2JMAA

R21a spc-sh3:p41 complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
MDETGKELVLALYDYQEKSPAEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The high-resolution NMR structure of the R21A Spc-SH3:P41 complex: Understanding the determinants of binding affinity by comparison with Abl-SH3
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Spectrin alpha chain, brain
total genus 12
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jmaA00
1PNJA 1KIKA 2V1RA 1ZUYA 4CC2A 1ARKA 2DNUA 3IQLA 4OMQA 1IO6A 2MOXA 1YNZA 4JPBW 2YT6A 5IXBA 1GCPA 2HCKA 1GCQC 2KE9A 2QDLA 1WIEA 3M0TA 3VRZA 5L23A 1YWOA 2DE0X 2DJQA 1BBZA 1AVZC 2DBMA 2FPDA 4AFZC 2EGEA 2PZ1A 2V1QA 1RI9A 4RTVA 4KRTA 4LUEA 1G2BA 2DL4A 2F2XA 2GGRA 4RTTA 2KRMA 3UA7A 2VVKA 4CC4B 2J7IA 3UF4A 1OPKA 3KFVA 1QWEA 1YP5A 1ABQA 2JT4A 5I11A 1AEYA 1NYFA 2G6FX 2JMAA 1X69A 2GTOA 2LJ3A 1E6HA 1VYUA 1KJWA 2O88A 2LQWA 1JU5C 1WFWA 2BZXA 1UFFA 2RQUA 1NEGA 4Z8AA 1WI7A 1V1CA 2RQVA 2KXDA 2YUPA 3QWYA 1GBRA 2ESWA 1Y0MA 2D0NA 2L2PA 2EVRA 3FJ5A 2AZVA 2YDLA 2L3PA 4ZNXA 1SHGA 5FW9A 2F2WA 2ECZA 5HCKA 3H0FA 3RNJA 4DEXA 2SEMA 4F16A 2PNIA 1M3AA 2KRNA 2KNBB 2C0TA 3EG3A 2W10A 4HVVA 4J9CA 1SSHA 2RMOA 3EG1A 1K4US 1SEMA 2A36A 3GBQA 2EGCA 2NUZA 1AWOA 2H8HA 3M0RA 4HXJA 3UATA 2BZ8A 4E6RA 3EG0A 1WLPB 2B86A 1T0JA 1VYVA 1K0SA 3EGUA 4RTZA 1TG0A 1UECA 1ZSGA 1QKXA 1ABOA 3H41A 2KGTA 1WXTA 1TUDA 3THKA 2MCNA 1M27C 2K9GA 3ULRB 1UG1A 3TVTA 1JXMA 2GNCA 1JQQA 2L3SA 2CH4A 2NWMA 3M0SA 1CKAA 2EKHA 4Z88A 1Z9ZA 1SPKA 2DL8A 2YSQA 2CT3A 2EYZA 2OJ2A 3C0CA 3SHWA 1UE9A 3TSWA 1AZGB 3VS3A 1OPLA 1I0CA 4Z89A 1YN8A 2JS2A 2E5KA 5I22A 2JXBA 1G83A 1N5ZA 2DLPA 1GCQA 2GBQA 2RF0A 2AKKA 2KT8A 1MUZA 1A0NB 3VS5A 1RUWA 4J9HA 2ENMA 2ED0A 2EQIA 4J9FA 3I9QA 2DVJA 1UHCA 2EYYA 4EIKA 1WXBA 2J6FA 1QWFA 2OAWA 1T3LA 2J6KA 3NGPA 3UA6A 1UTIA 1X27A 4M4ZA 2YUNA 4ORZA 2J05A 2O9SA 1NG2A 2HDAA 1X2QA 2AZSA 2KYBA 4DEYA 1AWXA 1W1FA 2LX7A 2SRCA 2JW4A 2FEIA 1Y57A 3I35A 4LN2A 2A08A 2ROLA 2FPEA 1GL5A 2DL5A 2KBTA 1WA7A 3SEMA 1ZX6A 1SRMA 4RTYA 2LP5A 2D8JA 1B07A 1M3BA 3M0QA 2GTJA 2CT4A 1XOVA 2P4RA 1M3CA 1AZEA 3EHQA 2RQTA 1K76A 1T3SA 2FO0A 2DA9A 2DL7A 2LNHB 2D8HA 2A37A 2DRMA 2DYBA 4JJDA 2FPFA 1UGVA 5GJVB 3VRYA 2IIMA 2EYXA 5IHIA 3ZL7C 1M8MA 1SRLA 1NYGA 2JS0A 1NLOC 2LQNA 1GFDA 1W6XA 1NM7A 2ED1A 1FMKA 2RNAA 4AG2C 4J9IA 1HJDA 4OMMA 1PWTA 1UJYA 4LUDA 4F17A 2CUDA 1CKBA 2JMCA 3PVQA 4CC7A 1PRMC 2W0ZA 2JM8A 4LE9A 4F14A 1JXOA 1X2KA 2KXCA 1ZUKA 4LNPA 2KT1A 1U06A 3PVLA 2L0AA 2RQWA 3PE0A 4A63B 2X3WD 2BZYA 3JV3A 1RLQC 1X43A 2EBPA 1JEGA 2CREA 4RTWA 3M0PA 3R6NA 2EYWA 1W70A 1ZUUA 2KRSA 2YUQA 2AK5A 1K0XA 2FRWA 1MV3A 5FWBA 2DRKA 4OMNA 2KYMA 4JZ4A 2EGAA 4IIMA 2HSPA 1OOTA 5IHKA 2M51A 2LCSA 4AFSC 1WX6A 3U23A 1JO8A 1ZLMA 4K11A 1BB9A 2ROTA 1UDLA 1H3HA 2LJ0A 4WCIA 2O2OA 1I1JA 3EHRA 1YWPA 4ESRA 4RTXA 1YCSB 2DX1A 3LH5A 1S1NA 1QCFA 3TSZA 3VS6A 1UJ0A 2LMJA 2YUOA 1H92A 2CSQA 2K79A 4HVWA 2J06A 1I07A 4QT7A 5EC7A 4JJBA 2O31A 1AD5A 1PKSA 2O9VA 2A28A 1AWJA 2GQIA 1BU1A 1VA7A 4JZ3A 4OMPA 5IH2A 1NEBA 1NLPC 3H0IA 5IXFA 1X6GA 3VS0A 2C0OA 2MIOA 2XMFA 5IHNA 2K3BA 3I5SA 1X6BA 1TUCA 4RTUA 1T0HA 1EFNA 4HVUA 2F2VA 3QWXX 1E6GA 2RPNA 2HEQA 3VS1A 1UUEA 1B3QA 4X1VA 1PKTA 1LCKA 2I0NA 2LZ6B 2X3XD 1M30A 1OV3A 2J6OA 2DF6A 4J9DA 1WXUA 1E7OA 1QLYA 2RN8A 4D8DA 4FSSA 2M0YA 1K1ZA 2K6DA 3M0UA 1QKWA 3VS4A 3I5RA 2DMOA 1AOJA 1WYXA 4JJCA 4J9EA 4GLMA 4AG1C 3A98A 4Y92A 2FG0A 4RUGA 2AKLA 1SHFA 1U3OA 3CQTA 4HCKA 1GRIA 2CH4W 1Z9QA 2DBKA 1GBQA 1HSQA 2K2MA 1J3TA 2CUBA 2KROA 1VYTA 1RLPC 2KR3A 1WDXA 2VKNA 4R0KA 3REAB 2FRYA 4IIOA 1PHTA 2EPDA 2K7AA 1MV0B 2EW3A 2RQRA 5ECAA 4J9GA 5FWCA 1AWWA 2KEAA 4AFUC 3NPFA 2VWFA 4CC3A 2L3QA 1FYNA 3VS2A 2LJ1A 4J9BA 1U5SA 2ABLA 4OMLA 1HD3A 2CSIA 4D8KA 1OEBA 2C0IA 3H0HA 3NHNA 2CDTA 1PRLC 3VS7A 1GFCA 4AFQC 1CSKA 2OI3A 1H8KA 5GJWB 3O5ZA 1UHFA 1BK2A 2DM1A 4GBQA 1ZBJA 3NMZC 2BTTA 2JTEA 2DL3A 3EG2A 2DILA 2HBWA 2PTKA 3REBB 3RBBB 1K9AA 2JM9A 4OMOA 1KFZA 2D1XA 1KSWA
chains in the Genus database with same CATH superfamily
3QPHA 5CKBA 2CZ1B 3FEOA 5GAN6 4M78B 1VQOT 4M7AB 3J81E 1NJIU 1WIEA 1I4K1 3VRZA 1YWOA 5IN1A 2DE0X 2DJQA 1BKBA 4KGXB 2DBMA 4M75F 4BI4A 3JCMd 2FPDA 3QG1A 2V1QA 5GAMd 2ZZDA 2DL4A 3HP9A 3MEVA 2VVKA 4CC4B 3UF4A 1OPKA 5CKFA 4C92B 3HFOA 5I11A 1I81A 2QEXA 1YJWQ 2JMAA 2LJ3A 5GAOr 5GMKh 3OYGA 2MI6A 4HA8A 4QVDA 1RAHB 3CMAA 1VQNT 1JU5C 2BZXA 4XQ3A 4TVRA 4LDXA 3L2WA 4MZMA 2D0NA 2L2PA 4WTOB 1JBMA 1TTHB 3V7RA 1R8OB 2AZVA 2X35A 2DJZA 3HFNA 1SHGA 2RD1A 4C92G 4FSXA 4DEXA 2V8IA 3M58A 2H3EB 2BKDN 2KNBB 1OULA 2W10A 4BI8B 3G6EA 4C0FA 2PUOB 2RMOA 3EG1A 2EJGA 2A36A 3MHXA 1M9SA 3V8JA 1YHQQ 1ZQ1A 2E70A 4HXJA 3JSCA 3CXCS 2F1LA 4RTZA 4C8QD 1XJWB 4BUGA 2QQ9A 1MNDA 2LDMA 1TUDA 1N27A 2MCNA 3OS5A 2DERA 1Y7XA 3TVTA 5FU7C 3CMAQ 2L3SA 2CH4A 3OYCA 3SFMA 2CZ7B 3N5BB 3FC3A 3M56A 1WJRA 1WQWA 2EKHA 3G1JA 2DZ9A 2R5AA 4L59A 1YIJA 1KQSA 3FRNA 2QK0A 3RKYA 4ELZC 2AIRB 3HKSA 3JAME 2JS2A 4XU3A 4A54A 2NUTB 1N8RR 3A8HB 5I22A 1N5ZA 3I55Q 2DLPA 2GBQA 5I2SA 1A0NB 1PD1A 3E2UA 2HKQB 3UT1A 1VQLA 2ED0A 3JCMe 4Z02A 2YHTA 3I9QA 2DVJA 2CGHA 4O5VA 1Q86R 3CCVQ 3CEYA 1I8FA 3UA6A 1UTIA 1MMGA 3OS2A 4ORZA 3OYHA 2F5TX 3A5ZB 1RACB 2D6FA 1D3BB 4FW2A 2KYBA 1Q7YR 4DEYA 1W1FA 3CCRA 2LTOA 2EYQA 3EFOB 1JB0E 2A08A 1WHLA 2FPEA 1GL5A 5HY6A 5CAIA 3SEMA 4ZTJA 2CKKA 2D8JA 2LP5A 5GAMj 1TUGB 4EPCA 4KBMB 1M3CA 4M78G 3EHQA 2CZ6B 2CP7A 1KC8C 1T3SA 2LQKA 2P0QA 3OYBA 1KD1U 1VQ7A 2D8HA 4FW1A 3ER0A 3LH0A 3VRYA 3I55T 3ZL7C 1YJ9Q 4DOVA 1VQ4T 3MPUB 1SRLA 3RR6A 1YJ9A 1NYGA 4DOWA 2QEXT 3L2RA 2JS0A 3KXTA 1NLOC 3HPWA 1W6XA 2V8JA 1NM7A 4JDSA 2ED1A 2IPOB 4CI0C 2ZPEB 1YHQT 3OYIA 4OMMA 2OTLA 1UJYA 2E10A 5D6YA 3NTKA 4BE1A 1QMCA 3CCJA 4X34A 3TEEA 1P92A 1K8AR 3VYGA 2RHIA 1JXOA 3SD4A 3A8MB 1I5OB 1X2KA 2B8AA 1EZZB 2VXFA 3OYEA 1QCNA 2L0AA 3OBYA 2X3WD 2BZYA 2YLBA 5GAMg 4KGZB 5GMKi 2MWOA 1X43A 3JCMg 1K8AC 3CBPA 3HHTB 2CREA 1YITA 1U8RA 1BYMA 2O4XA 3G7ZA 2KK4A 3RIRA 2X4XA 3CPFA 1K0XA 3NTHA 3GIBA 3OY9A 4UC4A 3CXCP 2JUFA 1X01A 3L2VA 4E7IA 3PMIA 4E7JA 2BE9B 2A3LA 2M51A 1BI3A 4LDWA 2EQUA 3L42A 1UDLA 4PJOD 4MDXA 3CMET 4PJOF 3PTAA 1I1JA 3MKDA 4M75A 2C06A 5GMKe 3CCET 4A4GA 1IHVA 4C92D 3MJXA 