2JMAA

R21a spc-sh3:p41 complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
MDETGKELVLALYDYQEKSPAEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title The high-resolution NMR structure of the R21A Spc-SH3:P41 complex: Understanding the determinants of binding affinity by comparison with Abl-SH3
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 12
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jmaA00
1UTIA 1WX6A 1M3AA 4EIKA 2FRWA 1E7OA 1UDLA 1OV3A 2LJ3A 5IH2A 1JU5C 1M3CA 2A08A 2D8HA 2LQNA 2HCKA 4LUDA 1AVZC 3NHNA 1UHFA 1QWFA 2L0AA 1PRMC 1RLPC 1AWOA 2GNCA 3H0FA 4J9GA 4A63B 3H41A 2F2XA 3PVQA 4Z8AA 3VS4A 1KFZA 4D8KA 2DRKA 4Y92A 1K0SA 2FEIA 2G6FX 1M30A 3NGPA 2RQRA 1JEGA 4HXJA 4ORZA 1W1FA 2EGAA 2HDAA 1NEBA 3NPFA 4RTYA 1AWWA 3ULRB 1BU1A 2JMAA 1SEMA 2JXBA 2RPNA 2KRMA 4HVWA 2ESWA 1AWXA 1T0HA 2E5KA 3REAB 4AFUC 1EFNA 3R6NA 1I1JA 2FRYA 1NEGA 1UG1A 2HSPA 2RNAA 2DX1A 2P4RA 1MV3A 5I22A 1H8KA 2FPFA 2F2WA 2VKNA 3A98A 4FSSA 1ZBJA 2MCNA 3QWYA 4HVUA 3RNJA 3EGUA 2JS0A 3EG2A 4ZNXA 2DMOA 4QT7A 1YP5A 3U23A 2I0NA 5L23A 1ZUUA 4HCKA 1AOJA 4RTXA 1A0NB 1AD5A 2KXCA 1GFDA 1SHFA 2O2OA 2YUOA 3EHRA 1HD3A 1GCPA 1X6BA 3UATA 1KSWA 3I9QA 1PKSA 5FWBA 4AG2C 1JQQA 3UA6A 2K9GA 1PHTA 1KJWA 4M4ZA 1ABOA 5GJWB 2DRMA 2B86A 1YWOA 4LN2A 4CC7A 2LJ0A 1ZSGA 2YDLA 1IO6A 2D0NA 2D8JA 2C0IA 1HSQA 2DL7A 3I35A 2W0ZA 4DEXA 4AFSC 2ED0A 2LCSA 2LMJA 2RMOA 4J9FA 2CUBA 2KGTA 3H0IA 2PZ1A 1T0JA 2ECZA 2YUNA 2LNHB 3VS2A 2KXDA 2KNBB 1Y0MA 1MUZA 4GLMA 4J9EA 1HJDA 2EQIA 3M0PA 1ZX6A 1X2QA 1OEBA 2EPDA 1M27C 4RTTA 2K7AA 1RI9A 1NYGA 2AKKA 1W6XA 1PKTA 1QCFA 1K4US 1AWJA 1OOTA 2EVRA 1WIEA 2M51A 3M0TA 1WYXA 1ZUYA 1GBQA 2AZSA 2HBWA 3THKA 2CSIA 2LQWA 2D1XA 1I0CA 1M3BA 1NM7A 2YT6A 1U06A 2C0TA 4JZ3A 1U3OA 2CT3A 2KE9A 2KYBA 1PWTA 2A28A 2W10A 3VS5A 1KIKA 1PNJA 2RF0A 2JS2A 1Y57A 2DBMA 1NYFA 2DVJA 3C0CA 3CQTA 2J6KA 2LP5A 1G83A 1VYVA 2FG0A 2EGCA 2ED1A 4ESRA 2F2VA 3EG1A 1XOVA 1YN8A 2NUZA 2DA9A 2C0OA 2O9SA 5FWCA 4F17A 3RBBB 3VS3A 2YSQA 3M0RA 3FJ5A 1GBRA 1FYNA 2J6OA 3M0SA 1AEYA 4CC3A 2OI3A 1K76A 2KT8A 1CKBA 4OMPA 2YUPA 3VRYA 2SEMA 4Z88A 3TSZA 1WI7A 4CC4B 1WXUA 2KROA 5HCKA 4AFZC 2KYMA 3JV3A 4RTZA 5IXBA 2K79A 1WXTA 3EG0A 2OJ2A 1X27A 2CH4A 1M8MA 1SPKA 2L3SA 1TG0A 1NLPC 3QWXX 2ENMA 2DF6A 4OMOA 1TUDA 1S1NA 1LCKA 5ECAA 1V1CA 4LUEA 2J06A 2O88A 1PRLC 2J7IA 2V1QA 3O5ZA 4J9BA 3VS7A 1AZGB 1JXOA 2DM1A 4DEYA 1VYUA 1OPKA 4RTVA 2GGRA 4J9IA 1J3TA 1H92A 2FPDA 2BZYA 1GFCA 1FMKA 1GCQC 4OMNA 1WFWA 2DL4A 2DE0X 1B3QA 1UECA 4X1VA 4AG1C 3VS0A 2EKHA 2DBKA 4CC2A 2RQUA 4WCIA 2ROLA 2HEQA 1ARKA 2VWFA 2M0YA 3NMZC 4HVVA 2VVKA 4GBQA 2CH4W 2BZ8A 2KBTA 2ROTA 1I07A 5IHKA 4J9HA 1SRLA 1K1ZA 3TVTA 4LE9A 1CKAA 4RUGA 1JXMA 1ABQA 1E6GA 3ZL7C 4K11A 1X69A 1RLQC 1SHGA 1K0XA 2DJQA 4D8DA 1UFFA 2FO0A 3TSWA 3SEMA 1ZUKA 4RTWA 1VYTA 2L3QA 1X43A 4F16A 1YCSB 3LH5A 2QDLA 1MV0B 3VRZA 1W70A 2CUDA 4RTUA 2AKLA 2MIOA 2MOXA 2A36A 3I5RA 3UA7A 5IHIA 5I11A 1Z9ZA 1X2KA 4OMMA 2KRSA 1QWEA 5EC7A 3H0HA 2DYBA 4F14A 1YWPA 4JJCA 1RUWA 2KEAA 2AK5A 2EYWA 2DILA 4J9CA 3PVLA 3VS1A 4E6RA 1VA7A 1NLOC 2J05A 2CDTA 3SHWA 2RQTA 3IQLA 1BK2A 2PNIA 4IIOA 2LX7A 1YNZA 2EYXA 4JJBA 1B07A 1SRMA 2SRCA 3GBQA 1H3HA 2PTKA 4OMQA 1JO8A 2O9VA 2EGEA 1T3SA 1GL5A 2RN8A 1QLYA 1CSKA 1GRIA 2BTTA 2NWMA 1UE9A 2H8HA 2JT4A 2X3WD 5GJVB 2L3PA 1UGVA 2DNUA 4JJDA 1T3LA 2GBQA 2LJ1A 1QKWA 1AZEA 2KRNA 1ZLMA 5FW9A 2V1RA 1WA7A 4AFQC 3REBB 2CREA 2OAWA 1BB9A 2DL3A 4JZ4A 2J6FA 1QKXA 3VS6A 1WLPB 2FPEA 2KT1A 2JMCA 5IXFA 3EG3A 2L2PA 2K6DA 2EYZA 1X6GA 4OMLA 2DL5A 2CT4A 4R0KA 1K9AA 1Z9QA 2JM8A 2DL8A 1UJ0A 2JW4A 2GTOA 3KFVA 1BBZA 3UF4A 5IHNA 1UHCA 2DLPA 2KR3A 2EBPA 2LZ6B 2JM9A 4JPBW 2AZVA 3I5SA 4KRTA 2GTJA 2IIMA 4Z89A 2A37A 2EW3A 2BZXA 4J9DA 2XMFA 1U5SA 1UJYA 2RQWA 2EYYA 4LNPA 1SSHA 1TUCA 2JTEA 1WXBA 1GCQA 2K2MA 3M0UA 2O31A 1G2BA 1E6HA 1OPLA 1N5ZA 3PE0A 2X3XD 1NG2A 3EHQA 1WDXA 2CSQA 3M0QA 2GQIA 4IIMA 1UUEA 2YUQA 2K3BA 2ABLA 2RQVA
