  4M75 D;  2MIO A;  1X75 C;  1ZUY A;  2XDB A;  2VWF A;  3QYG B;  3P8H A;  1YFN A;  1CKB A;  3OS5 A;  4N0A A;  5GAN f;  4DEY A;  5FRM A;  3H9N A;  2PQW A;  1VQ9 Q;  5D6Y A;  2RI2 A;  2DYI A;  1QVP A;  2KYB A;  1GXI E;  3GNF B;  3RMQ A;  3CCR T;  2IPO B;  2MCN A;  2NUP B;  1S72 Q;  1YJN T;  3INZ A;  2ED0 A;  2EAY A;  3JB9 F;  2YUP A;  4HT8 A;  1SSH A;  4AFU C;  1K0X A;  4PJO B;  4M7D E;  2BKD N;  3OYH A;  1AHJ B;  2QA4 T;  4ANJ A;  1G2B A;  4BY6 C;  1YI2 A;  3SWN A;  2L3Q A;  1VQP A;  1NJI C;  1ZA2 B;  3TQ7 P;  1UGP B;  1JO8 A;  1K1Z A;  1IRX A;  1JXM A;  1IO6 A;  4PFO A;  3D7S B;  2WSE E;  3CCJ A;  3G1J A;  2PUO B;  4X34 A;  3CCQ A;  1ARK A;  2KQW A;  3CEY A;  2DRM A;  2NUP A;  1MMD A;  3M54 A;  5DY9 A;  2MYS A;  2E3I A;  3IQL A;  1Q7Y U;  1M1K R;  2CSQ A;  4BD3 A;  5HK3 A;  4P5N A;  4KGZ B;  5GMK e;  3V7R A;  1OX9 A;  1Y96 B;  1OOT A;  2DRK A;  3H0H A;  1B07 A;  1RLQ C;  3E1S A;  2GTO A;  2DJZ A;  3JCM b;  1MMN A;  4OVA A;  4ESR A;  4X9C A;  4DBH A;  3I9Q A;  2HMA A;  2WSC E;  1KD1 U;  2MPX C;  4M7D B;  3CPW S;  2X35 A;  2RM4 A;  2A7Y A;  3FLG A;  4LDX A;  4XAX B;  1RAG B;  5LJ3 j;  2NUT A;  3OS0 A;  2HDA A;  2K7A A;  1PKS A;  2CGH A;  2LC4 A;  3OY9 A;  4MDX A;  1LOJ A;  3PT9 A;  3CCU A;  2F1L A;  2XG8 D;  5C0M A;  4M77 G;  2XK0 A;  1WZO A;  2E10 A;  3X24 B;  2LQK A;  1I1J A;  1ZUU A;  4DBQ A;  2P0P A;  2XD0 A;  2DL4 A;  4OB1 B;  1GRI A;  3TEE A;  4OML A;  3VYG A;  1VQ8 T;  2FO0 A;  4HA8 A;  2HZY A;  2L0A A;  2RI5 A;  4AFZ C;  3LLR A;  1WXT A;  1N6A A;  1SF9 A;  2H3J A;  5GAN 8;  3CMA Q;  1KIK A;  1UGR B;  2DAQ A;  3CBP A;  2CP3 A;  3U23 A;  2EW3 A;  3MCA B;  4IUP A;  3H8Z A;  3M9Q A;  4EPC A;  4KBM B;  2W0Z A;  1M4Z A;  5I2M A;  4BI3 A;  4N4G A;  2COY A;  2JW4 A;  4KUD K;  2LCC A;  4DBR A;  3EGX B;  2LDM A;  2A37 A;  1AZE A;  3MP8 A;  7AT1 B;  1KQS S;  3DLM A;  5LJ3 g;  2YDL A;  2ENM A;  3CMA T;  4ZN1 A;  3CCV T;  4FT4 A;  1D3B A;  2PVG B;  1SG5 A;  5I11 A;  5FU7 C;  2F69 A;  2K2M A;  4IIM A;  3QWY A;  4IKF A;  3JB9 J;  2LJ3 A;  4RTW A;  2D0Q B;  4M78 F;  3QZ9 B;  3VS2 A;  2LMJ A;  4PJO D;  1S72 