4F7UE 2DIQA 2LMJA 1H92A 3QDFA 2K79A 2E12A 4JJBA 1YCYA 1AWJA 1BU1A 2EFIA 5IXFA 4RMOA 1X6GA 1WQ7A 3FJPA 1Q86C 4ZN1A 2K3BA 3I5SA 4RTUA 5D6WA 1RADB 2PU9B 3QWXX 2HEQA 1YIJT 4F04B 3L2ZA 2QQSA 1B34A 1S72A 3PGGA 1PKTA 2I0NA 2LZ6B 3JCMV 1UGPB 2J6OA 3PFSA 2DF6A 2QDYB 4FSSA 4FL6A 1QKWA 2NUTA 2A0FB 3I5RA 1AOJA 1WYXA 2WSEE 4J9EA 3CCMT 1M1FA 4AG1C 4Y92A 5AYFA 2AKLA 3OYJA 1SHFA 1D1BA 4A4KA 4LD6A 2QG9B 1K73C 1GRIA 1GBQA 3HRUA 2K2MA 1WZOA 2CUBA 2KR3A 4PJJA 2QYZA 2VKNA 4PJOA 3QKJA 4R0KA 3FDRA 2P0PA 2K7AA 1RAGB 4BDZA 2JVVA 4J5YA 5FWCA 4ELYC 4AFUC 3NPFA 5LJ3e 3C95A 3GLXA 2HNIA 1BCMA 4J9BA 5LJ5d 4DBRA 1HD3A 4IUQA 1QQJA 3NHNA 3ZBDA 4M7DB 2WSCE 3MEWA 2RJEA 2ZGWA 5GJWB 3V8LA 3G4SQ 2DM1A 2HQXA 2YLCA 3EG2A 2PTKA 4HT8A 3OYKA 1K9AA 2JM9A 2D1XA 1KSWA 4PJNA 1KIKA 3F70A 2OTJT 1IO6A 5J26A 1VQ4A 1YJ9T 4JPBW 3OBWA 2YT6A 2GFUA 2HCKA 1NPPA 2DZCA 3SB2A 2LX9A 1YJNA 1BBZA 4JRIA 1NBEB 4P5NA 5CQXA 2PZ1A 1VQMQ 1RI9A 3CC4A 4OB3B 1JRIA 5GAOn 2LNVA 3OYLA 4RTTA 2KRMA 3UA7A 2J7IA 2HMAA 1VQPA 4N4IA 1QWEA 1ABQA 2JT4A 4EMKA 3KUFA 1AEYA 1D1AA 2WSFE 2G6FX 2DTOA 2GTOA 1TXQA 1E6HA 2Z0WA 1KJWA 1OYXA 2RK2A 5KCHA 3OS0A 2O88A 2LQWA 3R6OA 1WFWA 3G71Q 1WI7A 2KXDA 2O4XB 4C8QC 3QWYA 3OYYA 1GBRA 1PSEA 2EVRA 4XTUA 5FW9A 2K5LA 1Q86U 3BY7A 3BFMA 1KHCA 3H0FA 3RNJA 2SEMA 3S3NA 4F16A 4ZGEB 4FT4A 1SSHA 1M1KU 2RI2A 2CP6A 2FHDA 3GBQA 4HCBA 4IKFA 1UEBA 5LJ3j 4M78F 3M0RA 5KYYA 1YITQ 1Y07A 8AT1B 3EG0A 1ZBXA 1WLPB 1RI0A 1K0SA 1RL2A 2DFUA 2Y4YA 1ZSGA 1VQLQ 4HT9A 2EKOA 3G71T 4LXCA 3LW5E 5GANj 1UGQB 1N9SA 4XTXA 2Y90A 4RG8A 5CO7A 1KC8U 1PG5B 1M27C 1G5VA 3JB9D 4N0AA 1UG1A 3GNFB 2GNCA 3RMSA 5LJ5e 1UB4A 4V2SA 4M7AG 4Z88A 5EG2A 2R57A 2M02A 1UE9A 2JZ2A 1AZGB 4ZGJB 2F5KA 1YN8A 3VKIA 4HCZA 1C6VX 1EIFA 4M7AA 3SWNB 4IUVA 2WACA 4M7DE 4AT1B 1N8RU 1GCQA 1MUZA 4B9WA 1RUWA 2L3RA 1VQ8T 4PLIA 4J9FA 3X24B 2KAFA 1UHCA 4N4GA 1G3YA 2EYYA 3S3OA 2ZCFB 1QWFA 2VASA 1MGQA 1X27A 4M4ZA 2YUNA 4PJLA 3L2UA 1NG2A 3X20B 2LT4A 4M7DG 2AZSA 1AWXA 4KH0B 3D7SB 2EAYA 4OB0B 2FEIA 4OB2B 2KVQG 1YI2A 1VQ6A 3QO3A 4FYVB 4EMKB 2MYSA 3CCUQ 1JJ2P 5CQYA 1WA7A 2JJ9A 4RTYA 3CC2Q 1B07A 2XICA 2EJ9A 4B6MA 1VQOA 2MAMA 2XDPA 1M3BA 1WNLA 3KBGA 3MP1A 1NE8A 3JCMc 3M55A 1AZEA 1K76A 3JB9J 2FO0A 2GFAA 2DL7A 4OGEA 2LNHB 1ZSZC 2KDSA 4E7LA 2DYBA 5GANf 1QVGP 2EYXA 5IHIA 4M78A 5KE2A 1VOMA 2MF2A 2RJCA 2LQNA 3C4SA 2GCXA 3CCRT 5GAN5 5KE3A 1OI1A 3JCMP 2K4YA 4KT0E 1YI2T 1BI1A 1PWTA 1WJSA 1VQ6T 4F17A 2E1HA 3M9QA 3CC2T 3PVQA 3C12A 5LL6S 1TOVA 3CCLT 1QP3A 6AT1B 3CCQQ 1WHKA 2M16A 1YHQA 1ZUKA 3NTIA 1VQKQ 4BY6B 4A63B 4LDVA 1RLQC 2PVOB 2ZPHB 3M0PA 3R6NA 2AT1B 3NFCA 2E65A 1QVFA 4KH1B 1RABB 4M77D 2AK5A 3EAEA 2QGFB 2DRKA 3H9NA 3OB9A 4OMNA 2KYMA 2EGAA 3FB9A 2CP2A 2NUPA 1OZ2A 4XU1A 3P8BB 3URGA 3MCAB 4OF1A 4AFSC 4JRQA 1WX6A 2HSEB 3U23A 3VV0A 3OW2A 3JCMJ 3LX7A 1BB9A 2GF7A 3UWNA 4II1A 4FT2A 2LJ0A 1VQ5A 4BE0A 4ESRA 4RTXA 3LH5A 1S1NA 1QCFA 2E41A 3EFOA 3S6WA 3A8OB 1DJ7B 3VS6A 2CSQA 2ATCB 3DB4A 2J06A 4MMKA 2RHXA 4QT7A 5EC7A 1PKSA 1VA7A 2NYSA 5IH2A 3H0IA 4M75C 4JS5A 4E47A 4ATOA 1PC0A 2DPPB 2MIOA 5IHNA 3X25B 5CKHA 3G6EQ 2QA4T 2VGNA 5CKEA 5C6SA 4PLLA 2RPNA 2QEXQ 5J39A 2DVEA 3VS1A 4C92F 3UPUA 1W2BP 5GMKj 1XTDA 1OU9A 1YIJQ 4X1VA 5CKDA 1LCKA 5KYUB 4MMLA 1M30A 3BDLA 4C8QG 2H3JA 4OMFB 2RN8A 1VQPQ 2M0YA 2X4YA 1KK7A 2COYA 1PSFA 4M77A 2RK1A 2IG0A 1C1AA 2RHUA 1VQ9T 2LQ8A 4GLMA 2V8KA 5AT1B 3GP8A 4RUGA 1K9MR 4BDYA 4N4HA 2XDBA 3JB9F 4QKUA 1M90C 4XTVA 5DLQE 1EX4A 3M4GA 2O01E 1J3TA 3CD6A 3X28B 3CCLQ 4L5GA 2RJDA 1WDXA 2FB7A 4A4HA 3UDCA 3QUIA 1PHTA 3JCMX 2DXUA 2DYIA 4IUUA 5GAOq 3MP6A 5ECAA 1N9RA 4J9GA 3QSUA 8ATCB 2HKNA 1NZ9A 2L3QA 3VS2A 4F7UF 3V7CA 2LJ1A 2MPXC 2X51A 3DLLA 2COWA 3QXEB 4D8KA 4C0DC 5I21A 3H0HA 1O9SA 1G3WA 1VQMA 3ME9A 4XTYA 1IB8A 4CRIA 3GF5A 4QQGA 5GAN2 4C5EA 4M75B 2JTEA 2OAUA 3HTRA 3RDVA 2DAQA 3RBBB 2LVMA 5LJ3g 3TCJA 1W2BA 2XKOC 2FZCB 1PNJA 2BE7D 4Q5WA 2XI9A 2E6NA 2V1RA 1ZUYA 2E3IA 4CC2A 2MWPA 3CCEA 2DNUA 4OMQA 2MOXA 2HL3A 5CCAA 2JNGA 1YNZA 3QYHB 2DTIA 3SWNA 5FRNA 2KE9A 3M0TA 5L23A 3CCQT 4ZN3A 1TU0B 1AVZC 4J7FA 4E7KA 5CVIA 4BB7A 4QQ6A 4M75D 1SKUB 2JTFA 4J8OA 4LUEA 1G2BA 1KQ2A 3CMEQ 3CCLA 4PL6A 2DD5A 4M78C 1I5LA 1ZA2B 3OMCA 2GGRA 3JCMh 1SG5A 3EFRA 2QGGA 3LYIA 1B34B 1QVPA 3OS1A 1NYFA 2FYKA 1VYUA 1SF9A 3FLGA 3JCMb 3V7SA 1ZHIA 1V29B 2RQUA 4Z8AA 2OTJQ 1V1CA 2L8DA 3VUBA 1Y0MA 2M0OA 3QZ5B 3WVDB 5KYUA 3FJ5A 2YDLA 2L3PA 4E2FB 1VQNA 2ECZA 5A2QE 3CCQA 4RCCA 2RJFA 3PMTA 3CCMA 1M3AA 2K5IA 4JLIA 3VYHB 1BCOA 3CMAT 2CYZB 3EG3A 5I2MA 2L89A 4FU6A 4PJOB 4PFPA 4A53A 4NOYA 1VQOQ 3QIIA 2QTXA 5KYNA 1K4US 4FM4B 5CK9A 2NUZA 1AWOA 2MK5A 3UATA 2BZ8A 1YI2Q 1VQ6Q 3OW2S 1T0JA 2DO3A 3EGUA 1UECA 1ABOA 4HKEA 2OTLQ 3H41A 3CC7Q 2KGTA 2VB6A 1M1GA 3E9FA 1KD1C 1KQ1A 4OGCA 1R0BG 1LOJA 2K9GA 4M78E 5GAOp 1M90R 3RMQA 4A4EA 1JQQA 3TREA 2E64A 3QBYA 3M0SA 1BI0A 1X75C 1SPKA 4M7DD 5KYWB 5GAN4 4N0AC 2YSQA 2CT3A 1MNEA 3CPWP 4XTWA 1O75A 4NL3A 2EQJA 3SHWA 4ZTFA 5HK0A 5GAMh 3DKMA 1KQSS 2E5KA 3I56Q 3P8DA 4PJOE 2JXBA 1G83A 4DBHA 1M2VA 4AMCA 2RF0A 2AKKA 3QYGB 3MO8A 4J9HA 5GAMe 2ENMA 2YRCA 3P8HA 4QW2A 3RERA 2NUPB 2FZGB 4EIKA 2KI7A 1VQ9A 2I2LA 2J6FA 2OAWA 1T3LA 1X6OA 1VQ9Q 2EJFA 3CCSQ 1H3ZA 4E7ZA 3INZA 4J6YA 2PUKB 3DB3A 1Q81C 2JOYA 2J05A 2O9SA 4FIBA 1MHNA 2D9TA 2KMTA 3ZEHA 4D6WA 2LX7A 2SRCA 2JW4A 5KYXB 1VIEA 3I35A 4LN2A 4R55A 2X4JA 3QHSA 2ROLA 1VQ8Q 4M75G 4C92A 2L5QA 4J83A 3HRTA 1OX9A 2DL5A 2HQEA 3CC7A 4Y28E 1SRMA 5LJ3h 3META 3M0QA 2GTJA 1UGSB 2CT4A 1XOVA 4RCBA 1KC8R 1G3SA 2P4RA 1K9MC 2RI5A 5A0DA 4Y91A 1ZSZB 4DBQA 3JCMQ 2DA9A 2DETA 1NJIR 1M1KC 2FPFA 5GJVB 2IIMA 3CCUT 2DIGA 3C94A 2G3RA 2OTLT 1YJWT 2ZPBB 2K2VA 1Q82C 3EGDA 1GFDA 1M4ZA 1MMAA 1TWBA 2ZPGB 5GANe 4AG2C 1XQHA 3CBOA 4C92E 2HL5C 3JCMf 4LUDA 1YITT 1KQSP 2RHZA 3CPWA 5GANg 1WGSA 4CC7A 2YWWA 2W0ZA 3M59A 4LE9A 1IGUA 5LJ5j 4F14A 4GLKA 2HQHA 3CPWS 1QP2A 2E4HA 3CC4Q 3M5AA 5GAOl 4LNPA 1U06A 1XNIA 3OYMA 2RQWA 3PE0A 2EBPA 1JEGA 4QVCA 1M2OA 2K3XA 1Y96B 2EYWA 4C0ZA 1W70A 1WPYA 4LDYA 3PIPA 5KYWA 1D0YA 3CD6Q 4X9DA 3SWNC 3OYAA 1MV3A 2M1HA 2QQAA 2R58A 1VQ5Q 3G71A 3MEAA 4IIMA 3JB9H 2QI2A 3DLMA 5LJ5g 1W4SA 4RKUE 2IVWA 3RESA 5FU6C 2ROTA 1H3HA 3EHRA 5L8RE 1YWPA 2HD0A 4PJOC 5GAMf 5CIUA 3TSZA 