chains in the Genus database with same CATH superfamily
2DTHA 5LJ5e 1W2BA 3CXCP 1YJNQ 3OW2S 3EGDB 2RI5A 1M3AA 1KG1A 1D1AA 1E7OA 1OV3A 3CCRA 5IH2A 1JU5C 3CCVA 1AVZC 3CC2T 4IURA 1B34A 2RHUA 3AT1B 1PRMC 1AWOA 1TU0B 2F5TX 4M7DD 3H41A 3PVQA 4M78F 2LC4A 1VUBA 2P0PA 4M78E 3E1SA 5D6YA 2D9TA 3QO3A 3EH2A 3QBYA 4LDWA 1JBMA 2FEIA 1RAAB 4DOWA 1M30A 2RQRA 2EKOA 4BY6B 1U8RA 1JEGA 5LJ5g 2DPPB 4IKFA 1ZQ1A 3SWNA 3LW5E 4MZMA 3NPFA 3HPWA 1AWWA 3VYGA 4BE2A 1BU1A 2JMAA 3J7AF 1BI0A 2E5KA 3REAB 3QIIA 1M1KC 3R6NA 2E6NA 5LJ3g 1UGQB 5LJ5f 2HZYA 1M8VA 4EMKB 4J5YA 1VQKA 4D6WA 1MV3A 4PK4A 2DD5A 2YXYA 3CCRT 3CCVT 2VKNA 4E7SA 5D6XA 3CXCA 3NTHA 1VQOQ 3OYMA 3M57A 5J3BA 3CCSQ 2JOYA 2VASA 4RKUE 4QQGA 3H8ZA 1ZUUA 1AOJA 1BCMA 3CCUQ 3ZFJA 2QQRA 4M77G 1K9MR 3VV0A 1S72A 3OBYA 2ATCB 5KYNA 2K9GA 3TQ7P 4M78A 4OB0B 3OS2A 2COWA 4LN2A 2LJ0A 2E64A 1ZSGA 2LT1A 4JRKA 2IPOB 2KVQG 2C0IA 1VQKT 3I35A 3NFCA 1YITA 1WZOA 1YIJQ 2DFUA 2LMJA 2CUBA 1VQPT 2PZ1A 1T0JA 2ECZA 2ZGWA 2LNHB 1MNEA 4M7DG 2KXDA 1EX4A 1MUZA 1Y0MA 1ZBXA 4GLMA 3M0PA 2MPXC 4ZTFA 1X2QA 2E1HA 1OEBA 1O75A 1IRXA 2XU8A 1QCFA 2QEXA 3VYHB 4HA8A 2RK2A 3JRZA 1OOTA 3CC7A 2EVRA 4C0FA 1WIEA 2M51A 3RR6A 3S3NA 1WYXA 4HT8A 1KHIA 5KYXA 1MHNA 4FIBA 1MMGA 2RO0A 1U3OA 2DVEA 2KE9A 5CKBA 4IUTA 3VS5A 4ATOA 1YITT 3X24B 3QKJA 2FL7A 2M9UA 3CQTA 2FG0A 4ESRA 1WHGA 2F2VA 4JLIA 3VKIA 1XOVA 5HK3A 2NUZA 2O9SA 5DLOA 1O9SA 2YSQA 5GANh 2OTLQ 2FZGB 4N4GA 4QQ6A 4N4HA 3M0SA 4MDWA 1R77A 1TH7A 2E5QA 4M7AF 3CCEQ 4DBRA 5CAIA 2YUPA 3VRYA 4M7AE 2QEXT 3TSZA 4M78G 2DXCA 4NL2A 1YBYA 2KYMA 5GANe 2K79A 4EMKC 4NL3A 1VQ7A 1NZ9A 1MGQA 2OJ2A 1X27A 2CH4A 1PD0A 5LJ5d 1FXXA 3CCJQ 2MK5A 3P8DA 3QWXX 1NLPC 2DF6A 1S1NA 3FRNA 1MMAA 4LUEA 1VOMA 4P5NA 3JB9F 2CS7A 1MNDA 2CP0A 3G6ET 4NOYA 1AZGB 1JXOA 4DEYA 2DO3A 5LJ3d 3E9GA 1FWZA 2EJ9A 2GGRA 3V8KA 1NJIU 2ZCFB 2M16A 2DE0X 4AG1C 5GANg 3OA6A 5GMKm 2EKHA 4RG8A 4CC2A 1RAFB 1SSFA 2LRQA 2NLUA 3HFOA 3M4GA 2ROLA 4BB7A 1VQ4Q 1ARKA 3OB9A 4MMKA 3G4SQ 1BYMA 4ELYC 2VWFA 4J83A 3OY9A 2JUFA 5GANf 1QVGP 2P4TA 2KBTA 1VQ7T 1SRLA 3VUBA 5KCOA 1SG5A 3MEWA 3L2VA 3PMIA 1ABQA 1M2VA 1VQNQ 3ZL7C 1X69A 1SHGA 2DJQA 1JRIA 1UFFA 2FZKB 3N5BB 1WQ7A 2QG9B 4NS5A 1HXDA 1W70A 4J8OA 4XTXA 2MIOA 2A36A 3I5RA 3UA7A 4C5IA 1UGSB 1WJQA 1C1AA 5IHIA 5CIUA 2CKKA 1VIFA 1IGUA 1QP3A 4M75D 4OMMA 1QWEA 2DYBA 1YWPA 4JJCA 3SD4A 5CK9A 5KYUA 1NBEB 1PG5B 2EJGA 1Q81R 4Y91A 3MEUA 2J05A 5C6SA 2CDTA 3SHWA 3INZA 5LJ3j 3TEEA 3JB9I 4BE1A 2PNIA 4C8QB 1TTHB 5FU7B 1Q81U 2XIDA 3X25B 1VQ8T 1SRMA 2SRCA 4J7IA 1NJIC 3LLRA 4X9DA 1QVGA 1JO8A 3DB3A 2O9VA 1OI1A 1D0YA 3G71Q 1VQ6Q 3CCQQ 2FVUA 5KCHA 2X3WD 3FB9A 3M56A 1XNIA 2R5MA 3OSVA 3OSSC 1R8OB 4ZGDB 3JCMW 2XD0A 1AZEA 2KRNA 2GFUA 2R5AA 5FW9A 3RMSA 4FYXB 4WTOB 1WA7A 3MHXA 2CREA 1V29B 1G5VA 4E47A 2Y4YA 4XTUA 4C0ZA 3CCMA 2DL3A 3F70A 4E7ZA 4KULA 3EFSA 2YWWA 3M59A 1QMCA 2RH2A 3EG3A 3QUIA 2K6DA 2CT4A 4CRIA 4EMKA 3KXTA 3FC3A 3CMEQ 1Z9QA 2JZ2A 2DYIA 5IHNA 4C0DB 2DLPA 2HBPA 1H3ZA 4JPBW 4J6WA 4IUQA 4C5EA 2HNIA 2ZPHB 1NPRA 3CC4A 2EW3A 4ZGEB 4J9DA 1U5SA 2V8IA 2MWPA 2A7YA 5I2MA 1UGRB 4PJOF 2QA4A 4E7HA 1YJNA 5GMKl 2K2MA 2O31A 1E6HA 1OPLA 2XICA 5CO7A 3PE0A 3CCMT 1VIEA 2CYZB 4O6JA 3M9QA 2YRVA 4IIMA 2JTFA 1QVGS 2YUQA 4RUGA 1WJSA 1UTIA 5GANd 2YLCA 1WX6A 2BE9B 