T;  5AYF A;  3CCM Q;  2VUB A;  1YIJ T;  1EX4 A;  2NYS A;  4LD9 K;  4FM4 B;  2KR3 A;  1W1F A;  4IUR A;  1PG5 B;  2KDS A;  3TSZ A;  2ATC B;  1OZ3 A;  1M2V A;  5GAM d;  4ZTJ A;  2JMC A;  3VV0 A;  4UC4 A;  4OMQ A;  4PNO A;  1UJY A;  2FPD A;  4WCI A;  3RBB B;  4IUU A;  3EFS A;  1MMA A;  1WHG A;  1D0Z A;  2V1R A;  3UPU A;  1YHQ T;  1SHF A;  4BDZ A;  3CXC S;  4JRK A;  3A8G B;  3SHW A;  1G8X A;  2ABL A;  4C8Q E;  2EYX A;  2FEI A;  2JNG A;  4FCY A;  2ESW A;  2LNV A;  2VXF A;  3JCM W;  2FG0 A;  3GPL A;  3QYH B;  1R77 A;  2XU8 A;  2X4W A;  3M0P A;  2BZX A;  4RTX A;  4YTL A;  4QQG A;  5GAN j;  3MEU A;  4J9H A;  3PGG A;  5FRN A;  1QCO A;  2KSS A;  1GFD A;  4PFP A;  3ER0 A;  4M78 C;  4F7U G;  2K3Y A;  4M7A E;  2KRO A;  3THK A;  3G4S Q;  1JB0 E;  2JXB A;  1H3H A;  1RAF B;  1K76 A;  2CZ6 B;  3HRU A;  3HSB A;  2AZV A;  1M5Q 1;  2VVK A;  1IZ6 A;  1VQ8 Q;  2MK5 A;  5IXB A;  3EHQ A;  4FT2 A;  2A0F B;  2D1X A;  1VQ5 Q;  2QI2 A;  4MZT A;  2OTJ Q;  2KRM A;  5GAN h;  2FZK B;  1Q95 G;  2DNU A;  1GBQ A;  1ZLM A;  1SEM A;  2JUF A;  1ZUK A;  3DB4 A;  2HSE B;  2YUN A;  2CZ0 B;  1NZ9 A;  3EGU A;  1F1B B;  2X3W D;  4IIO A;  2E4H A;  3KXT A;  1YIT A;  2E5K A;  2RMO A;  1Q82 R;  3C0C A;  3JCM c;  2RK2 A;  1IGU A;  3FEO A;  5CKB A;  4R55 A;  3CCS Q;  1OU8 A;  1YJW T;  2QDL A;  2DZC A;  3CBM A;  1AOJ A;  2LT4 A;  3A98 A;  2BTT A;  4B6M A;  5GMK i;  1WHH A;  2K5F A;  4A4K A;  1TSF A;  2DIL A;  1JBM A;  4LDV A;  3BDU A;  3CQT A;  2A28 A;  1VUB A;  4EIK A;  3PTA A;  3RUX A;  2OAW A;  2QK0 A;  1H3Z A;  3X28 B;  1NE8 A;  5C6S A;  1VQO Q;  4M77 C;  4WTO B;  1UGQ B;  4C92 D;  5LJ5 h;  4KH0 B;  3CME T;  3MHX A;  1RLP C;  1N5Z A;  4J6Y A;  2D9T A;  2O2O A;  2OX7 A;  3L42 A;  4A54 A;  5GAM h;  1NG2 A;  1T3S A;  2RQU A;  3L2Z A;  2QEX A;  1C1A A;  2ZCF B;  1YJ9 T;  1G3S A;  2ED1 A;  4OF1 A;  2JTM A;  4DA4 A;  1QKW A;  4CC4 B;  1X6O A;  1GCP A;  3HRS A;  1UHC A;  2DXB A;  1K73 R;  1WPY A;  2KBT A;  3WVD B;  1RI0 A;  5IHI A;  3MJX A;  5KE3 A;  1YJN A;  2YT6 A;  3JCM e;  2QQS A;  4NL2 A;  2B86 A;  2FRW A;  4WF2 A;  2GGR A;  2RHX A;  3E2U A;  1QWF