3OSSC 4OVAA 2EIFA 2HBPA 3SDZA 1AHJB 4HVWA 3L2QA 2O31A 2HAXA 2A28A 2GQIA 1NEBA 2P84A 3VS0A 3OYDA 3E9GA 2C0OA 2XMFA 3BE3A 3ASKA 1ACMB 5D6XA 1M8VA 1RAEB 2BIVA 3A1PA 1TUCA 2XD0A 1T0HA 4M7AC 1QVFS 1E6GA 1UUEA 5LJ5h 1LVKA 2X9HA 1LNXA 3QZ9B 5GAN7 1B3QA 4DBFA 5FRMA 1FMVA 3CBMA 1VUBA 3QJ6A 3WVEB 3CC7T 1TH7A 1WHJA 1JJ2S 3OYFA 3EGXA 1E7OA 4VUBA 4D8DA 2CS7A 1K1ZA 3M0UA 5IT9E 3EFSA 4C8QF 2FVUA 3VS4A 4EMGA 3EGDB 3A98A 1OZ3A 1RAAB 1U3OA 4C8QA 3CQTA 4HCKA 1QW1A 4R56A 3HSBA 3CCJT 2KROA 1VYTA 1NJIC 4BY6C 4FYXB 2DEQA 1LJOA 2A7YA 1Q82U 3REAB 2FRYA 2VYTA 4IIOA 4XTZA 3EG9B 2PVDB 2EPDA 3I56T 1K8AU 1MV0B 3OMGA 3RUXA 1D3BA 2EW3A 1LPLA 1FX7A 2KEAA 1AWWA 2VWFA 5IAYA 1FYNA 5KH6A 4C0DB 1U5SA 2ABLA 2XHCA 4OMLA 2CP0A 2CSIA 2QASA 2MMPA 1G8XA 2C0IA 2QAZA 2YRDA 2CDTA 3PNWC 4IURA 4F7UG 1BIBA 1GFCA 1CSKA 2OI3A 1H8KA 2LT1A 1UHFA 1BK2A 2RA2A 4GBQA 1ZBJA 3NMZC 1Q81R 2BTTA 2JTMA 2DILA 3CCUA 1TS9A 3REBB 5GAN8 3OQ5A 1Y71A 4OMOA 4WF2A 1OQKA 4EDUA 1KFZA 4M7DC 4M77F 5FLXE 3RKXA 1ARKA 3GOXA 3IQLA 5IXBA 1GCPA 2DXCA 1GCQC 2QDLA 5DLOA 5A0LA 1M2VB 4PFOA 2EWNA 3CCJQ 1JJ2A 4HCCA 4LDUA 4XU0A 4AFZC 1KG1A 1WHHA 2EGEA 4RTVA 2QQRA 4KRTA 4KGVB 2F2XA 1VQMT 3KFVA 3H8ZA 1YP5A 3LGFA 2BUDA 4BD3A 4C92C 1IREB 3HRSA 1X69A 5DM7R 3JCMW 4BE2A 2EQMA 1S72Q 5GANd 3I56A 3LGLA 1NEGA 1D1CA 2FZKB 1UFFA 5HKCA 2RQVA 4JS4A 1K73R 2YUPA 2ESWA 1VQKA 2RM4A 3PIOA 3WXMB 3BDUA 4NS5A 4ZNXA 2QQBA 2F2WA 3S3MA 4XAXB 3T9NA 1BIAA 5HCKA 4DQ2A 4JLGA 1ZSZA 2PNIA 2VV5A 3OW2P 1R77A 2KRNA 1FWZA 1PCXA 2C0TA 4HVVA 4J9CA 4C8QB 1IXDA 5HK3A 4DA4A 1SEMA 2JN0A 1K9MU 2EGCA 2H8HA 1VQLT 4E6RA 2DK3A 4M78D 2B86A 1VYVA 4E7SA 1KD1R 1TG0A 2YRVA 1QKXA 1QVFP 3LWIA 1WXTA 2ZPFB 3THKA 3A8LB 4C5IA 1U1TA 3ULRB 3CCSA 2LCLA 1JXMA 2RB6A 2NWMA 5GMKl 4FCYA 1F1BB 3QDRB 1CKAA 1Z9ZA 5LJ3d 2DL8A 2F69A 4JUVA 1RAIB 3OSVA 1U1SA 3A8GB 1YJWA 1PD0A 1AT1B 2EYZA 2OJ2A 3CD6T 4M7AF 1D09B 3C0CA 2OX7A 3TU4K 1VQ8A 3TSWA 3VS3A 1Y96A 1M5Q1 3J80E 1OPLA 1I0CA 4Z89A 2DXTA 4M77B 1YFNA 4ME7A 3M53A 1VQ4Q 2KT8A 3VS5A 1MMNA 2COZA 2EQIA 4O6JA 3O8VA 1VQ7T 4KUDK 2PVGB 1WXBA 2J6KA 4EMKC 3NGPA 3VUZA 4L6V5 4M7DF 3H6ZA 1R0CB 1IZ6A 3GPLA 1WHGA 3CCST 3AT1B 2HDAA 1OU8A 1X2QA 4F7UB 1PM3A 3RKWA 4BI3A 4RG2A 3JB9I 4J7IA 1Y57A 1H641 1G3TA 3G4SA 1TSFA 3OA6A 5GAOm 2KBTA 9ATCB 4J6XA 1ZX6A 2PQWA 3I55A 4XU2A 4C5GA 2DD4A 4IUTA 3CCRQ 4KULA 4A4FA 2XU8A 3VU3C 2RQTA 3MEUA 3QJYA 5LJ3f 1S72T 2DRMA 2A37A 5D7UA 4JJDA 1UGVA 1ZA1B 2CP3A 4C0GA 5M9OA 2XG8D 2LC4A 1M8MA 1Q95G 1BI2A 4XK8E 1N6AA 4JRPA 3CCEQ 2QTVA 4LD9K 2CZ0B 4KUIA 4MZPA 2DTHA 3X26B 1Q81U 2KSSA 1HK9A 1FMKA 2R5MA 2RNAA 4J9IA 1HJDA 4J6WA 1Q7YU 3TQ7P 5KYYB 2XIDA 3M54A 2K57A 2CUDA 4GY5A 1CKBA 2E5QA 2JMCA 1PRMC 3CCVA 2JM8A 4M77C 5A0GA 1VQKT 2VXEA 2ZAEA 1SSFA 3L1AA 2KXCA 2KT1A 4PJMA 3PVLA 4B9XA 2RHYA 1K73U 3E19A 3JV3A 3M4YA 2KY9A 5KCOA 4RTWA 4M7AD 2NLUA 2V26A 4JJNK 3M57A 1ZUUA 2KRSA 2YUQA 1W2BS 3JB9G 3CMEA 1D0ZA 2FRWA 3Q1JA 4M77E 4QVZA 5FWBA 3LWHA 2LRQA 4JRKA 4JZ4A 3G4ST 2HSPA 3CC4T 3AHUA 4BACA 5GMKm 1OOTA 2GQVA 5IHKA 4M7DA 2XK0A 2K3YA 1FMWA 2E3HA 5FU6B 2LCSA 3OYNA 1JO8A 1ZLMA 4K11A 3EH1A 1Q7YC 2VUBA 3BW1A 3G6ET 4WCIA 2O2OA 4PFZA 1YJNQ 4QQDA 2OTJA 2VGMA 1YCSB 2DX1A 1VQPT 1RAFB 2DEUA 2QA4A 2HZYA 4MZTA 1M1KR 1UJ0A 2YUOA 4YTLA 1I07A 1IHWA 2LCCA 5CR2A 1AD5A 2O9VA 4JZ3A 1QCOA 4OMPA 1NLPC 2KQWA 1QVGA 3CCMQ 2FL7A 1VQ5T 1Q82R 1OX8A 5FU7B 1X6BA 1M90U 2CP5A 2RO0A 1EFNA 4HVUA 5J3BA 2F2VA 3ZFJA 1UGRB 3CCVT 2K5FA 3MP8A 4MDWA 4E7HA 4FYYB 4ANJA 3E1SA 3EG9A 4M7AE 2M9UA 2AHJB 1N8RC 1WJQA 1MMDA 2X3XD 3GNGA 1OV3A 7AT1B 5LJ5f 4J9DA 2ZPIB 1WXUA 1QLYA 2VC8A 5DY9A 1B7TA 2K6DA 3V8KA 2QA4Q 5GAN3 3PT9A 3CXCA 2DMOA 4JJCA 3JRZA 4PKCC 1VQNQ 2FG0A 2DXBA 2RH2A 2EQKA 5GANh 3VJPA 2CH4W 3LLRA 1Z9QA 2DBKA 1VQ7Q 1HSQA 3CC2A 4M77G 2E6ZA 2RI3A 1RLPC 3HL8A 4C8QE 3FIFA 4ZGDB 5KYXA 2DKGA 4OB1B 3EH2A 4PK4A 4M75E 5C0MA 2P4TA 2Y4XA 1QVGS 2X4WA 4F7UA 2RQRA 1D0XA 1YJNT 1FXXA 1GXIE 3J7AF 4NL2A 4CC3A 3EGXB 1VIFA 4PJOG 1YBYA 1OEBA 1HXDA 1PRLC 1V76A 1KHIA 2D0QB 3VS7A 1IRXA 4FYWB 4OP0A 4AFQC 4PNOA 4EMHA 3O5ZA 1NPRA 1WHMA 1C0MA 4C5HA 2DL3A 2P0KA 2XDDA 4IUPA 2HBWA 2YXYA 1HYOA 2QXFA 5FROA 4X9CA 1IGQA
chains in the Genus database with same CATH topology
1PNJA 1KIKA 2V1RA 1ZUYA 4CC2A 1ARKA 2DNUA 3IQLA 4OMQA 1IO6A 2MOXA 1YNZA 4JPBW 2YT6A 5IXBA 1GCPA 2HCKA 1GCQC 2KE9A 2QDLA 1WIEA 3M0TA 3VRZA 5L23A 1YWOA 2DE0X 2DJQA 1BBZA 1AVZC 2DBMA 2FPDA 4AFZC 2EGEA 2PZ1A 2V1QA 1RI9A 4RTVA 4KRTA 4LUEA 1G2BA 2DL4A 2F2XA 2GGRA 4RTTA 2KRMA 3UA7A 2VVKA 4CC4B 2J7IA 3UF4A 1OPKA 3KFVA 1QWEA 1YP5A 1ABQA 2JT4A 5I11A 1AEYA 1NYFA 2G6FX 2JMAA 1X69A 2GTOA 2LJ3A 1E6HA 1VYUA 1KJWA 2O88A 2LQWA 1JU5C 1WFWA 2BZXA 1UFFA 2RQUA 1NEGA 4Z8AA 1WI7A 1V1CA 2RQVA 2KXDA 2YUPA 3QWYA 1GBRA 2ESWA 1Y0MA 2D0NA 2L2PA 2EVRA 3FJ5A 2AZVA 2YDLA 2L3PA 4ZNXA 1SHGA 5FW9A 2F2WA 2ECZA 5HCKA 3H0FA 3RNJA 4DEXA 2SEMA 4F16A 2PNIA 1M3AA 2KRNA 2KNBB 2C0TA 3EG3A 2W10A 4HVVA 4J9CA 1SSHA 2RMOA 3EG1A 1K4US 1SEMA 2A36A 3GBQA 2EGCA 2NUZA 1AWOA 2H8HA 3M0RA 4HXJA 3UATA 2BZ8A 4E6RA 3EG0A 1WLPB 2B86A 1T0JA 1VYVA 1K0SA 3EGUA 4RTZA 1TG0A 1UECA 1ZSGA 1QKXA 1ABOA 3H41A 2KGTA 1WXTA 1TUDA 3THKA 2MCNA 1M27C 2K9GA 3ULRB 1UG1A 3TVTA 1JXMA 2GNCA 1JQQA 2L3SA 2CH4A 2NWMA 3M0SA 1CKAA 2EKHA 4Z88A 1Z9ZA 1SPKA 2DL8A 2YSQA 2CT3A 2EYZA 2OJ2A 3C0CA 3SHWA 1UE9A 3TSWA 1AZGB 3VS3A 1OPLA 1I0CA 4Z89A 1YN8A 2JS2A 2E5KA 5I22A 2JXBA 1G83A 1N5ZA 2DLPA 1GCQA 2GBQA 2RF0A 2AKKA 2KT8A 1MUZA 1A0NB 3VS5A 1RUWA 4J9HA 2ENMA 2ED0A 2EQIA 4J9FA 3I9QA 2DVJA 1UHCA 2EYYA 4EIKA 1WXBA 2J6FA 1QWFA 2OAWA 1T3LA 2J6KA 3NGPA 3UA6A 1UTIA 1X27A 4M4ZA 2YUNA 4ORZA 2J05A 2O9SA 1NG2A 2HDAA 1X2QA 2AZSA 2KYBA 4DEYA 1AWXA 1W1FA 2LX7A 2SRCA 2JW4A 2FEIA 1Y57A 3I35A 4LN2A 2A08A 2ROLA 2FPEA 1GL5A 2DL5A 2KBTA 1WA7A 3SEMA 1ZX6A 1SRMA 4RTYA 2LP5A 2D8JA 1B07A 1M3BA 3M0QA 2GTJA 2CT4A 1XOVA 2P4RA 1M3CA 1AZEA 3EHQA 2RQTA 1K76A 1T3SA 2FO0A 2DA9A 2DL7A 2LNHB 2D8HA 2A37A 2DRMA 2DYBA 4JJDA 2FPFA 1UGVA 5GJVB 3VRYA 2IIMA 2EYXA 5IHIA 3ZL7C 1M8MA 1SRLA 1NYGA 2JS0A 1NLOC 2LQNA 1GFDA 1W6XA 1NM7A 2ED1A 1FMKA 2RNAA 4AG2C 4J9IA 1HJDA 4OMMA 1PWTA 1UJYA 4LUDA 4F17A 2CUDA 1CKBA 2JMCA 3PVQA 4CC7A 1PRMC 2W0ZA 2JM8A 4LE9A 4F14A 1JXOA 1X2KA 2KXCA 