4EIKA 4KUDK 4A4KA 2VGMA 1YJWQ 3CBPA 4OVAA 2F5KA 4V2SA 3H0FA 4J9GA 1D09B 4Z8AA 1G3SA 4CI0C 4Y92A 3BDUA 2QA4T 2G6FX 3QDFA 3NGPA 3ZBDA 1YJNT 1W1FA 3UDCA 3KBGA 1NEBA 4BE0A 1SEMA 4GY5A 4HVWA 2ESWA 4F7UF 1RI0A 4XTVA 1VQOA 4R55A 5A0DA 4X9CA 3PTAA 5GAN8 3CCSA 3E2UA 4C8QC 2FRYA 3TREA 5FU7C 3QZ5B 2HSPA 1Q86R 1TOVA 2DX1A 5I22A 3CCUA 1H8KA 7AT1B 4A4GA 3CCLQ 2E4HA 1ZBJA 2L3RA 3C95A 3G7ZA 3EG2A 4ZNXA 3QJ6A 5KE2A 3U23A 2I0NA 5DY9A 5L8RE 5DM7R 2A3LA 4RTXA 3SDZA 1Q7YU 1A0NB 2KXCA 1SHFA 3EHRA 4JLGA 1VQLA 1F1BB 2HL3A 3RKYA 2D6FA 1PKSA 2NYSA 2VV5A 3UA6A 1YIJA 1Q82U 1VQOT 3JCMV 5GAOm 3CCST 2ZPEB 2H3EB 3CPWA 4FW2A 2E41A 2D0NA 3I55Q 1I5LA 2DL7A 4E7LA 1C6VX 3CCUT 4C0DC 3M54A 3DB4A 3OYCA 2LCSA 1YHQQ 2RMOA 4J9FA 3BFMA 2KSSA 3R6OA 5GAN4 3CPFA 3VS2A 1IHVA 1C0MA 3V8LA 1EIFA 4EMHA 4C8QE 1HJDA 1M90R 1KD1R 3RESA 2LDMA 1VQLT 1I4K1 1FMVA 2OTJA 2DXBA 1NYGA 4II1A 1M90U 1W6XA 1PKTA 1N27A 5LJ3e 1ZUYA 2E12A 2VC8A 1PCXA 2RI3A 1NM7A 2IVWA 2YT6A 4JZ3A 2YRCA 2A28A 2OTLA 4FW1A 2RF0A 1RAEB 2MWOA 1Q7YC 3I56Q 1WPYA 2OX7A 1Y57A 3C0CA 3CCEA 3OYJA 2LP5A 1D0XA 1N8RR 2EGCA 3E19A 2QQ9A 4EPCA 1OZ2A 5CQXA 5FWCA 3VS3A 1EZZB 5D7UA 1Q82C 2A0FB 3CBOA 1FYNA 1NE8A 4ZN3A 2NUPA 2KI7A 3CCJA 5GAMh 2X4JA 2SEMA 2OTJT 2L5QA 3OMCA 4OB1B 3CPWS 5LJ3f 2ZPFB 4C8QD 1QQJA 2VGNA 1WXUA 4QKUA 1K8AR 4PFZA 4ZN1A 1WXTA 3A8LB 4C8QA 1KQ2A 3BDLA 2HQXA 1SPKA 2OTLT 3RERA 1Y71A 4JJNK 2LT4A 1PRLC 3CCET 4M78D 3O5ZA 4C92B 4J9BA 2DM1A 1VYUA 1K9MU 2YLBA 3JCMP 2K5LA 4VUBA 1M1FA 4J9IA 1WQWA 1H92A 5EG2A 4KBMB 2BUDA 1BIAA 1GCQC 4X1VA 4M7AC 2DBKA 3CCJT 2HL5C 2RQUA 4WCIA 5GAMg 5GAN2 3LYIA 2HEQA 3PIOA 3L2RA 3FDRA 1NPPA 1VQNA 3Q1JA 1IXDA 3NMZC 3FEOA 2VVKA 4GBQA 5GAOl 4WF2A 3VUZA 2ROTA 4PLLA 2DJZA 4J9HA 1K1ZA 4FT2A 2DETA 5KE3A 4LE9A 4ZTJA 3OYGA 3CC2Q 2NUTB 3MEVA 3BW1A 3J81E 1S72T 1AT1B 4D8DA 2FHDA 1ZUKA 3E9FA 1VYTA 1VQ9Q 4L59A 3QHSA 2K4YA 3LH5A 2QDLA 4J6XA 3VRZA 4KH1B 2MI6A 2CUDA 1AHJB 3GNGA 2COZA 2MOXA 4PJOB 2CP3A 5I11A 1X01A 1Z9ZA 1KQSA 1TWBA 2KRSA 4FM4B 2BE7D 1RUWA 2AK5A 2DILA 3G71A 3QZ9B 4E6RA 2EIFA 2FZCB 2PUKB 4C8QG 2P0KA 4DBQA 1K9MC 2LX7A 1D1CA 3OS1A 3MP1A 5I2SA 5GAOn 4JJBA 3L1AA 1B07A 3A5ZB 4KGXB 4BY6C 3NTKA 2VB6A 2MYSA 2PTKA 5FRMA 1WHMA 2DERA 2EGEA 2QAZA 1T3SA 4LD6A 1HYOA 1FMWA 3OYKA 1CSKA 1UB4A 2BTTA 4LDUA 2QTVA 2H8HA 5GJVB 3CC7T 1BI2A 2DNUA 3M58A 4PJJA 1YJ9Q 2GBQA 2PVGB 2QYZA 2LJ1A 2RA2A 2V1RA 2RJEA 3QYGB 3JCMc 3CMEA 4AFQC 5J39A 1WJRA 4PJLA 1I5OB 2L89A 3OS5A 1TSFA 4JZ4A 2J6FA 3G71T 1QKXA 3VS6A 4F7UB 1G3TA 2KT1A 3P8HA 4JUVA 3D7SB 2ZPIB 1X6GA 4XTZA 2FB7A 1K9AA 1X6OA 3WVEB 4M77B 2M0OA 2EJFA 4E7JA 1BBZA 3UF4A 3EG9B 3A8GB 2EBPA 2CZ1B 3V7SA 1IHWA 1VQPQ 4M75F 4BACA 4RG2A 3RKWA 1R0CB 3MO8A 4KRTA 2GTJA 4QVDA 1SKUB 4BI8B 2O01E 1KQSS 1KC8R 2RQWA 2B8AA 2EYYA 1KQ1A 4M7AD 2XG8D 1TUCA 2JTEA 1GCQA 2DAQA 2EYQA 2RHIA 3M0UA 1OZ3A 3CMET 4M7AA 1KHCA 1N5ZA 1RL2A 1YJWA 3G1JA 1NG2A 2XDPA 3EHQA 1WDXA 2CSQA 2QQAA 2GQIA 2X9HA 2JTMA 4HCZA 2C0OA 2RQVA 3GLXA 4M7DB 3L42A 8ATCB 3JB9D 2LJ3A 2F1LA 2EAYA 1M3CA 2A08A 2D8HA 2LQNA 2HCKA 3QXEB 5GAMd 3CMAA 3NHNA 1UHFA 3C12A 2FYKA 1G3YA 3ER0A 1LVKA 2L0AA 2VXFA 3SB2A 3L2ZA 4FT4A 2GNCA 4A63B 2F2XA 1K73R 4FYVB 3VS4A 5GMKh 1KFZA 4PJOC 3EGDA 4HXJA 4ORZA 1JB0E 2HDAA 3L2QA 1YI2Q 3QPHA 1YJWT 4OB3B 3CCLA 3ULRB 4C92F 2JXBA 4XU2A 4JDSA 2RPNA 2KRMA 4IUUA 1PC0A 3QYHB 1AWXA 4C92E 4AFUC 1EFNA 5CQYA 3P8BB 4Y28E 5HK0A 5GMKe 1NEGA 5GMKi 3CBMA 1XTDA 2KK4A 5FU6B 2P4RA 2V8KA 2EQUA 4XK8E 2DD4A 2FPFA 3CMAT 4FSSA 3G6EQ 4B9XA 1BI1A 4LXCA 2AT1B 3QWYA 3M53A 3DKMA 1B7TA 2CZ7B 1BIBA 3BE3A 5GAN6 1YP5A 4PFPA 4EDUA 2BIVA 5GAN5 3HTRA 