A;  5FWC A;  4RCB A;  5HY6 A;  6AT1 B;  3CC2 A;  3LGF A;  4C8Q A;  3OA6 A;  3MEA A;  3QXE B;  2YHT A;  1N8R C;  2J06 A;  3P8D A;  1BBZ A;  1C0M A;  5CIU A;  4JDS A;  4PLL A;  1IXD A;  1Y07 A;  4Y28 E;  3VRY A;  2FZG B;  5J39 A;  3OYB A;  1KQ1 A;  1KC8 R;  1D09 B;  1M2O A;  2P84 A;  1MUZ A;  2HCK A;  5GAM g;  3WVE B;  3QG1 A;  1JXO A;  5GMK l;  1QVG A;  4N4H A;  1X2Q A;  4XTU A;  4HCC A;  1VQO A;  3HL8 A;  3JCM f;  1UGV A;  1LPL A;  4FL6 A;  2BE9 B;  2QDY B;  2LJ1 A;  1KQ2 A;  3O5Z A;  1YCS B;  1YIJ Q;  1EFN A;  5FWB A;  1KQS P;  3CC4 A;  2DVE A;  1M90 R;  2RA2 A;  1DJ7 B;  4DOV A;  4LUD A;  5IHK A;  2DTH A;  2I0N A;  2MOX A;  1X27 A;  2RJC A;  1RAD B;  3BE3 A;  2DPP B;  1ZSG A;  4F7U B;  2DO3 A;  4J8O A;  1UGS B;  1GL5 A;  3CCS A;  1OUL A;  1TTH B;  2DJQ A;  1M30 A;  1FMV A;  3CCE T;  1OZ2 A;  4J9C A;  4AT1 B;  4QKU A;  2J05 A;  2EYY A;  1AWO A;  3H0I A;  4M75 E;  3JCM V;  3G6E T;  4JLG A;  2BZY A;  1VQ4 T;  1D1B A;  5LJ5 f;  4M7A G;  4PJM A;  1IB8 A;  1BU1 A;  2K3B A;  1RAE B;  4ELY C;  3UA7 A;  1M90 C;  1U5S A;  1ZBJ A;  3DB3 A;  3NTH A;  1G3W A; 
#chains in the Genus database with same CATH homology
 4ESR A;  2HEQ A;  1W70 A;  3I9Q A;  1I0C A;  1HSQ A;  1YNZ A;  3EG2 A;  2ECZ A;  5L23 A;  2EYZ A;  1KFZ A;  1YWP A;  3M0T A;  3LH5 A;  2L3S A;  5IHN A;  1YN8 A;  2RQR A;  2HDA A;  1UTI A;  1PKS A;  2K7A A;  3KFV A;  1SHG A;  2GQI A;  2JM9 A;  4D8K A;  3TSW A;  3VS4 A;  4Z88 A;  2P4R A;  1UFF A;  1QLY A;  2J6O A;  2O88 A;  4GBQ A;  1MV0 B;  4A63 B;  1UHF A;  4CC7 A;  2J6K A;  2LX7 A;  2RQV A;  2NWM A;  2RNA A;  2YUO A;  1I1J A;  1ZUU A;  1V1C A;  2F2V A;  2K79 A;  1GCQ A;  2DL4 A;  1GRI A;  2W10 A;  4X1V A;  2KNB B;  2AKL A;  2OI3 A;  2CDT A;  4LUE A;  4OML A;  1WI7 A;  2C0O A;  2L2P A;  2FO0 A;  1A0N B;  1NLP C;  1PKT A;  4E6R A;  2VKN A;  2L0A A;  1T3L A;  4AFZ C;  2ROT A;  3H41 A;  1WXT A;  4JZ4 A;  2CSI A;  2YUQ A;  2EKH A;  2LQN A;  2KGT A;  2LJ0 A;  1KIK A;  1M3A A;  2EGE A;  4R0K A;  2O9S A;  4LNP A;  1H8K A;  3ZL7 C;  3U23 A;  2EW3 A;  1JU5 C;  2EGA A;  4J9F A;  1NEB A;  4J9D A;  2W0Z A;  