1ZUKA 4LNPA 2KT1A 1U06A 3PVLA 2L0AA 2RQWA 3PE0A 4A63B 2X3WD 2BZYA 3JV3A 1RLQC 1X43A 2EBPA 1JEGA 2CREA 4RTWA 3M0PA 3R6NA 2EYWA 1W70A 1ZUUA 2KRSA 2YUQA 2AK5A 1K0XA 2FRWA 1MV3A 5FWBA 2DRKA 4OMNA 2KYMA 4JZ4A 2EGAA 4IIMA 2HSPA 1OOTA 5IHKA 2M51A 2LCSA 4AFSC 1WX6A 3U23A 1JO8A 1ZLMA 4K11A 1BB9A 2ROTA 1UDLA 1H3HA 2LJ0A 4WCIA 2O2OA 1I1JA 3EHRA 1YWPA 4ESRA 4RTXA 1YCSB 2DX1A 3LH5A 1S1NA 1QCFA 3TSZA 3VS6A 1UJ0A 2LMJA 2YUOA 1H92A 2CSQA 2K79A 4HVWA 2J06A 1I07A 4QT7A 5EC7A 4JJBA 2O31A 1AD5A 1PKSA 2O9VA 2A28A 1AWJA 2GQIA 1BU1A 1VA7A 4JZ3A 4OMPA 5IH2A 1NEBA 1NLPC 3H0IA 5IXFA 1X6GA 3VS0A 2C0OA 2MIOA 2XMFA 5IHNA 2K3BA 3I5SA 1X6BA 1TUCA 4RTUA 1T0HA 1EFNA 4HVUA 2F2VA 3QWXX 1E6GA 2RPNA 2HEQA 3VS1A 1UUEA 1B3QA 4X1VA 1PKTA 1LCKA 2I0NA 2LZ6B 2X3XD 1M30A 1OV3A 2J6OA 2DF6A 4J9DA 1WXUA 1E7OA 1QLYA 2RN8A 4D8DA 4FSSA 2M0YA 1K1ZA 2K6DA 3M0UA 1QKWA 3VS4A 3I5RA 2DMOA 1AOJA 1WYXA 4JJCA 4J9EA 4GLMA 4AG1C 3A98A 4Y92A 2FG0A 4RUGA 2AKLA 1SHFA 1U3OA 3CQTA 4HCKA 1GRIA 2CH4W 1Z9QA 2DBKA 1GBQA 1HSQA 2K2MA 1J3TA 2CUBA 2KROA 1VYTA 1RLPC 2KR3A 1WDXA 2VKNA 4R0KA 3REAB 2FRYA 4IIOA 1PHTA 2EPDA 2K7AA 1MV0B 2EW3A 2RQRA 5ECAA 4J9GA 5FWCA 1AWWA 2KEAA 4AFUC 3NPFA 2VWFA 4CC3A 2L3QA 1FYNA 3VS2A 2LJ1A 4J9BA 1U5SA 2ABLA 4OMLA 1HD3A 2CSIA 4D8KA 1OEBA 2C0IA 3H0HA 3NHNA 2CDTA 1PRLC 3VS7A 1GFCA 4AFQC 1CSKA 2OI3A 1H8KA 5GJWB 3O5ZA 1UHFA 1BK2A 2DM1A 4GBQA 1ZBJA 3NMZC 2BTTA 2JTEA 2DL3A 3EG2A 2DILA 2HBWA 2PTKA 3REBB 3RBBB 1K9AA 2JM9A 4OMOA 1KFZA 2D1XA 1KSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PNJ A;  1KIK A;  2V1R A;  1ZUY A;  4CC2 A;  1ARK A;  2DNU A;  3IQL A;  4OMQ A;  1IO6 A;  2MOX A;  1YNZ A;  4JPB W;  2YT6 A;  5IXB A;  1GCP A;  2HCK A;  1GCQ C;  2KE9 A;  2QDL A;  1WIE A;  3M0T A;  3VRZ A;  5L23 A;  1YWO A;  2DE0 X;  2DJQ A;  1BBZ A;  1AVZ C;  2DBM A;  2FPD A;  4AFZ C;  2EGE A;  2PZ1 A;  2V1Q A;  1RI9 A;  4RTV A;  4KRT A;  4LUE A;  1G2B A;  2DL4 A;  2F2X A;  2GGR A;  4RTT A;  2KRM A;  3UA7 A;  2VVK A;  4CC4 B;  2J7I A;  3UF4 A;  1OPK A;  3KFV A;  1QWE A;  1YP5 A;  1ABQ A;  2JT4 A;  5I11 A;  1AEY A;  1NYF A;  2G6F X;  2JMA A;  1X69 A;  2GTO A;  2LJ3 A;  1E6H A;  1VYU A;  1KJW A;  2O88 A;  2LQW A;  1JU5 C;  1WFW A;  2BZX A;  1UFF A;  2RQU A;  1NEG A;  4Z8A A;  1WI7 A;  1V1C A;  2RQV A;  2KXD A;  2YUP A;  3QWY A;  1GBR A;  2ESW A;  1Y0M A;  2D0N A;  2L2P A;  2EVR A;  3FJ5 A;  2AZV A;  2YDL A;  2L3P A;  4ZNX A;  1SHG A;  5FW9 A;  2F2W A;  2ECZ A;  5HCK A;  3H0F A;  3RNJ A;  4DEX A;  2SEM A;  4F16 A;  2PNI A;  1M3A A;  2KRN A;  2KNB B;  2C0T A;  3EG3 A;  2W10 A;  4HVV A;  4J9C A;  1SSH A;  2RMO A;  3EG1 A;  1K4U S;  1SEM A;  2A36 A;  3GBQ A;  2EGC A;  2NUZ A;  1AWO A;  2H8H A;  3M0R A;  4HXJ A;  3UAT A;  2BZ8 A;  4E6R A;  3EG0 A;  1WLP B;  2B86 A;  1T0J A;  1VYV A;  1K0S A;  3EGU A;  4RTZ A;  1TG0 A;  1UEC A;  1ZSG A;  1QKX A;  1ABO A;  3H41 A;  2KGT A;  1WXT A;  1TUD A;  3THK A;  2MCN A;  1M27 C;  2K9G A;  3ULR B;  1UG1 A;  3TVT A;  1JXM A;  2GNC A;  1JQQ A;  2L3S A;  2CH4 A;  2NWM A;  3M0S A;  1CKA A;  2EKH A;  4Z88 A;  1Z9Z A;  1SPK A;  2DL8 A;  2YSQ A;  2CT3 A;  2EYZ A;  2OJ2 A;  3C0C A;  3SHW A;  1UE9 A;  3TSW A;  1AZG B;  3VS3 A;  1OPL A;  1I0C A;  4Z89 A;  1YN8 A;  2JS2 A;  2E5K A;  5I22 A;  2JXB A;  1G83 A;  1N5Z A;  2DLP A;  1GCQ A;  2GBQ A;  2RF0 A;  2AKK A;  2KT8 A;  1MUZ A;  1A0N B;  3VS5 A;  1RUW A;  4J9H A;  2ENM A;  2ED0 A;  2EQI A;  4J9F A;  3I9Q A;  2DVJ A;  1UHC A;  2EYY A;  4EIK A;  1WXB A;  2J6F A;  1QWF A;  2OAW A;  1T3L A;  2J6K A;  3NGP A;  3UA6 A;  1UTI A;  1X27 A;  4M4Z A;  2YUN A;  4ORZ A;  2J05 A;  2O9S A;  1NG2 A;  2HDA A;  1X2Q A;  2AZS A;  2KYB A;  4DEY A;  1AWX A;  1W1F A;  2LX7 A;  2SRC A;  2JW4 A;  2FEI A;  1Y57 A;  3I35 A;  4LN2 A;  2A08 A;  2ROL A;  2FPE A;  1GL5 A;  2DL5 A;  2KBT A;  1WA7 A;  3SEM A;  1ZX6 A;  1SRM A;  4RTY A;  2LP5 A;  2D8J A;  1B07 A;  1M3B A;  3M0Q A;  2GTJ A;  2CT4 A;  1XOV A;  2P4R A;  1M3C A;  1AZE A;  3EHQ A;  2RQT A;  1K76 A;  1T3S A;  2FO0 A;  2DA9 A;  2DL7 A;  2LNH B;  2D8H A;  2A37 A;  2DRM A;  2DYB A;  4JJD A;  2FPF A;  1UGV A;  5GJV B;  3VRY A;  2IIM A;  2EYX A;  5IHI A;  3ZL7 C;  1M8M A;  1SRL A;  1NYG A;  2JS0 A;  1NLO C;  2LQN A;  1GFD A;  1W6X A;  1NM7 A;  2ED1 A;  1FMK A;  2RNA A;  4AG2 C;  4J9I A;  1HJD A;  4OMM A;  1PWT A;  1UJY A;  4LUD A;  4F17 A;  2CUD A;  1CKB A;  2JMC A;  3PVQ A;  4CC7 A;  1PRM C;  2W0Z A;  2JM8 A;  4LE9 A;  4F14 A;  1JXO A;  1X2K A;  2KXC A;  1ZUK A;  4LNP A;  2KT1 A;  1U06 A;  3PVL A;  2L0A A;  2RQW A;  3PE0 A;  4A63 B;  2X3W D;  2BZY A;  3JV3 A;  1RLQ C;  1X43 A;  2EBP A;  1JEG A;  2CRE A;  4RTW A;  3M0P A;  3R6N A;  2EYW A;  1W70 A;  1ZUU A;  2KRS A;  2YUQ A;  2AK5 A;  1K0X A;  2FRW A;  1MV3 A;  5FWB A;  2DRK A;  4OMN A;  2KYM A;  4JZ4 A;  2EGA A;  4IIM A;  2HSP A;  1OOT A;  5IHK A;  2M51 A;  2LCS A;  4AFS C;  1WX6 A;  3U23 A;  1JO8 A;  1ZLM A;  4K11 A;  1BB9 A;  2ROT A;  1UDL A;  1H3H A;  2LJ0 A;  4WCI A;  2O2O A;  1I1J A;  3EHR A;  1YWP A;  4ESR A;  4RTX A;  1YCS B;  2DX1 A;  3LH5 A;  1S1N A;  1QCF A;  3TSZ A;  3VS6 A;  1UJ0 A;  2LMJ A;  2YUO A;  1H92 A;  2CSQ A;  2K79 A;  4HVW A;  2J06 A;  1I07 A;  4QT7 A;  5EC7 A;  4JJB A;  2O31 A;  1AD5 A;  1PKS A;  2O9V A;  2A28 A;  1AWJ A;  2GQI A;  1BU1 A;  1VA7 A;  4JZ3 A;  4OMP A;  5IH2 A;  1NEB A;  1NLP C;  3H0I A;  5IXF A;  1X6G A;  3VS0 A;  2C0O A;  2MIO A;  2XMF A;  5IHN A;  2K3B A;  3I5S A;  1X6B A;  1TUC A;  4RTU A;  1T0H A;  1EFN A;  4HVU A;  2F2V A;  3QWX X;  1E6G A;  2RPN A;  2HEQ A;  3VS1 A;  1UUE A;  1B3Q A;  4X1V A;  1PKT A;  1LCK A;  2I0N A;  2LZ6 B;  2X3X D;  1M30 A;  1OV3 A;  2J6O A;  2DF6 A;  4J9D A;  1WXU A;  1E7O A;  1QLY A;  2RN8 A;  4D8D A;  4FSS A;  2M0Y A;  1K1Z A;  2K6D A;  3M0U A;  1QKW A;  3VS4 A;  3I5R A;  2DMO A;  1AOJ A;  1WYX A;  4JJC A;  4J9E A;  4GLM A;  4AG1 C;  3A98 A;  4Y92 A;  2FG0 A;  4RUG A;  2AKL A;  1SHF A;  1U3O A;  3CQT A;  4HCK A;  1GRI A;  2CH4 W;  1Z9Q A;  2DBK A;  1GBQ A;  1HSQ A;  2K2M A;  1J3T A;  2CUB A;  2KRO A;  1VYT A;  1RLP C;  2KR3 A;  1WDX A;  2VKN A;  4R0K A;  3REA B;  2FRY A;  4IIO A;  1PHT A;  2EPD A;  2K7A A;  1MV0 B;  2EW3 A;  2RQR A;  5ECA A;  4J9G A;  5FWC A;  1AWW A;  2KEA A;  4AFU C;  3NPF A;  2VWF A;  4CC3 A;  2L3Q A;  1FYN A;  3VS2 A;  2LJ1 A;  4J9B A;  1U5S A;  2ABL A;  4OML A;  1HD3 A;  2CSI A;  4D8K A;  1OEB A;  2C0I A;  3H0H A;  3NHN A;  2CDT A;  1PRL C;  3VS7 A;  1GFC A;  4AFQ C;  1CSK A;  2OI3 A;  1H8K A;  5GJW B;  3O5Z A;  1UHF A;  1BK2 A;  2DM1 A;  4GBQ A;  1ZBJ A;  3NMZ C;  2BTT A;  2JTE A;  2DL3 A;  3EG2 A;  2DIL A;  2HBW A;  2PTK A;  3REB B;  3RBB B;  1K9A A;  2JM9 A;  4OMO A;  1KFZ A;  2D1X A;  1KSW A; 