1GFDA 2O2OA 2YUOA 3I55A 3QJYA 1GCPA 4M7AG 3UATA 3I9QA 1OU9A 4B9WA 5FWBA 5GAMj 1JQQA 3JCMb 3V7RA 1KJWA 1ABOA 2QASA 1YHQA 5CR2A 3A8HB 4CC7A 1WHJA 2YDLA 2EQKA 3OMGA 2V8JA 1QCOA 2W0ZA 4DEXA 1Q81C 4PJOE 5IT9E 3V7CA 1N9SA 3JB9G 2ED0A 3HKSA 2LQ8A 1ZSZB 2DTIA 2YUNA 3M4YA 1VQ5Q 3X26B 3LGFA 1PSFA 4J9EA 1VQMQ 2EQIA 2PUOB 2RHZA 1BKBA 1D3BB 3I55T 3OYAA 1OU8A 4N0AC 4RTTA 2AKKA 4FSXA 1AWJA 4PJNA 1GBQA 2AZSA 2HBWA 2CSIA 5LL6S 3CC4T 3PNWC 1I8FA 1VQ8Q 1IGQA 1U06A 2C0TA 3S6WA 1XQHA 2ZPBB 1PWTA 2WSEE 3H6ZA 4ANJA 4ZGJB 1QVPA 2NUTA 1NYFA 2J6KA 4DA4A 1G83A 1VYVA 2ED1A 3CPWP 2L8DA 2ZAEA 3UPUA 2QGGA 3GP8A 4PJOD 1MMNA 3RBBB 3V8JA 4A53A 4HT9A 2I2LA 2K57A 4F7UE 3M0RA 1GBRA 3JCMh 4PJOA 2J6OA 4M77F 3CEYA 5CKFA 1AEYA 3A8OB 4L6V5 4EMGA 4M77E 4MZPA 1QVFS 2KT8A 1CKBA 1Y96B 4FYYB 4UC4A 1Q86U 4BI4A 4RCBA 2DIQA 3X20B 4CC4B 2X35A 3FLGA 3SFMA 4E7IA 4N4IA 2LCLA 4OF1A 3EG0A 5FU6C 3JCMe 2XKOC 3URGA 1TG0A 4A4FA 1DJ7B 5ECAA 1LCKA 2J06A 5A0LA 1D1BA 3X28B 2V1QA 1RAHB 1SF9A 4KH0B 2E70A 2WSFE 1BCOA 2DK3A 2PVDB 1J3TA 4M7DF 5HKCA 1GFCA 1ZA1B 1WFWA 2DL4A 2JNGA 1B3QA 5J26A 3WVDB 1M1KR 3OQ5A 4M7DE 3JCMg 2KMTA 3RDVA 1M2VB 3VU3C 4XU0A 2CZ6B 2M0YA 4HVVA 4F7UA 3O8VA 2BZ8A 1VQ9A 1IB8A 1I07A 1N9RA 5IHKA 1QP2A 4M77A 1CKAA 2DTOA 3EFOB 3HRSA 1N6AA 5KYWB 1YFNA 1ZSZC 4M75B 1KD1U 1YIJT 1Q86C 3TSWA 2O4XB 1W4SA 2L3QA 2HQEA 4LD9K 1X43A 4F16A 1U1TA 2X4WA 4QVZA 1MV0B 4JRPA 4PJOG 3M5AA 4RTUA 2AKLA 4O5VA 3OYFA 1X2KA 3CD6Q 3H0HA 4F14A 4N0AA 3HRUA 2RK1A 4DQ2A 1G3WA 2KEAA 1PM3A 4J9CA 3VS1A 4PL6A 1VA7A 1NLOC 5CKDA 2LTOA 2RQTA 4IIOA 1VQ9T 2DIGA 1N8RU 4M7DA 5IN1A 2COYA 1YJ9A 2EYXA 3KUFA 3QG1A 5KYYB 3GBQA 1OYXA 4OMQA 5M9OA 5FROA 5AYFA 2RN8A 1UE9A 4ELZC 2M1HA 4JS4A 2JT4A 5I21A 2L3PA 3MJXA 3FJPA 2DEQA 2HD0A 2RD1A 3HP9A 2CP7A 4JRIA 2VUBA 4TVRA 2HSEB 4JJDA 3DLLA 5GMKj 1ZLMA 2LNVA 4IUPA 2K3YA 1K8AU 5GAMe 2HQHA 3ME9A 4A4EA 4DOVA 1BB9A 4BDZA 5GAOr 4HCBA 2EQMA 2C06A 2CP2A 1VQPA 4BDYA 4F7UG 1VQ4A 3G4SA 1M1GA 1M90C 1KD1C 3QSUA 1KQSP 1Y7XA 4QVCA 2DL5A 2RHXA 1YJ9T 4Z02A 1KK7A 2KY9A 4LDYA 1PD1A 2PU9B 1W2BS 4OGCA 2JM9A 2HAXA 2AZVA 2KQWA 3I5SA 1UEBA 1R0BG 4AT1B 1IZ6A 1G8XA 4YTLA 4FL6A 2A37A 1D0ZA 2BZXA 3FIFA 3LH0A 2OAUA 2XMFA 1UJYA 2LCCA 3LWHA 4LNPA 1SSHA 1VQLQ 1WXBA 4X34A 5GAMf 1N8RC 2Y90A 1G2BA 8AT1B 5KH6A 1P92A 3OYBA 3HFNA 1LJOA 1VQ4T 1UUEA 1Y07A 2GF7A 4Q5WA 3G4ST 2ABLA 2HMAA 3JCMd 2FRWA 3S3MA 1UDLA 1OX8A 4LUDA 3OYLA 3ZEHA 3AHUA 2E6ZA 3TCJA 2RJFA 4M75C 1QWFA 1K8AC 3NTIA 4JS5A 1RLPC 1YI2A 2DEUA 1ZSZA 2HKQB 1VQNT 2AIRB 2GFAA 4B6MA 1VQ6A 3OYNA 3CCQA 1UGPB 4RMOA 3CXCS 1WHHA 3MCAB 4D8KA 2DRKA 1K0SA 3CCRQ 3CCVQ 4KGVB 3HL8A 2DXTA 4FYWB 2EGAA 1D3BA 2OTJQ 2XI9A 4RTYA 1RABB 4A4HA 2RJDA 3G6EA 2EFIA 3LX7A 2JVVA 1T0HA 1I1JA 1UG1A 2DZ9A 2RNAA 3HSBA 3RMQA 1X75C 3JB9H 1LPLA 3EGXB 4HCCA 2F2WA 3A98A 4F04B 4BI3A 2MCNA 4HVUA 3RNJA 3EGUA 1YI2T 1PSEA 2JS0A 3PIPA 1VQ6T 2DMOA 4QT7A 3CCQT 4RCCA 5FRNA 1VQKQ 5L23A 4HCKA 2XHCA 3MEAA 1AD5A 1HD3A 2P84A 1X6BA 1M9SA 2V26A 1KSWA 1TUGB 1Y96A 4AG2C 2E10A 2X51A 3MP8A 3C94A 4C92C 1NJIR 5GAN3 1PHTA 4M4ZA 4M75E 2VXEA 2Z0WA 5GJWB 2DRMA 2B86A 1TS9A 2JJ9A 2DXUA 1YWOA 5C0MA 2P0QA 1IO6A 2D8JA 1HSQA 1VQ5A 3MP6A 3PFSA 4A54A 1VQMA 4AFSC 1KC8U 1S72Q 4BD3A 2K5FA 1B34B 3JCMJ 2K3XA 2KGTA 3H0IA 5D6WA 1HK9A 1LNXA 2RHYA 4XU1A 4DBFA 5GAOp 3ASKA 4IUVA 2RI2A 1VQ8A 1JJ2P 2KNBB 1YITQ 4XTYA 2K5IA 2BKDN 1ZX6A 1RADB 3PGGA 3SWNB 3EH1A 2EPDA 1M27C 5CKEA 2CZ0B 2K7AA 1RI9A 4LDVA 1K4US 3M0TA 2Y4XA 3L2UA 3THKA 2LQWA 2D1XA 3A1PA 1I0CA 1M3BA 4MMLA 4JRQA 2G3RA 2CT3A 2NUPB 2KYBA 1WNLA 2JN0A 5LJ5j 2W10A 3S3OA 4C5HA 1PNJA 3OS0A 1VQ5T 1K73U 