4HVU A;  1VYU A;  2FPF A;  2DBM A;  1OPL A;  1M8M A;  3UA6 A;  1AWX A;  2JW4 A;  1S1N A;  4RTT A;  1OEB A;  2JS0 A;  2A37 A;  4Y92 A;  1AZE A;  4ORZ A;  2RPN A;  2YDL A;  2HSP A;  1M3C A;  2ENM A;  1TUC A;  4RTZ A;  1M27 C;  2DM1 A;  1OV3 A;  5IH2 A;  4OMN A;  1KJW A;  1SRL A;  5I11 A;  2H8H A;  3NGP A;  3TVT A;  2K2M A;  4IIM A;  1UEC A;  2NUZ A;  3NPF A;  1AD5 A;  3QWY A;  4F16 A;  4OMO A;  2LJ3 A;  4RTW A;  1T0J A;  1E6H A;  1MV3 A;  2DL7 A;  2V1Q A;  3VS2 A;  2D8J A;  2LMJ A;  1NLO C;  1CKA A;  1PRL C;  3VS0 A;  2DMO A;  1M3B A;  2FRY A;  2LP5 A;  2KR3 A;  1PWT A;  1Y0M A;  2K6D A;  1W1F A;  2SRC A;  1K4U S;  1KSW A;  1UJ0 A;  2ROL A;  3TSZ A;  2A36 A;  2SEM A;  1VYV A;  1WIE A;  2JMC A;  2EPD A;  1HJD A;  4HVV A;  4OMQ A;  1UJY A;  2FPD A;  2EBP A;  4RUG A;  4WCI A;  3RBB B;  1WLP B;  1TG0 A;  2DF6 A;  2K9G A;  2V1R A;  1SHF A;  2BZ8 A;  1G83 A;  2KE9 A;  4CC2 A;  2F2W A;  1E6G A;  2C0T A;  3SHW A;  1H92 A;  2ABL A;  1U06 A;  1WDX A;  1X69 A;  2G6F X;  2KT8 A;  2DX1 A;  2EYX A;  1TUD A;  2FEI A;  3NHN A;  2ESW A;  1UDL A;  2JM8 A;  5IXF A;  2FG0 A;  1NEG A;  4D8D A;  3M0P A;  2BZX A;  4RTX A;  4RTV A;  1WXU A;  1PHT A;  1T0H A;  1OPK A;  4J9H A;  3VS1 A;  4J9I A;  1YWO A;  1GFD A;  1PRM C;  2GBQ A;  2OJ2 A;  1Y57 A;  1X2K A;  4M4Z A;  2DA9 A;  3RNJ A;  4JPB W;  2JMA A;  2PNI A;  2KRO A;  3THK A;  1RI9 A;  1WA7 A;  4J9B A;  5I22 A;  1LCK A;  2DL8 A;  4K11 A;  2O31 A;  2F2X A;  2JXB A;  3M0S A;  1H3H A;  2EVR A;  1K76 A;  2RF0 A;  2AZV A;  2M51 A;  2VVK A;  1BB9 A;  3I5S A;  2PZ1 A;  4J9E A;  2DL5 A;  5IXB A;  3EHQ A;  1UG1 A;  2D1X A;  1UE9 A;  4RTU A;  2XMF A;  4HVW A;  3I35 A;  2RQW A;  2KRM A;  1SPK A;  5GJV B;  2KRN A;  1GBR A;  2AZS A;  2DNU A;  1GBQ A;  3M0U A;  1ZLM A;  1SEM A;  2RN8 A;  1ZUK A;  4LN2 A;  3PVQ A;  2X3X D;  2YUN A;  2CUB A;  2LZ6 B;  2M0Y A;  2GNC A;  3EGU A;  3PVL A;  2GTJ A;  3EG3 A;  3H0F A;  2KEA A;  3EHR A;  1K0S A;  1AEY A;  4OMP A;  2X3W D;  2HBW A;  4IIO A;  4CC3 A;  4DEX A;  1VYT A;  2E5K A;  2D0N A;  2KT1 A;  2RMO A;  3C0C A;  2KRS A;  2CH4 A;  4GLM A;  2CUD