#chains in the Genus database with same CATH topology
 3QPH A;  5CKB A;  2CZ1 B;  3FEO A;  5GAN 6;  4M78 B;  1VQO T;  4M7A B;  3J81 E;  1NJI U;  1WIE A;  1I4K 1;  3VRZ A;  1YWO A;  5IN1 A;  2DE0 X;  2DJQ A;  1BKB A;  4KGX B;  2DBM A;  4M75 F;  4BI4 A;  3JCM d;  2FPD A;  3QG1 A;  2V1Q A;  5GAM d;  2ZZD A;  2DL4 A;  3HP9 A;  3MEV A;  2VVK A;  4CC4 B;  3UF4 A;  1OPK A;  5CKF A;  4C92 B;  3HFO A;  5I11 A;  1I81 A;  2QEX A;  1YJW Q;  2JMA A;  2LJ3 A;  5GAO r;  5GMK h;  3OYG A;  2MI6 A;  4HA8 A;  4QVD A;  1RAH B;  3CMA A;  1VQN T;  1JU5 C;  2BZX A;  4XQ3 A;  4TVR A;  4LDX A;  3L2W A;  4MZM A;  2D0N A;  2L2P A;  4WTO B;  1JBM A;  1TTH B;  3V7R A;  1R8O B;  2AZV A;  2X35 A;  2DJZ A;  3HFN A;  1SHG A;  2RD1 A;  4C92 G;  4FSX A;  4DEX A;  2V8I A;  3M58 A;  2H3E B;  2BKD N;  2KNB B;  1OUL A;  2W10 A;  4BI8 B;  3G6E A;  4C0F A;  2PUO B;  2RMO A;  3EG1 A;  2EJG A;  2A36 A;  3MHX A;  1M9S A;  3V8J A;  1YHQ Q;  1ZQ1 A;  2E70 A;  4HXJ A;  3JSC A;  3CXC S;  2F1L A;  4RTZ A;  4C8Q D;  1XJW B;  4BUG A;  2QQ9 A;  1MND A;  2LDM A;  1TUD A;  1N27 A;  2MCN A;  3OS5 A;  2DER A;  1Y7X A;  3TVT A;  5FU7 C;  3CMA Q;  2L3S A;  2CH4 A;  3OYC A;  3SFM A;  2CZ7 B;  3N5B B;  3FC3 A;  3M56 A;  1WJR A;  1WQW A;  2EKH A;  3G1J A;  2DZ9 A;  2R5A A;  4L59 A;  1YIJ A;  1KQS A;  3FRN A;  2QK0 A;  3RKY A;  4ELZ C;  2AIR B;  3HKS A;  3JAM E;  2JS2 A;  4XU3 A;  4A54 A;  2NUT B;  1N8R R;  3A8H B;  5I22 A;  1N5Z A;  3I55 Q;  2DLP A;  2GBQ A;  5I2S A;  1A0N B;  1PD1 A;  3E2U A;  2HKQ B;  3UT1 A;  1VQL A;  2ED0 A;  3JCM e;  4Z02 A;  2YHT A;  3I9Q A;  2DVJ A;  2CGH A;  4O5V A;  1Q86 R;  3CCV Q;  3CEY A;  1I8F A;  3UA6 A;  1UTI A;  1MMG A;  3OS2 A;  4ORZ A;  3OYH A;  2F5T X;  3A5Z B;  1RAC B;  2D6F A;  1D3B B;  4FW2 A;  2KYB A;  1Q7Y R;  4DEY A;  1W1F A;  3CCR A;  2LTO A;  2EYQ A;  3EFO B;  1JB0 E;  2A08 A;  1WHL A;  2FPE A;  1GL5 A;  5HY6 A;  5CAI A;  3SEM A;  4ZTJ A;  2CKK A;  2D8J A;  2LP5 A;  5GAM j;  1TUG B;  4EPC A;  4KBM B;  1M3C A;  4M78 G;  3EHQ A;  2CZ6 B;  2CP7 A;  1KC8 C;  1T3S A;  2LQK A;  2P0Q A;  3OYB A;  1KD1 U;  1VQ7 A;  2D8H A;  4FW1 A;  3ER0 A;  3LH0 A;  3VRY A;  3I55 T;  3ZL7 C;  1YJ9 Q;  4DOV A;  1VQ4 T;  3MPU B;  1SRL A;  3RR6 A;  1YJ9 A;  1NYG A;  4DOW A;  2QEX T;  3L2R A;  2JS0 A;  3KXT A;  1NLO C;  3HPW A;  1W6X A;  2V8J A;  1NM7 A;  4JDS A;  2ED1 A;  2IPO B;  4CI0 C;  2ZPE B;  1YHQ T;  3OYI A;  4OMM A;  2OTL A;  1UJY A;  2E10 A;  5D6Y A;  3NTK A;  4BE1 A;  1QMC A;  3CCJ A;  4X34 A;  3TEE A;  1P92 A;  1K8A R;  3VYG A;  2RHI A;  1JXO A;  3SD4 A;  3A8M B;  1I5O B;  1X2K A;  2B8A A;  1EZZ B;  2VXF A;  3OYE A;  1QCN A;  2L0A A;  3OBY A;  2X3W D;  2BZY A;  2YLB A;  5GAM g;  4KGZ B;  5GMK i;  2MWO A;  1X43 A;  3JCM g;  1K8A C;  3CBP A;  3HHT B;  2CRE A;  1YIT A;  1U8R A;  1BYM A;  2O4X A;  3G7Z A;  2KK4 A;  3RIR A;  2X4X A;  3CPF A;  1K0X A;  3NTH A;  3GIB A;  3OY9 A;  4UC4 A;  3CXC P;  2JUF A;  1X01 A;  3L2V A;  4E7I A;  3PMI A;  4E7J A;  2BE9 B;  2A3L A;  2M51 A;  1BI3 A;  4LDW A;  2EQU A;  3L42 A;  1UDL A;  4PJO D;  4MDX A;  3CME T;  4PJO F;  3PTA A;  1I1J A;  3MKD A;  4M75 A;  2C06 A;  5GMK e;  3CCE T;  4A4G A;  1IHV A;  4C92 D;  3MJX A;  4F7U E;  2DIQ A;  2LMJ A;  1H92 A;  3QDF A;  2K79 A;  2E12 A;  4JJB A;  1YCY A;  1AWJ A;  1BU1 A;  2EFI A;  5IXF A;  4RMO A;  1X6G A;  1WQ7 A;  3FJP A;  1Q86 C;  4ZN1 A;  2K3B A;  3I5S A;  4RTU A;  5D6W A;  1RAD B;  2PU9 B;  3QWX X;  2HEQ A;  1YIJ T;  4F04 B;  3L2Z A;  2QQS A;  1B34 A;  1S72 A;  3PGG A;  1PKT A;  2I0N A;  2LZ6 B;  3JCM V;  1UGP B;  2J6O A;  3PFS A;  2DF6 A;  2QDY B;  4FSS A;  4FL6 A;  1QKW A;  2NUT A;  2A0F B;  3I5R A;  1AOJ A;  1WYX A;  2WSE E;  4J9E A;  3CCM T;  1M1F A;  4AG1 C;  4Y92 A;  5AYF A;  2AKL A;  3OYJ A;  1SHF A;  1D1B A;  4A4K A;  4LD6 A;  2QG9 B;  1K73 C;  1GRI A;  1GBQ A;  3HRU A;  2K2M A;  1WZO A;  2CUB A;  2KR3 A;  4PJJ A;  2QYZ A;  2VKN A;  4PJO A;  3QKJ A;  4R0K A;  3FDR A;  2P0P A;  2K7A A;  1RAG B;  4BDZ A;  2JVV A;  4J5Y A;  5FWC A;  4ELY C;  4AFU C;  3NPF A;  5LJ3 e;  3C95 A;  3GLX A;  2HNI A;  1BCM A;  4J9B A;  5LJ5 d;  4DBR A;  1HD3 A;  4IUQ A;  1QQJ A;  3NHN A;  3ZBD A;  4M7D B;  2WSC E;  3MEW A;  2RJE A;  2ZGW A;  5GJW B;  3V8L A;  3G4S Q;  2DM1 A;  2HQX A;  2YLC A;  3EG2 A;  2PTK A;  4HT8 A;  3OYK A;  1K9A A;  2JM9 A;  2D1X A;  1KSW A;  4PJN A;  1KIK A;  3F70 A;  2OTJ T;  1IO6 A;  5J26 A;  1VQ4 A;  1YJ9 T;  4JPB W;  3OBW A;  2YT6 A;  2GFU A;  2HCK A;  1NPP A;  2DZC A;  3SB2 A;  2LX9 A;  1YJN A;  1BBZ A;  4JRI A;  1NBE B;  4P5N A;  5CQX A;  2PZ1 A;  1VQM Q;  1RI9 A;  3CC4 A;  4OB3 B;  1JRI A;  5GAO n;  2LNV A;  3OYL A;  4RTT A;  2KRM A;  3UA7 A;  2J7I A;  2HMA A;  1VQP A;  4N4I A;  1QWE A;  1ABQ A;  2JT4 A;  4EMK A;  3KUF A;  1AEY A;  1D1A A;  2WSF E;  2G6F X;  2DTO A;  2GTO A;  1TXQ A;  1E6H A;  2Z0W A;  1KJW A;  1OYX A;  2RK2 A;  5KCH A;  3OS0 A;  2O88 A;  2LQW A;  3R6O A;  1WFW A;  3G71 Q;  1WI7 A;  2KXD A;  2O4X B;  4C8Q C;  3QWY A;  3OYY A;  1GBR A;  1PSE A;  2EVR A;  4XTU A;  5FW9 A;  2K5L A;  1Q86 U;  3BY7 A;  3BFM A;  1KHC A;  3H0F A;  3RNJ A;  2SEM A;  3S3N A;  4F16 A;  4ZGE B;  4FT4 A;  1SSH A;  1M1K U;  2RI2 A;  2CP6 A;  2FHD A;  3GBQ A;  4HCB A;  4IKF A;  1UEB A;  5LJ3 j;  4M78 F;  3M0R A;  5KYY A;  1YIT Q;  1Y07 A;  8AT1 B;  3EG0 A;  1ZBX A;  1WLP B;  1RI0 A;  1K0S A;  1RL2 A;  2DFU A;  2Y4Y A;  1ZSG A;  1VQL Q;  4HT9 A;  2EKO A;  3G71 T;  4LXC A;  3LW5 E;  5GAN