1KIKA 2ZPGB 2JS2A 1VQMT 3EFOA 1GXIE 1LOJA 2QEXQ 2DBMA 2DVJA 1WGSA 1QVFP 4OB2B 5KYWA 3CC7Q 5CKHA 3OYDA 4M75A 3GPLA 3C4SA 3EG1A 2XK0A 2O4XA 2GCXA 1YN8A 4F17A 2DA9A 1V76A 4C0GA 3PT9A 3UT1A 2QI2A 5HY6A 3FJ5A 3JCMQ 4AMCA 2H3JA 4L5GA 3T9NA 4CC3A 2OI3A 4DBHA 9ATCB 1K76A 4OMPA 4Z88A 1JJ2A 4PNOA 1ZHIA 1KC8C 1WI7A 3MPUB 4M78B 2KROA 2PVOB 5DLQE 2KDSA 5HCKA 2WSCE 3VJPA 4AFZC 4RTZA 1RAIB 3JV3A 5IXBA 3JCMX 2CGHA 2QXFA 3RUXA 1M8MA 3LWIA 5KYYA 2L3SA 2ENMA 4OMOA 1TUDA 4OP0A 3EAEA 2E3HA 2F69A 1V1CA 2X4YA 2O88A 2M02A 2J7IA 3OYEA 2XDDA 5A2QE 3CCLT 2X4XA 2D0QB 4QW2A 3VS7A 4OGEA 4FCYA 4J7FA 1VQ7Q 1OPKA 1M5Q1 1RACB 2VYTA 4RTVA 4MDXA 1QVFA 4LDXA 2FPDA 3OYYA 4KGZB 2BZYA 1FMKA 4KUIA 4OMNA 1UECA 4M77C 1M4ZA 2ZZDA 3VS0A 4MZTA 4C92D 1QW1A 2E65A 3RIRA 1M2OA 6AT1B 1YCYA 3J80E 3RKXA 1K73C 1Q95G 3TU4K 4R56A 4C92A 3LGLA 3H9NA 3QDRB 1RAGB 2CH4W 5KYXB 3JB9J 4ME7A 4XQ3A 3OW2P 3EFRA 3TVTA 2CP6A 1WHKA 3OYIA 5CCAA 2PQWA 1JXMA 4XAXB 2WACA 1E6GA 4PLIA 4M75G 4K11A 2LX9A 3CD6A 5A0GA 1RLQC 1H641 3I56A 1K0XA 2CP5A 1WHLA 2FO0A 1I81A 2QK0A 3SEMA 4RTWA 1YHQT 2QTXA 1YCSB 4M7DC 2EWNA 1JJ2S 4BUGA 4QQDA 3META 2HKNA 3SWNC 1XJWB 4XTWA 5EC7A 2MMPA 4PJMA 2MAMA 2QQBA 2EYWA 3PVLA 4J6YA 4FU6A 3IQLA 1BK2A 3PMTA 1YNZA 4HKEA 3CMAQ 1MMDA 4E2FB 4PKCC 1H3HA 1TXQA 2DKGA 1GL5A 3OW2A 4XU3A 3CD6T 1QLYA 1GRIA 3I56T 2NWMA 2QQSA 4E7KA 3BY7A 3M55A 1U1SA 3GOXA 1UGVA 1BI3A 1ACMB 2YHTA 2E3IA 2LVMA 2QDYB 2LQKA 1T3LA 2AHJB 1QKWA 2RB6A 3REBB 5GAOq 2OAWA 2RM4A 3GNFB 1OQKA 4C92G 2DZCA 1W2BP 1Q7YR 4C5GA 4M78C 1WLPB 2MF2A 2FPEA 2JMCA 2RJCA 1OULA 2YRDA 5IAYA 5IXFA 2R57A 2L2PA 2KAFA 3GIBA 2EYZA 5AT1B 4OMLA 4R0KA 1IREB 3JSCA 5GANj 2EQJA 3MKDA 4GLKA 2JM8A 2DL8A 1UJ0A 2JW4A 2GTOA 3KFVA 3EGXA 4M7AB 1Q82R 1QCNA 1UHCA 2KR3A 4KT0E 2R58A 3DLMA 3CCMQ 4OMFB 3CC2A 3HRTA 2LZ6B 5FLXE 1M1KU 3UWNA 3OYHA 2GQVA 1OX9A 2IIMA 4Z89A 3GF5A 4M77D 2QGFB 1FX7A 3JCMf 3L2WA 5CVIA 3A8MB 5LJ5h 3HHTB 3WXMB 3OBWA 3EG9A 2K2VA 5GAN7 5KYUB 2IG0A 1ZA2B 2X3XD 3JAME 3CC4Q 5LJ3h 3M0QA 2XDBA 4PFOA 4C8QF 2K3BA 2QA4Q
chains in the Genus database with same CATH topology
1UTIA 1WX6A 1M3AA 4EIKA 2FRWA 1E7OA 1UDLA 1OV3A 2LJ3A 5IH2A 1JU5C 1M3CA 2A08A 2D8HA 2LQNA 2HCKA 4LUDA 1AVZC 3NHNA 1UHFA 1QWFA 2L0AA 1PRMC 1RLPC 1AWOA 2GNCA 3H0FA 4J9GA 4A63B 3H41A 2F2XA 3PVQA 4Z8AA 3VS4A 1KFZA 4D8KA 2DRKA 4Y92A 1K0SA 2FEIA 2G6FX 1M30A 3NGPA 2RQRA 1JEGA 4HXJA 4ORZA 1W1FA 2EGAA 2HDAA 1NEBA 3NPFA 4RTYA 1AWWA 3ULRB 1BU1A 2JMAA 1SEMA 2JXBA 2RPNA 2KRMA 4HVWA 2ESWA 1AWXA 1T0HA 2E5KA 3REAB 4AFUC 1EFNA 3R6NA 1I1JA 2FRYA 1NEGA 1UG1A 2HSPA 2RNAA 2DX1A 2P4RA 1MV3A 5I22A 1H8KA 2FPFA 2F2WA 2VKNA 3A98A 4FSSA 1ZBJA 2MCNA 3QWYA 4HVUA 3RNJA 3EGUA 2JS0A 3EG2A 4ZNXA 2DMOA 4QT7A 1YP5A 3U23A 2I0NA 5L23A 1ZUUA 4HCKA 1AOJA 4RTXA 1A0NB 1AD5A 2KXCA 1GFDA 1SHFA 2O2OA 2YUOA 3EHRA 1HD3A 1GCPA 1X6BA 3UATA 1KSWA 3I9QA 1PKSA 5FWBA 4AG2C 1JQQA 3UA6A 2K9GA 1PHTA 1KJWA 4M4ZA 1ABOA 5GJWB 2DRMA 2B86A 1YWOA 4LN2A 4CC7A 2LJ0A 1ZSGA 2YDLA 1IO6A 2D0NA 2D8JA 2C0IA 1HSQA 2DL7A 3I35A 2W0ZA 4DEXA 4AFSC 2ED0A 2LCSA 2LMJA 2RMOA 4J9FA 2CUBA 2KGTA 3H0IA 2PZ1A 1T0JA 2ECZA 2YUNA 2LNHB 3VS2A 2KXDA 2KNBB 1Y0MA 1MUZA 4GLMA 4J9EA 1HJDA 2EQIA 3M0PA 1ZX6A 1X2QA 1OEBA 2EPDA 1M27C 4RTTA 2K7AA 1RI9A 1NYGA 2AKKA 1W6XA 1PKTA 1QCFA 1K4US 1AWJA 1OOTA 2EVRA 1WIEA 2M51A 3M0TA 1WYXA 1ZUYA 1GBQA 2AZSA 2HBWA 3THKA 2CSIA 2LQWA 2D1XA 1I0CA 1M3BA 1NM7A 2YT6A 1U06A 2C0TA 4JZ3A 1U3OA 2CT3A 2KE9A 2KYBA 1PWTA 2A28A 2W10A 3VS5A 1KIKA 1PNJA 2RF0A 2JS2A 1Y57A 2DBMA 1NYFA 2DVJA 3C0CA 3CQTA 2J6KA 2LP5A 1G83A 1VYVA 2FG0A 2EGCA 2ED1A 4ESRA 2F2VA 3EG1A 