A;  2QDL A;  1X43 A;  1AOJ A;  3A98 A;  1FYN A;  3JV3 A;  2BTT A;  2D8H A;  2DBK A;  3SEM A;  4RTY A;  4KRT A;  4ZNX A;  5FW9 A;  2DIL A;  3REA B;  1SRM A;  1WXB A;  1JEG A;  2J6F A;  3CQT A;  4JJB A;  1NYF A;  2A28 A;  2LCS A;  3VS5 A;  2O9V A;  2DYB A;  1W6X A;  4OMM A;  2C0I A;  3R6N A;  4EIK A;  2J7I A;  4JJD A;  1J3T A;  2OAW A;  5EC7 A;  2DL3 A;  4AFQ C;  1NM7 A;  1UUE A;  3NMZ C;  4J9G A;  1AWJ A;  1RLP C;  1AWW A;  1N5Z A;  1BK2 A;  1WFW A;  1B3Q A;  2AK5 A;  2KXD A;  2O2O A;  1I07 A;  1NG2 A;  1T3S A;  2CH4 W;  2YSQ A;  1AVZ C;  2RQU A;  1GCQ C;  2AKK A;  3FJ5 A;  4Z8A A;  1QCF A;  2RQT A;  2CT3 A;  4F14 A;  3UAT A;  2ED1 A;  5HCK A;  1E7O A;  1QKW A;  4JZ3 A;  4CC4 B;  1GCP A;  3VS3 A;  1UHC A;  4AFS C;  2L3P A;  1VA7 A;  2CRE A;  4Z89 A;  2KBT A;  3UF4 A;  5IHI A;  4JJC A;  1Z9Z A;  3QWX X;  3VRZ A;  1ZX6 A;  2DE0 X;  2YT6 A;  1ABQ A;  1ABO A;  2B86 A;  2FRW A;  1PNJ A;  2GGR A;  1QWF A;  2FPE A;  2EQI A;  5FWC A;  3VS6 A;  2JT4 A;  1QWE A;  2MIO A;  1ZUY A;  1NYG A;  2VWF A;  3PE0 A;  5ECA A;  4AG2 C;  2J06 A;  1CKB A;  4QT7 A;  3VS7 A;  1BBZ A;  4HCK A;  1GFC A;  3M0R A;  3VRY A;  3I5R A;  2LNH B;  1WYX A;  4DEY A;  1X6B A;  1MUZ A;  2HCK A;  1AZG B;  1WX6 A;  1JXO A;  1XOV A;  1CSK A;  3EG0 A;  2DLP A;  1X2Q A;  2KYB A;  2MCN A;  1UGV A;  3ULR B;  4FSS A;  1YP5 A;  2ED0 A;  2IIM A;  2LJ1 A;  4LE9 A;  3O5Z A;  1YCS B;  2YUP A;  1EFN A;  3EG1 A;  4F17 A;  1JQQ A;  5FWB A;  2KYM A;  1SSH A;  4AFU C;  1K0X A;  3GBQ A;  1RUW A;  1X6G A;  4LUD A;  1G2B A;  5IHK A;  2I0N A;  2MOX A;  1X27 A;  4HXJ A;  2CT4 A;  2L3Q A;  1ZSG A;  1GL5 A;  2KXC A;  1JO8 A;  1K1Z A;  1JXM A;  1IO6 A;  2DJQ A;  2EYW A;  1M30 A;  5GJW B;  2LQW A;  1Z9Q A;  4J9C A;  2PTK A;  1ARK A;  2J05 A;  2DRM A;  2EYY A;  1AWO A;  3H0I A;  4AG1 C;  1K9A A;  3IQL A;  1U3O A;  2A08 A;  3M0Q A;  3REB B;  2EGC A;  2JTE A;  1QKX A;  2CSQ A;  2BZY A;  1FMK A;  2DVJ A;  1HD3 A;  1BU1 A;  2K3B A;  1OOT A;  2DRK A;  3H0H A;  1B07 A;  3UA7 A;  1RLQ C;  1U5S A;  1ZBJ A;  2GTO A;  2JS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...