j;  1UGQ B;  1N9S A;  4XTX A;  2Y90 A;  4RG8 A;  5CO7 A;  1KC8 U;  1PG5 B;  1M27 C;  1G5V A;  3JB9 D;  4N0A A;  1UG1 A;  3GNF B;  2GNC A;  3RMS A;  5LJ5 e;  1UB4 A;  4V2S A;  4M7A G;  4Z88 A;  5EG2 A;  2R57 A;  2M02 A;  1UE9 A;  2JZ2 A;  1AZG B;  4ZGJ B;  2F5K A;  1YN8 A;  3VKI A;  4HCZ A;  1C6V X;  1EIF A;  4M7A A;  3SWN B;  4IUV A;  2WAC A;  4M7D E;  4AT1 B;  1N8R U;  1GCQ A;  1MUZ A;  4B9W A;  1RUW A;  2L3R A;  1VQ8 T;  4PLI A;  4J9F A;  3X24 B;  2KAF A;  1UHC A;  4N4G A;  1G3Y A;  2EYY A;  3S3O A;  2ZCF B;  1QWF A;  2VAS A;  1MGQ A;  1X27 A;  4M4Z A;  2YUN A;  4PJL A;  3L2U A;  1NG2 A;  3X20 B;  2LT4 A;  4M7D G;  2AZS A;  1AWX A;  4KH0 B;  3D7S B;  2EAY A;  4OB0 B;  2FEI A;  4OB2 B;  2KVQ G;  1YI2 A;  1VQ6 A;  3QO3 A;  4FYV B;  4EMK B;  2MYS A;  3CCU Q;  1JJ2 P;  5CQY A;  1WA7 A;  2JJ9 A;  4RTY A;  3CC2 Q;  1B07 A;  2XIC A;  2EJ9 A;  4B6M A;  1VQO A;  2MAM A;  2XDP A;  1M3B A;  1WNL A;  3KBG A;  3MP1 A;  1NE8 A;  3JCM c;  3M55 A;  1AZE A;  1K76 A;  3JB9 J;  2FO0 A;  2GFA A;  2DL7 A;  4OGE A;  2LNH B;  1ZSZ C;  2KDS A;  4E7L A;  2DYB A;  5GAN f;  1QVG P;  2EYX A;  5IHI A;  4M78 A;  5KE2 A;  1VOM A;  2MF2 A;  2RJC A;  2LQN A;  3C4S A;  2GCX A;  3CCR T;  5GAN 5;  5KE3 A;  1OI1 A;  3JCM P;  2K4Y A;  4KT0 E;  1YI2 T;  1BI1 A;  1PWT A;  1WJS A;  1VQ6 T;  4F17 A;  2E1H A;  3M9Q A;  3CC2 T;  3PVQ A;  3C12 A;  5LL6 S;  1TOV A;  3CCL T;  1QP3 A;  6AT1 B;  3CCQ Q;  1WHK A;  2M16 A;  1YHQ A;  1ZUK A;  3NTI A;  1VQK Q;  4BY6 B;  4A63 B;  4LDV A;  1RLQ C;  2PVO B;  2ZPH B;  3M0P A;  3R6N A;  2AT1 B;  3NFC A;  2E65 A;  1QVF A;  4KH1 B;  1RAB B;  4M77 D;  2AK5 A;  3EAE A;  2QGF B;  2DRK A;  3H9N A;  3OB9 A;  4OMN A;  2KYM A;  2EGA A;  3FB9 A;  2CP2 A;  2NUP A;  1OZ2 A;  4XU1 A;  3P8B B;  3URG A;  3MCA B;  4OF1 A;  4AFS C;  4JRQ A;  1WX6 A;  2HSE B;  3U23 A;  3VV0 A;  3OW2 A;  3JCM J;  3LX7 A;  1BB9 A;  2GF7 A;  3UWN A;  4II1 A;  4FT2 A;  2LJ0 A;  1VQ5 A;  4BE0 A;  4ESR A;  4RTX A;  3LH5 A;  1S1N A;  1QCF A;  2E41 A;  3EFO A;  3S6W A;  3A8O B;  1DJ7 B;  3VS6 A;  2CSQ A;  2ATC B;  3DB4 A;  2J06 A;  4MMK A;  2RHX A;  4QT7 A;  5EC7 A;  1PKS A;  1VA7 A;  2NYS A;  5IH2 A;  3H0I A;  4M75 C;  4JS5 A;  4E47 A;  4ATO A;  1PC0 A;  2DPP B;  2MIO A;  5IHN A;  3X25 B;  5CKH A;  3G6E Q;  2QA4 T;  2VGN A;  5CKE A;  5C6S A;  4PLL A;  2RPN A;  2QEX Q;  5J39 A;  2DVE A;  3VS1 A;  4C92 F;  3UPU A;  1W2B P;  5GMK j;  1XTD A;  1OU9 A;  1YIJ Q;  4X1V A;  5CKD A;  1LCK A;  5KYU B;  4MML A;  1M30 A;  3BDL A;  4C8Q G;  2H3J A;  4OMF B;  2RN8 A;  1VQP Q;  2M0Y A;  2X4Y A;  1KK7 A;  2COY A;  1PSF A;  4M77 A;  2RK1 A;  2IG0 A;  1C1A A;  2RHU A;  1VQ9 T;  2LQ8 A;  4GLM A;  2V8K A;  5AT1 B;  3GP8 A;  4RUG A;  1K9M R;  4BDY A;  4N4H A;  2XDB A;  3JB9 F;  4QKU A;  1M90 C;  4XTV A;  5DLQ E;  1EX4 A;  3M4G A;  2O01 E;  1J3T A;  3CD6 A;  3X28 B;  3CCL Q;  4L5G A;  2RJD A;  1WDX A;  2FB7 A;  4A4H A;  3UDC A;  3QUI A;  1PHT A;  3JCM X;  2DXU A;  2DYI A;  4IUU A;  5GAO q;  3MP6 A;  5ECA A;  1N9R A;  4J9G A;  3QSU A;  8ATC B;  2HKN A;  1NZ9 A;  2L3Q A;  3VS2 A;  4F7U F;  3V7C A;  2LJ1 A;  2MPX C;  2X51 A;  3DLL A;  2COW A;  3QXE B;  4D8K A;  4C0D C;  5I21 A;  3H0H A;  1O9S A;  1G3W A;  1VQM A;  3ME9 A;  4XTY A;  1IB8 A;  4CRI A;  3GF5 A;  4QQG A;  5GAN 2;  4C5E A;  4M75 B;  2JTE A;  2OAU A;  3HTR A;  3RDV A;  2DAQ A;  3RBB B;  2LVM A;  5LJ3 g;  3TCJ A;  1W2B A;  2XKO C;  2FZC B;  1PNJ A;  2BE7 D;  4Q5W A;  2XI9 A;  2E6N A;  2V1R A;  1ZUY A;  2E3I A;  4CC2 A;  2MWP A;  3CCE A;  2DNU A;  4OMQ A;  2MOX A;  2HL3 A;  5CCA A;  2JNG A;  1YNZ A;  3QYH B;  2DTI A;  3SWN A;  5FRN A;  2KE9 A;  3M0T A;  5L23 A;  3CCQ T;  4ZN3 A;  1TU0 B;  1AVZ C;  4J7F A;  4E7K A;  5CVI A;  4BB7 A;  4QQ6 A;  4M75 D;  1SKU B;  2JTF A;  4J8O A;  4LUE A;  1G2B A;  1KQ2 A;  3CME Q;  3CCL A;  4PL6 A;  2DD5 A;  4M78 C;  1I5L A;  1ZA2 B;  3OMC A;  2GGR A;  3JCM h;  1SG5 A;  3EFR A;  2QGG A;  3LYI A;  1B34 B;  1QVP A;  3OS1 A;  1NYF A;  2FYK A;  1VYU A;  1SF9 A;  3FLG A;  3JCM b;  3V7S A;  1ZHI A;  1V29 B;  2RQU A;  4Z8A A;  2OTJ Q;  1V1C A;  2L8D A;  3VUB A;  1Y0M A;  2M0O A;  3QZ5 B;  3WVD B;  5KYU A;  3FJ5 A;  2YDL A;  2L3P A;  4E2F B;  1VQN A;  2ECZ A;  5A2Q E;  3CCQ A;  4RCC A;  2RJF A;  3PMT A;  3CCM A;  1M3A A;  2K5I A;  4JLI A;  3VYH B;  1BCO A;  3CMA T;  2CYZ B;  3EG3 A;  5I2M A;  2L89 A;  4FU6 A;  4PJO B;  4PFP A;  4A53 A;  4NOY A;  1VQO Q;  3QII A;  2QTX A;  5KYN A;  1K4U S;  4FM4 B;  5CK9 A;  2NUZ A;  1AWO A;  2MK5 A;  3UAT A;  2BZ8 A;  1YI2 Q;  1VQ6 Q;  3OW2 S;  1T0J A;  2DO3 A;  3EGU A;  1UEC A;  1ABO A;  4HKE A;  2OTL Q;  3H41 A;  3CC7 Q;  2KGT A;  2VB6 A;  1M1G A;  3E9F A;  1KD1 C;  1KQ1 A;  4OGC A;  1R0B G;  1LOJ A;  2K9G A;  4M78 E;  5GAO p;  1M90 R;  3RMQ A;  4A4E A;  1JQQ A;  3TRE A;  2E64 A;  3QBY A;  3M0S A;  1BI0 A;  1X75 C;  1SPK A;  4M7D D;  5KYW B;  5GAN 4;  4N0A C;  2YSQ A;  2CT3 A;  1MNE A;  3CPW P;  4XTW A;  1O75 A;  4NL3 A;  2EQJ A;  3SHW A;  4ZTF A;  5HK0 A;  5GAM h;  3DKM A;  1KQS S;  2E5K A;  3I56 Q;  3P8D A;  4PJO E;  2JXB A;  1G83 A;  4DBH A;  1M2V A;  4AMC A;  2RF0 A;  2AKK A;  3QYG B;  3MO8 A;  4J9H A;  5GAM e;  2ENM A;  2YRC A;  3P8H A;  4QW2 A;  3RER A;  2NUP B;  2FZG B;  4EIK A;  2KI7 A;  1VQ9 A;  2I2L A;  2J6F A;  2OAW A;  1T3L A;  1X6O A;  1VQ9 Q;  2EJF A;  3CCS Q;  1H3Z A;  4E7Z A;  3INZ A;  4J6Y A;  2PUK B;  3DB3 A;  1Q81 C;  2JOY A;  2J05 A;  2O9S A;  4FIB A;  1MHN A;  2D9T A;  2KMT A;  3ZEH A;  4D6W A;  2LX7 A;  2SRC A;  2JW4 A;  5KYX B;  1VIE A;  3I35 A;  4LN2 A;  4R55 A;  2X4J A;  3QHS A;  2ROL A;  1VQ8 Q;  4M75 G;  4C92 A;  2L5Q A;  4J83 A;  3HRT A;  1OX9 A;  2DL5 A;  2HQE A;  3CC7 A;  4Y28 E;  1SRM A;  5LJ3 h;  3MET A;  3M0Q A;  2GTJ A;  1UGS B;  2CT4 A;  1XOV A;  4RCB A;  1KC8 R;  1G3S A;  2P4R A;  1K9M C;  2RI5 A;  5A0D A;  4Y91 A;  1ZSZ B;  4DBQ A;  3JCM Q;  2DA9 A;  2DET A;  1NJI R;  1M1K C;  2FPF A;  5GJV B;  2IIM A;  3CCU T;  2DIG A;  3C94 A;  2G3R A;  2OTL T;  1YJW T;  2ZPB B;  2K2V A;  1Q82 C;  3EGD A;  1GFD A;  1M4Z A;  1MMA A;  