1XOVA 1YN8A 2NUZA 2DA9A 2C0OA 2O9SA 5FWCA 4F17A 3RBBB 3VS3A 2YSQA 3M0RA 3FJ5A 1GBRA 1FYNA 2J6OA 3M0SA 1AEYA 4CC3A 2OI3A 1K76A 2KT8A 1CKBA 4OMPA 2YUPA 3VRYA 2SEMA 4Z88A 3TSZA 1WI7A 4CC4B 1WXUA 2KROA 5HCKA 4AFZC 2KYMA 3JV3A 4RTZA 5IXBA 2K79A 1WXTA 3EG0A 2OJ2A 1X27A 2CH4A 1M8MA 1SPKA 2L3SA 1TG0A 1NLPC 3QWXX 2ENMA 2DF6A 4OMOA 1TUDA 1S1NA 1LCKA 5ECAA 1V1CA 4LUEA 2J06A 2O88A 1PRLC 2J7IA 2V1QA 3O5ZA 4J9BA 3VS7A 1AZGB 1JXOA 2DM1A 4DEYA 1VYUA 1OPKA 4RTVA 2GGRA 4J9IA 1J3TA 1H92A 2FPDA 2BZYA 1GFCA 1FMKA 1GCQC 4OMNA 1WFWA 2DL4A 2DE0X 1B3QA 1UECA 4X1VA 4AG1C 3VS0A 2EKHA 2DBKA 4CC2A 2RQUA 4WCIA 2ROLA 2HEQA 1ARKA 2VWFA 2M0YA 3NMZC 4HVVA 2VVKA 4GBQA 2CH4W 2BZ8A 2KBTA 2ROTA 1I07A 5IHKA 4J9HA 1SRLA 1K1ZA 3TVTA 4LE9A 1CKAA 4RUGA 1JXMA 1ABQA 1E6GA 3ZL7C 4K11A 1X69A 1RLQC 1SHGA 1K0XA 2DJQA 4D8DA 1UFFA 2FO0A 3TSWA 3SEMA 1ZUKA 4RTWA 1VYTA 2L3QA 1X43A 4F16A 1YCSB 3LH5A 2QDLA 1MV0B 3VRZA 1W70A 2CUDA 4RTUA 2AKLA 2MIOA 2MOXA 2A36A 3I5RA 3UA7A 5IHIA 5I11A 1Z9ZA 1X2KA 4OMMA 2KRSA 1QWEA 5EC7A 3H0HA 2DYBA 4F14A 1YWPA 4JJCA 1RUWA 2KEAA 2AK5A 2EYWA 2DILA 4J9CA 3PVLA 3VS1A 4E6RA 1VA7A 1NLOC 2J05A 2CDTA 3SHWA 2RQTA 3IQLA 1BK2A 2PNIA 4IIOA 2LX7A 1YNZA 2EYXA 4JJBA 1B07A 1SRMA 2SRCA 3GBQA 1H3HA 2PTKA 4OMQA 1JO8A 2O9VA 2EGEA 1T3SA 1GL5A 2RN8A 1QLYA 1CSKA 1GRIA 2BTTA 2NWMA 1UE9A 2H8HA 2JT4A 2X3WD 5GJVB 2L3PA 1UGVA 2DNUA 4JJDA 1T3LA 2GBQA 2LJ1A 1QKWA 1AZEA 2KRNA 1ZLMA 5FW9A 2V1RA 1WA7A 4AFQC 3REBB 2CREA 2OAWA 1BB9A 2DL3A 4JZ4A 2J6FA 1QKXA 3VS6A 1WLPB 2FPEA 2KT1A 2JMCA 5IXFA 3EG3A 2L2PA 2K6DA 2EYZA 1X6GA 4OMLA 2DL5A 2CT4A 4R0KA 1K9AA 1Z9QA 2JM8A 2DL8A 1UJ0A 2JW4A 2GTOA 3KFVA 1BBZA 3UF4A 5IHNA 1UHCA 2DLPA 2KR3A 2EBPA 2LZ6B 2JM9A 4JPBW 2AZVA 3I5SA 4KRTA 2GTJA 2IIMA 4Z89A 2A37A 2EW3A 2BZXA 4J9DA 2XMFA 1U5SA 1UJYA 2RQWA 2EYYA 4LNPA 1SSHA 1TUCA 2JTEA 1WXBA 1GCQA 2K2MA 3M0UA 2O31A 1G2BA 1E6HA 1OPLA 1N5ZA 3PE0A 2X3XD 1NG2A 3EHQA 1WDXA 2CSQA 3M0QA 2GQIA 4IIMA 1UUEA 2YUQA 2K3BA 2ABLA 2RQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UTI A;  1WX6 A;  1M3A A;  4EIK A;  2FRW A;  1E7O A;  1UDL A;  1OV3 A;  2LJ3 A;  5IH2 A;  1JU5 C;  1M3C A;  2A08 A;  2D8H A;  2LQN A;  2HCK A;  4LUD A;  1AVZ C;  3NHN A;  1UHF A;  1QWF A;  2L0A A;  1PRM C;  1RLP C;  1AWO A;  2GNC A;  3H0F A;  4J9G A;  4A63 B;  3H41 A;  2F2X A;  3PVQ A;  4Z8A A;  3VS4 A;  1KFZ A;  4D8K A;  2DRK A;  4Y92 A;  1K0S A;  2FEI A;  2G6F X;  1M30 A;  3NGP A;  2RQR A;  1JEG A;  4HXJ A;  4ORZ A;  1W1F A;  2EGA A;  2HDA A;  1NEB A;  3NPF A;  4RTY A;  1AWW A;  3ULR B;  1BU1 A;  2JMA A;  1SEM A;  2JXB A;  2RPN A;  2KRM A;  4HVW A;  2ESW A;  1AWX A;  1T0H A;  2E5K A;  3REA B;  4AFU C;  1EFN A;  3R6N A;  1I1J A;  2FRY A;  1NEG A;  1UG1 A;  2HSP A;  2RNA A;  2DX1 A;  2P4R A;  1MV3 A;  5I22 A;  1H8K A;  2FPF A;  2F2W A;  2VKN A;  3A98 A;  4FSS A;  1ZBJ A;  2MCN A;  3QWY A;  4HVU A;  3RNJ A;  3EGU A;  2JS0 A;  3EG2 A;  4ZNX A;  2DMO A;  4QT7 A;  1YP5 A;  3U23 A;  2I0N A;  5L23 A;  1ZUU A;  4HCK A;  1AOJ A;  4RTX A;  1A0N B;  1AD5 A;  2KXC A;  1GFD A;  1SHF A;  2O2O A;  2YUO A;  3EHR A;  1HD3 A;  1GCP A;  1X6B A;  3UAT A;  1KSW A;  3I9Q A;  1PKS A;  5FWB A;  4AG2 C;  1JQQ A;  3UA6 A;  2K9G A;  1PHT A;  1KJW A;  4M4Z A;  1ABO A;  5GJW B;  2DRM A;  2B86 A;  1YWO A;  4LN2 A;  4CC7 A;  2LJ0 A;  1ZSG A;  2YDL A;  1IO6 A;  2D0N A;  2D8J A;  2C0I A;  1HSQ A;  2DL7 A;  3I35 A;  2W0Z A;  4DEX A;  4AFS C;  2ED0 A;  2LCS A;  2LMJ A;  2RMO A;  4J9F A;  2CUB A;  2KGT A;  3H0I A;  2PZ1 A;  1T0J A;  2ECZ A;  2YUN A;  2LNH B;  3VS2 A;  2KXD A;  2KNB B;  1Y0M A;  1MUZ A;  4GLM A;  4J9E A;  1HJD A;  2EQI A;  3M0P A;  1ZX6 A;  1X2Q A;  1OEB A;  2EPD A;  1M27 C;  4RTT A;  2K7A A;  1RI9 A;  1NYG A;  2AKK A;  1W6X A;  1PKT A;  1QCF A;  1K4U S;  1AWJ A;  1OOT A;  2EVR A;  1WIE A;  2M51 A;  3M0T A;  1WYX A;  1ZUY A;  1GBQ A;  2AZS A;  2HBW A;  3THK A;  2CSI A;  2LQW A;  2D1X A;  1I0C A;  1M3B A;  1NM7 A;  2YT6 A;  1U06 A;  2C0T A;  4JZ3 A;  1U3O A;  2CT3 A;  2KE9 A;  2KYB A;  1PWT A;  2A28 A;  2W10 A;  3VS5 A;  1KIK A;  1PNJ A;  2RF0 A;  2JS2 A;  1Y57 A;  2DBM A;  1NYF A;  2DVJ A;  3C0C A;  3CQT A;  2J6K A;  2LP5 A;  1G83 A;  1VYV A;  2FG0 A;  2EGC A;  2ED1 A;  4ESR A;  2F2V A;  3EG1 A;  1XOV A;  1YN8 A;  2NUZ A;  2DA9 A;  2C0O A;  2O9S A;  5FWC A;  4F17 A;  3RBB B;  3VS3 A;  2YSQ A;  3M0R A;  3FJ5 A;  1GBR A;  1FYN A;  2J6O A;  3M0S A;  1AEY A;  4CC3 A;  2OI3 A;  1K76 A;  2KT8 A;  1CKB A;  4OMP A;  2YUP A;  3VRY A;  2SEM A;  4Z88 A;  3TSZ A;  1WI7 A;  4CC4 B;  1WXU A;  2KRO A;  5HCK A;  4AFZ C;  2KYM A;  3JV3 A;  4RTZ A;  5IXB A;  2K79 A;  1WXT A;  3EG0 A;  2OJ2 A;  1X27 A;  2CH4 A;  1M8M A;  1SPK A;  2L3S A;  1TG0 A;  1NLP C;  3QWX X;  2ENM A;  2DF6 A;  4OMO A;  1TUD A;  1S1N A;  1LCK A;  5ECA A;  1V1C A;  4LUE A;  2J06 A;  2O88 A;  1PRL C;  2J7I A;  2V1Q A;  3O5Z A;  4J9B A;  3VS7 A;  1AZG B;  1JXO A;  2DM1 A;  4DEY A;  1VYU A;  1OPK A;  4RTV A;  2GGR A;  4J9I A;  1J3T A;  1H92 A;  2FPD A;  2BZY A;  1GFC A;  1FMK A;  1GCQ C;  4OMN A;  1WFW A;  2DL4 A;  2DE0 X;  1B3Q A;  1UEC A;  4X1V A;  4AG1 C;  3VS0 A;  2EKH A;  2DBK A;  4CC2 A;  2RQU A;  4WCI A;  2ROL A;  2HEQ A;  1ARK A;  2VWF A;  2M0Y A;  3NMZ C;  4HVV A;  2VVK A;  4GBQ A;  2CH4 W;  2BZ8 A;  2KBT A;  2ROT A;  1I07 A;  5IHK A;  4J9H A;  1SRL A;  1K1Z A;  3TVT A;  4LE9 A;  1CKA A;  4RUG A;  1JXM A;  1ABQ A;  1E6G A;  3ZL7 C;  4K11 A;  1X69 A;  1RLQ C;  1SHG A;  1K0X A;  2DJQ A;  4D8D A;  1UFF A;  2FO0 A;  3TSW A;  3SEM A;  1ZUK A;  4RTW A;  1VYT A;  2L3Q A;  1X43 A;  4F16 A;  1YCS B;  3LH5 A;  2QDL A;  1MV0 B;  3VRZ A;  1W70 A;  2CUD A;  4RTU A;  2AKL A;  2MIO A;  2MOX A;  2A36 A;  3I5R A;  3UA7 A;  5IHI A;  5I11 A;  1Z9Z A;  1X2K A;  4OMM A;  2KRS A;  1QWE A;  5EC7 A;  3H0H A;  2DYB A;  4F14 A;  1YWP A;  4JJC A;  1RUW A;  2KEA A;  2AK5 A;  2EYW A;  2DIL A;  4J9C A;  3PVL A;  3VS1 A;  4E6R A;  1VA7 A;  1NLO C;  2J05 A;  2CDT A;  3SHW A;  2RQT A;  3IQL A;  1BK2 A;  2PNI A;  4IIO A;  2LX7 A;  1YNZ A;  2EYX A;  4JJB A;  1B07 A;  1SRM A;  2SRC A;  3GBQ A;  1H3H A;  2PTK A;  4OMQ A;  1JO8 A;  2O9V A;  2EGE A;  1T3S A;  1GL5 A;  2RN8 A;  1QLY A;  1CSK A;  1GRI A;  2BTT A;  2NWM A;  1UE9 A;  2H8H A;  2JT4 A;  2X3W D;  5GJV B;  2L3P A;  1UGV A;  2DNU A;  4JJD A;  1T3L A;  2GBQ A;  2LJ1 A;  1QKW A;  1AZE A;  2KRN A;  1ZLM A;  5FW9 A;  2V1R A;  1WA7 A;  4AFQ C;  3REB B;  2CRE A;  2OAW A;  1BB9 A;  2DL3 A;  4JZ4 A;  2J6F A;  1QKX A;  3VS6 A;  1WLP B;  2FPE A;  2KT1 A;  2JMC A;  5IXF A;  3EG3 A;  2L2P A;  2K6D A;  2EYZ A;  1X6G A;  4OML A;  2DL5 A;  2CT4 A;  4R0K A;  1K9A A;  1Z9Q A;  2JM8 A;  2DL8 A;  1UJ0 A;  2JW4 A;  2GTO A;  3KFV A;  1BBZ A;  3UF4 A;  5IHN A;  1UHC A;  2DLP A;  2KR3 A;  2EBP A;  2LZ6 B;  2JM9 A;  4JPB W;  2AZV A;  3I5S A;  4KRT A;  2GTJ A;  2IIM A;  4Z89 A;  2A37 A;  2EW3 A;  2BZX A;  4J9D A;  2XMF A;  1U5S A;  1UJY A;  2RQW A;  2EYY A;  4LNP A;  1SSH A;  1TUC A;  2JTE A;  1WXB A;  1GCQ A;  2K2M A;  3M0U A;  2O31 A;  1G2B A;  1E6H A;  1OPL A;  1N5Z A;  3PE0 A;  2X3X D;  1NG2 A;  3EHQ A;  1WDX A;  2CSQ A;  3M0Q A;  2GQI A;  4IIM A;  1UUE A;  2YUQ A;  2K3B A;  2ABL A;  2RQV A; 