1TWB A;  2ZPG B;  5GAN e;  4AG2 C;  1XQH A;  3CBO A;  4C92 E;  2HL5 C;  3JCM f;  4LUD A;  1YIT T;  1KQS P;  2RHZ A;  3CPW A;  5GAN g;  1WGS A;  4CC7 A;  2YWW A;  2W0Z A;  3M59 A;  4LE9 A;  1IGU A;  5LJ5 j;  4F14 A;  4GLK A;  2HQH A;  3CPW S;  1QP2 A;  2E4H A;  3CC4 Q;  3M5A A;  5GAO l;  4LNP A;  1U06 A;  1XNI A;  3OYM A;  2RQW A;  3PE0 A;  2EBP A;  1JEG A;  4QVC A;  1M2O A;  2K3X A;  1Y96 B;  2EYW A;  4C0Z A;  1W70 A;  1WPY A;  4LDY A;  3PIP A;  5KYW A;  1D0Y A;  3CD6 Q;  4X9D A;  3SWN C;  3OYA A;  1MV3 A;  2M1H A;  2QQA A;  2R58 A;  1VQ5 Q;  3G71 A;  3MEA A;  4IIM A;  3JB9 H;  2QI2 A;  3DLM A;  5LJ5 g;  1W4S A;  4RKU E;  2IVW A;  3RES A;  5FU6 C;  2ROT A;  1H3H A;  3EHR A;  5L8R E;  1YWP A;  2HD0 A;  4PJO C;  5GAM f;  5CIU A;  3TSZ A;  3OSS C;  4OVA A;  2EIF A;  2HBP A;  3SDZ A;  1AHJ B;  4HVW A;  3L2Q A;  2O31 A;  2HAX A;  2A28 A;  2GQI A;  1NEB A;  2P84 A;  3VS0 A;  3OYD A;  3E9G A;  2C0O A;  2XMF A;  3BE3 A;  3ASK A;  1ACM B;  5D6X A;  1M8V A;  1RAE B;  2BIV A;  3A1P A;  1TUC A;  2XD0 A;  1T0H A;  4M7A C;  1QVF S;  1E6G A;  1UUE A;  5LJ5 h;  1LVK A;  2X9H A;  1LNX A;  3QZ9 B;  5GAN 7;  1B3Q A;  4DBF A;  5FRM A;  1FMV A;  3CBM A;  1VUB A;  3QJ6 A;  3WVE B;  3CC7 T;  1TH7 A;  1WHJ A;  1JJ2 S;  3OYF A;  3EGX A;  1E7O A;  4VUB A;  4D8D A;  2CS7 A;  1K1Z A;  3M0U A;  5IT9 E;  3EFS A;  4C8Q F;  2FVU A;  3VS4 A;  4EMG A;  3EGD B;  3A98 A;  1OZ3 A;  1RAA B;  1U3O A;  4C8Q A;  3CQT A;  4HCK A;  1QW1 A;  4R56 A;  3HSB A;  3CCJ T;  2KRO A;  1VYT A;  1NJI C;  4BY6 C;  4FYX B;  2DEQ A;  1LJO A;  2A7Y A;  1Q82 U;  3REA B;  2FRY A;  2VYT A;  4IIO A;  4XTZ A;  3EG9 B;  2PVD B;  2EPD A;  3I56 T;  1K8A U;  1MV0 B;  3OMG A;  3RUX A;  1D3B A;  2EW3 A;  1LPL A;  1FX7 A;  2KEA A;  1AWW A;  2VWF A;  5IAY A;  1FYN A;  5KH6 A;  4C0D B;  1U5S A;  2ABL A;  2XHC A;  4OML A;  2CP0 A;  2CSI A;  2QAS A;  2MMP A;  1G8X A;  2C0I A;  2QAZ A;  2YRD A;  2CDT A;  3PNW C;  4IUR A;  4F7U G;  1BIB A;  1GFC A;  1CSK A;  2OI3 A;  1H8K A;  2LT1 A;  1UHF A;  1BK2 A;  2RA2 A;  4GBQ A;  1ZBJ A;  3NMZ C;  1Q81 R;  2BTT A;  2JTM A;  2DIL A;  3CCU A;  1TS9 A;  3REB B;  5GAN 8;  3OQ5 A;  1Y71 A;  4OMO A;  4WF2 A;  1OQK A;  4EDU A;  1KFZ A;  4M7D C;  4M77 F;  5FLX E;  3RKX A;  1ARK A;  3GOX A;  3IQL A;  5IXB A;  1GCP A;  2DXC A;  1GCQ C;  2QDL A;  5DLO A;  5A0L A;  1M2V B;  4PFO A;  2EWN A;  3CCJ Q;  1JJ2 A;  4HCC A;  4LDU A;  4XU0 A;  4AFZ C;  1KG1 A;  1WHH A;  2EGE A;  4RTV A;  2QQR A;  4KRT A;  4KGV B;  2F2X A;  1VQM T;  3KFV A;  3H8Z A;  1YP5 A;  3LGF A;  2BUD A;  4BD3 A;  4C92 C;  1IRE B;  3HRS A;  1X69 A;  5DM7 R;  3JCM W;  4BE2 A;  2EQM A;  1S72 Q;  5GAN d;  3I56 A;  3LGL A;  1NEG A;  1D1C A;  2FZK B;  1UFF A;  5HKC A;  2RQV A;  4JS4 A;  1K73 R;  2YUP A;  2ESW A;  1VQK A;  2RM4 A;  3PIO A;  3WXM B;  3BDU A;  4NS5 A;  4ZNX A;  2QQB A;  2F2W A;  3S3M A;  4XAX B;  3T9N A;  1BIA A;  5HCK A;  4DQ2 A;  4JLG A;  1ZSZ A;  2PNI A;  2VV5 A;  3OW2 P;  1R77 A;  2KRN A;  1FWZ A;  1PCX A;  2C0T A;  4HVV A;  4J9C A;  4C8Q B;  1IXD A;  5HK3 A;  4DA4 A;  1SEM A;  2JN0 A;  1K9M U;  2EGC A;  2H8H A;  1VQL T;  4E6R A;  2DK3 A;  4M78 D;  2B86 A;  1VYV A;  4E7S A;  1KD1 R;  1TG0 A;  2YRV A;  1QKX A;  1QVF P;  3LWI A;  1WXT A;  2ZPF B;  3THK A;  3A8L B;  4C5I A;  1U1T A;  3ULR B;  3CCS A;  2LCL A;  1JXM A;  2RB6 A;  2NWM A;  5GMK l;  4FCY A;  1F1B B;  3QDR B;  1CKA A;  1Z9Z A;  5LJ3 d;  2DL8 A;  2F69 A;  4JUV A;  1RAI B;  3OSV A;  1U1S A;  3A8G B;  1YJW A;  1PD0 A;  1AT1 B;  2EYZ A;  2OJ2 A;  3CD6 T;  4M7A F;  1D09 B;  3C0C A;  2OX7 A;  3TU4 K;  1VQ8 A;  3TSW A;  3VS3 A;  1Y96 A;  1M5Q 1;  3J80 E;  1OPL A;  1I0C A;  4Z89 A;  2DXT A;  4M77 B;  1YFN A;  4ME7 A;  3M53 A;  1VQ4 Q;  2KT8 A;  3VS5 A;  1MMN A;  2COZ A;  2EQI A;  4O6J A;  3O8V A;  1VQ7 T;  4KUD K;  2PVG B;  1WXB A;  2J6K A;  4EMK C;  3NGP A;  3VUZ A;  4L6V 5;  4M7D F;  3H6Z A;  1R0C B;  1IZ6 A;  3GPL A;  1WHG A;  3CCS T;  3AT1 B;  2HDA A;  1OU8 A;  1X2Q A;  4F7U B;  1PM3 A;  3RKW A;  4BI3 A;  4RG2 A;  3JB9 I;  4J7I A;  1Y57 A;  1H64 1;  1G3T A;  3G4S A;  1TSF A;  3OA6 A;  5GAO m;  2KBT A;  9ATC B;  4J6X A;  1ZX6 A;  2PQW A;  3I55 A;  4XU2 A;  4C5G A;  2DD4 A;  4IUT A;  3CCR Q;  4KUL A;  4A4F A;  2XU8 A;  3VU3 C;  2RQT A;  3MEU A;  3QJY A;  5LJ3 f;  1S72 T;  2DRM A;  2A37 A;  5D7U A;  4JJD A;  1UGV A;  1ZA1 B;  2CP3 A;  4C0G A;  5M9O A;  2XG8 D;  2LC4 A;  1M8M A;  1Q95 G;  1BI2 A;  4XK8 E;  1N6A A;  4JRP A;  3CCE Q;  2QTV A;  4LD9 K;  2CZ0 B;  4KUI A;  4MZP A;  2DTH A;  3X26 B;  1Q81 U;  2KSS A;  1HK9 A;  1FMK A;  2R5M A;  2RNA A;  4J9I A;  1HJD A;  4J6W A;  1Q7Y U;  3TQ7 P;  5KYY B;  2XID A;  3M54 A;  2K57 A;  2CUD A;  4GY5 A;  1CKB A;  2E5Q A;  2JMC A;  1PRM C;  3CCV A;  2JM8 A;  4M77 C;  5A0G A;  1VQK T;  2VXE A;  2ZAE A;  1SSF A;  3L1A A;  2KXC A;  2KT1 A;  4PJM A;  3PVL A;  4B9X A;  2RHY A;  1K73 U;  3E19 A;  3JV3 A;  3M4Y A;  2KY9 A;  5KCO A;  4RTW A;  4M7A D;  2NLU A;  2V26 A;  4JJN K;  3M57 A;  1ZUU A;  2KRS A;  2YUQ A;  1W2B S;  3JB9 G;  3CME A;  1D0Z A;  2FRW A;  3Q1J A;  4M77 E;  4QVZ A;  5FWB A;  3LWH A;  2LRQ A;  4JRK A;  4JZ4 A;  3G4S T;  2HSP A;  3CC4 T;  3AHU A;  4BAC A;  5GMK m;  1OOT A;  2GQV A;  5IHK A;  4M7D A;  2XK0 A;  2K3Y A;  1FMW A;  2E3H A;  5FU6 B;  2LCS A;  3OYN A;  1JO8 A;  1ZLM A;  4K11 A;  3EH1 A;  1Q7Y C;  2VUB A;  3BW1 A;  3G6E T;  4WCI A;  2O2O A;  4PFZ A;  1YJN Q;  4QQD A;  2OTJ A;  2VGM A;  1YCS B;  2DX1 A;  1VQP T;  1RAF B;  2DEU A;  2QA4 A;  2HZY A;  4MZT A;  1M1K R;  1UJ0 A;  2YUO A;  4YTL A;  1I07 A;  1IHW A;  2LCC A;  5CR2 A;  1AD5 A;  2O9V A;  4JZ3 A;  1QCO A;  4OMP A;  1NLP C;  2KQW A;  1QVG A;  3CCM Q;  2FL7 A;  1VQ5 T;  1Q82 R;  1OX8 A;  5FU7 B;  1X6B A;  1M90 U;  2CP5 A;  2RO0 A;  1EFN A;  4HVU A;  5J3B A;  2F2V A;  3ZFJ A;  1UGR B;  3CCV T;  2K5F A;  3MP8 A;  4MDW A;  4E7H A;  4FYY B;  4ANJ A;  3E1S A;  3EG9 A;  4M7A E;  2M9U A;  2AHJ B;  1N8R C;  1WJQ A;  1MMD A;  2X3X D;  3GNG A;  1OV3 A;  7AT1 B;  5LJ5 f;  4J9D A;  2ZPI B;  1WXU A;  1QLY A;  2VC8 A;  5DY9 A;  1B7T A;  2K6D A;  3V8K A;  2QA4 Q;  5GAN 3;  3PT9 A;  3CXC A;  2DMO A;  4JJC A;  3JRZ A;  4PKC C;  1VQN Q;  2FG0 A;  2DXB A;  2RH2 A;  2EQK A;  5GAN h;  3VJP A;  2CH4 W;  3LLR A;  1Z9Q A;  2DBK A;  1VQ7 Q;  1HSQ A;  3CC2 A;  4M77 G;  2E6Z A;  2RI3 A;  1RLP C;  3HL8 A;  4C8Q E;  3FIF A;  4ZGD B;  5KYX A;  2DKG A;  4OB1 B;  3EH2 A;  4PK4 A;  4M75 E;  5C0M A;  2P4T A;  2Y4X A;  1QVG S;  2X4W A;  4F7U A;  2RQR A;  1D0X A;  1YJN T;  1FXX A;  1GXI E;  3J7A F;  4NL2 A;  4CC3 A;  3EGX B;  1VIF A;  4PJO G;  1YBY A;  1OEB A;  1HXD A;  1PRL C;  1V76 A;  1KHI A;  2D0Q B;  3VS7 A;  1IRX A;  4FYW B;  4OP0 A;  4AFQ C;  4PNO A;  4EMH A;  3O5Z A;  1NPR A;  1WHM A;  1C0M A;  4C5H A;  2DL3 A;  2P0K A;  2XDD A;  4IUP A;  2HBW A;  2YXY A;  1HYO A;  2QXF A;  5FRO A;  4X9C A;  1IGQ A; 
#chains in the Genus database with same CATH homology
 1PNJ A;  1KIK A;  2V1R A;  1ZUY A;  4CC2 A;  1ARK A;  2DNU A;  3IQL A;  4OMQ A;  1IO6 A;  2MOX A;  1YNZ A;  4JPB W;  2YT6 A;  5IXB A;  1GCP A;  2HCK A;  1GCQ C;  2KE9 A;  2QDL A;  1WIE A;  3M0T A;  3VRZ A;  5L23 A;  1YWO A;  2DE0 X;  2DJQ A;  1BBZ A;  1AVZ C;  2DBM A;  2FPD A;  4AFZ C;  2EGE A;  2PZ1 A;  2V1Q A;  1RI9 A;  4RTV A;  4KRT A;  4LUE A;  1G2B A;  2DL4 A;  2F2X A;  2GGR A;  4RTT A;  2KRM A;  3UA7 A;  2VVK A;  4CC4 B;  2J7I A;  3UF4 A;  1OPK A;  3KFV A;  1QWE A;  1YP5 A;  1ABQ A;  2JT4 A;  5I11 A;  1AEY A;  1NYF A;  2G6F X;  2JMA A;  1X69 A;  2GTO A;  2LJ3 A;  1E6H A;  1VYU A;  1KJW A;  2O88 A;  2LQW A;  1JU5 C;  1WFW A;  2BZX A;  1UFF A;  2RQU A;  1NEG A;  4Z8A A;  1WI7 A;  1V1C A;  2RQV A;  2KXD A;  2YUP A;  3QWY A;  1GBR A;  2ESW A;  1Y0M A;  2D0N A;  2L2P A;  2EVR A;  3FJ5 A;  2AZV A;  2YDL A;  2L3P A;  4ZNX A;  1SHG A;  5FW9 A;  2F2W A;  2ECZ A;  5HCK A;  3H0F A;  3RNJ A;  4DEX A;  2SEM A;  4F16 A;  2PNI A;  1M3A A;  2KRN A;  2KNB B;  2C0T A;  3EG3 A;  2W10 A;  4HVV A;  4J9C A;  1SSH A;  2RMO A;  3EG1 A;  1K4U S;  1SEM A;  2A36 A;  3GBQ A;  2EGC A;  2NUZ A;  1AWO A;  2H8H A;  3M0R A;  4HXJ A;  3UAT A;  2BZ8 A;  4E6R A;  3EG0 A;  1WLP B;  2B86 A;  1T0J A;  1VYV A;  1K0S A;  3EGU A;  4RTZ A;  1TG0 A;  1UEC A;  1ZSG A;  1QKX A;  1ABO A;  3H41 A;  2KGT A;  1WXT A;  1TUD A;  3THK A;  2MCN A;  1M27 C;  2K9G A;  3ULR B;  1UG1 A;  3TVT A;  1JXM A;  2GNC A;  1JQQ A;  2L3S A;  2CH4 A;  2NWM A;  3M0S A;  1CKA A;  2EKH A;  4Z88 A;  1Z9Z A;  1SPK A;  2DL8 A;  2YSQ A;  2CT3 A;  2EYZ A;  2OJ2 A;  3C0C A;  3SHW A;  1UE9 A;  3TSW A;  1AZG B;  3VS3 A;  1OPL A;  1I0C A;  4Z89 A;  1YN8 A;  2JS2 A;  2E5K A;  5I22 A;  2JXB A;  1G83 A;  1N5Z A;  2DLP A;  1GCQ A;  2GBQ A;  2RF0 A;  2AKK A;  2KT8 A;  1MUZ A;  1A0N B;  3VS5 A;  1RUW A;  4J9H A;  2ENM A;  2ED0 A;  2EQI A;  4J9F A;  3I9Q A;  2DVJ A;  1UHC A;  2EYY A;  4EIK A;  1WXB A;  2J6F A;  1QWF A;  2OAW A;  1T3L A;  2J6K A;  3NGP A;  3UA6 A;  1UTI A;  1X27 A;  4M4Z A;  2YUN A;  4ORZ A;  2J05 A;  2O9S A;  1NG2 A;  2HDA A;  1X2Q A;  2AZS A;  2KYB A;  4DEY A;  1AWX A;  1W1F A;  2LX7 A;  2SRC A;  2JW4 A;  2FEI A;  1Y57 A;  3I35 A;  4LN2 A;  2A08 A;  2ROL A;  2FPE A;  1GL5 A;  2DL5 A;  2KBT A;  1WA7 A;  3SEM A;  1ZX6 A;  1SRM A;  4RTY A;  2LP5 A;  2D8J A;  1B07 A;  1M3B A;  3M0Q A;  2GTJ A;  2CT4 A;  1XOV A;  2P4R A;  1M3C A;  1AZE A;  3EHQ A;  2RQT A;  1K76 A;  1T3S A;  2FO0 A;  2DA9 A;  2DL7 A;  2LNH B;  2D8H A;  2A37 A;  2DRM A;  2DYB A;  4JJD A;  2FPF A;  1UGV A;  5GJV B;  3VRY A;  2IIM A;  2EYX A;  5IHI A;  3ZL7 C;  1M8M A;  1SRL A;  1NYG A;  2JS0 A;  1NLO C;  2LQN A;  1GFD A;  1W6X A;  1NM7 A;  2ED1 A;  1FMK A;  2RNA A;  4AG2 C;  4J9I A;  1HJD A;  4OMM A;  1PWT A;  1UJY A;  4LUD A;  4F17 A;  2CUD A;  1CKB A;  2JMC A;  3PVQ A;  4CC7 A;  1PRM C;  2W0Z A;  2JM8 A;  4LE9 A;  4F14 A;  1JXO A;  1X2K A;  2KXC A;  1ZUK A;  4LNP A;  2KT1 A;  1U06 A;  3PVL A;  2L0A A;  2RQW A;  3PE0 A;  4A63 B;  2X3W D;  2BZY A;  3JV3 A;  1RLQ C;  1X43 A;  2EBP A;  1JEG A;  2CRE A;  4RTW A;  3M0P A;  3R6N A;  2EYW A;  1W70 A;  1ZUU A;  2KRS A;  2YUQ A;  2AK5 A;  1K0X A;  2FRW A;  1MV3 A;  5FWB A;  2DRK A;  4OMN A;  2KYM A;  4JZ4 A;  2EGA A;  4IIM A;  2HSP A;  1OOT A;  5IHK A;  2M51 A;  2LCS A;  4AFS C;  1WX6 A;  3U23 A;  1JO8 A;  1ZLM A;  4K11 A;  1BB9 A;  2ROT A;  1UDL A;  1H3H A;  2LJ0 A;  4WCI A;  2O2O A;  1I1J A;  3EHR A;  1YWP A;  4ESR A;  4RTX A;  1YCS B;  2DX1 A;  3LH5 A;  1S1N A;  1QCF A;  3TSZ A;  3VS6 A;  1UJ0 A;  2LMJ A;  2YUO A;  1H92 A;  2CSQ A;  2K79 A;  4HVW A;  2J06 A;  1I07 A;  4QT7 A;  5EC7 A;  4JJB A;  2O31 A;  1AD5 A;  1PKS A;  2O9V A;  2A28 A;  1AWJ A;  2GQI A;  1BU1 A;  1VA7 A;  4JZ3 A;  4OMP A;  5IH2 A;  1NEB A;  1NLP C;  3H0I A;  5IXF A;  1X6G A;  3VS0 A;  2C0O A;  2MIO A;  2XMF A;  5IHN A;  2K3B A;  3I5S A;  1X6B A;  1TUC A;  4RTU A;  1T0H A;  1EFN A;  4HVU A;  2F2V A;  3QWX X;  1E6G A;  2RPN A;  2HEQ A;  3VS1 A;  1UUE A;  1B3Q A;  4X1V A;  1PKT A;  1LCK A;  2I0N A;  2LZ6 B;  2X3X D;  1M30 A;  1OV3 A;  2J6O A;  2DF6 A;  4J9D A;  1WXU A;  1E7O A;  1QLY A;  2RN8 A;  4D8D A;  4FSS A;  2M0Y A;  1K1Z A;  2K6D A;  3M0U A;  1QKW A;  3VS4 A;  3I5R A;  2DMO A;  1AOJ A;  1WYX A;  4JJC A;  4J9E A;  4GLM A;  4AG1 C;  3A98 A;  4Y92 A;  2FG0 A;  4RUG A;  2AKL A;  1SHF A;  1U3O A;  3CQT A;  4HCK A;  1GRI A;  2CH4 W;  1Z9Q A;  2DBK A;  1GBQ A;  1HSQ A;  2K2M A;  1J3T A;  2CUB A;  2KRO A;  1VYT A;  1RLP C;  2KR3 A;  1WDX A;  2VKN A;  4R0K A;  3REA B;  2FRY A;  4IIO A;  1PHT A;  2EPD A;  2K7A A;  1MV0 B;  2EW3 A;  2RQR A;  5ECA A;  4J9G A;  5FWC A;  1AWW A;  2KEA A;  4AFU C;  3NPF A;  2VWF A;  4CC3 A;  2L3Q A;  1FYN A;  3VS2 A;  2LJ1 A;  4J9B A;  1U5S A;  2ABL A;  4OML A;  1HD3 A;  2CSI A;  4D8K A;  1OEB A;  2C0I A;  3H0H A;  3NHN A;  2CDT A;  1PRL C;  3VS7 A;  1GFC A;  4AFQ C;  1CSK A;  2OI3 A;  1H8K A;  5GJW B;  3O5Z A;  1UHF A;  1BK2 A;  2DM1 A;  4GBQ A;  1ZBJ A;  3NMZ C;  2BTT A;  2JTE A;  2DL3 A;  3EG2 A;  2DIL A;  2HBW A;  2PTK A;  3REB B;  3RBB B;  1K9A A;  2JM9 A;  4OMO A;  1KFZ A;  2D1X A;  1KSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...