#chains in the Genus database with same CATH topology
 2DTH A;  5LJ5 e;  1W2B A;  3CXC P;  1YJN Q;  3OW2 S;  3EGD B;  2RI5 A;  1M3A A;  1KG1 A;  1D1A A;  1E7O A;  1OV3 A;  3CCR A;  5IH2 A;  1JU5 C;  3CCV A;  1AVZ C;  3CC2 T;  4IUR A;  1B34 A;  2RHU A;  3AT1 B;  1PRM C;  1AWO A;  1TU0 B;  2F5T X;  4M7D D;  3H41 A;  3PVQ A;  4M78 F;  2LC4 A;  1VUB A;  2P0P A;  4M78 E;  3E1S A;  5D6Y A;  2D9T A;  3QO3 A;  3EH2 A;  3QBY A;  4LDW A;  1JBM A;  2FEI A;  1RAA B;  4DOW A;  1M30 A;  2RQR A;  2EKO A;  4BY6 B;  1U8R A;  1JEG A;  5LJ5 g;  2DPP B;  4IKF A;  1ZQ1 A;  3SWN A;  3LW5 E;  4MZM A;  3NPF A;  3HPW A;  1AWW A;  3VYG A;  4BE2 A;  1BU1 A;  2JMA A;  3J7A F;  1BI0 A;  2E5K A;  3REA B;  3QII A;  1M1K C;  3R6N A;  2E6N A;  5LJ3 g;  1UGQ B;  5LJ5 f;  2HZY A;  1M8V A;  4EMK B;  4J5Y A;  1VQK A;  4D6W A;  1MV3 A;  4PK4 A;  2DD5 A;  2YXY A;  3CCR T;  3CCV T;  2VKN A;  4E7S A;  5D6X A;  3CXC A;  3NTH A;  1VQO Q;  3OYM A;  3M57 A;  5J3B A;  3CCS Q;  2JOY A;  2VAS A;  4RKU E;  4QQG A;  3H8Z A;  1ZUU A;  1AOJ A;  1BCM A;  3CCU Q;  3ZFJ A;  2QQR A;  4M77 G;  1K9M R;  3VV0 A;  1S72 A;  3OBY A;  2ATC B;  5KYN A;  2K9G A;  3TQ7 P;  4M78 A;  4OB0 B;  3OS2 A;  2COW A;  4LN2 A;  2LJ0 A;  2E64 A;  1ZSG A;  2LT1 A;  4JRK A;  2IPO B;  2KVQ G;  2C0I A;  1VQK T;  3I35 A;  3NFC A;  1YIT A;  1WZO A;  1YIJ Q;  2DFU A;  2LMJ A;  2CUB A;  1VQP T;  2PZ1 A;  1T0J A;  2ECZ A;  2ZGW A;  2LNH B;  1MNE A;  4M7D G;  2KXD A;  1EX4 A;  1MUZ A;  1Y0M A;  1ZBX A;  4GLM A;  3M0P A;  2MPX C;  4ZTF A;  1X2Q A;  2E1H A;  1OEB A;  1O75 A;  1IRX A;  2XU8 A;  1QCF A;  2QEX A;  3VYH B;  4HA8 A;  2RK2 A;  3JRZ A;  1OOT A;  3CC7 A;  2EVR A;  4C0F A;  1WIE A;  2M51 A;  3RR6 A;  3S3N A;  1WYX A;  4HT8 A;  1KHI A;  5KYX A;  1MHN A;  4FIB A;  1MMG A;  2RO0 A;  1U3O A;  2DVE A;  2KE9 A;  5CKB A;  4IUT A;  3VS5 A;  4ATO A;  1YIT T;  3X24 B;  3QKJ A;  2FL7 A;  2M9U A;  3CQT A;  2FG0 A;  4ESR A;  1WHG A;  2F2V A;  4JLI A;  3VKI A;  1XOV A;  5HK3 A;  2NUZ A;  2O9S A;  5DLO A;  1O9S A;  2YSQ A;  5GAN h;  2OTL Q;  2FZG B;  4N4G A;  4QQ6 A;  4N4H A;  3M0S A;  4MDW A;  1R77 A;  1TH7 A;  2E5Q A;  4M7A F;  3CCE Q;  4DBR A;  5CAI A;  2YUP A;  3VRY A;  4M7A E;  2QEX T;  3TSZ A;  4M78 G;  2DXC A;  4NL2 A;  1YBY A;  2KYM A;  5GAN e;  2K79 A;  4EMK C;  4NL3 A;  1VQ7 A;  1NZ9 A;  1MGQ A;  2OJ2 A;  1X27 A;  2CH4 A;  1PD0 A;  5LJ5 d;  1FXX A;  3CCJ Q;  2MK5 A;  3P8D A;  3QWX X;  1NLP C;  2DF6 A;  1S1N A;  3FRN A;  1MMA A;  4LUE A;  1VOM A;  4P5N A;  3JB9 F;  2CS7 A;  1MND A;  2CP0 A;  3G6E T;  4NOY A;  1AZG B;  1JXO A;  4DEY A;  2DO3 A;  5LJ3 d;  3E9G A;  1FWZ A;  2EJ9 A;  2GGR A;  3V8K A;  1NJI U;  2ZCF B;  2M16 A;  2DE0 X;  4AG1 C;  5GAN g;  3OA6 A;  5GMK m;  2EKH A;  4RG8 A;  4CC2 A;  1RAF B;  1SSF A;  2LRQ A;  2NLU A;  3HFO A;  3M4G A;  2ROL A;  4BB7 A;  1VQ4 Q;  1ARK A;  3OB9 A;  4MMK A;  3G4S Q;  1BYM A;  4ELY C;  2VWF A;  4J83 A;  3OY9 A;  2JUF A;  5GAN f;  1QVG P;  2P4T A;  2KBT A;  1VQ7 T;  1SRL A;  3VUB A;  5KCO A;  1SG5 A;  3MEW A;  3L2V A;  3PMI A;  1ABQ A;  1M2V A;  1VQN Q;  3ZL7 C;  1X69 A;  1SHG A;  2DJQ A;  1JRI A;  1UFF A;  2FZK B;  3N5B B;  1WQ7 A;  2QG9 B;  4NS5 A;  1HXD A;  1W70 A;  4J8O A;  4XTX A;  2MIO A;  2A36 A;  3I5R A;  3UA7 A;  4C5I A;  1UGS B;  1WJQ A;  1C1A A;  5IHI A;  5CIU A;  2CKK A;  1VIF A;  1IGU A;  1QP3 A;  4M75 D;  4OMM A;  1QWE A;  2DYB A;  1YWP A;  4JJC A;  3SD4 A;  5CK9 A;  5KYU A;  1NBE B;  1PG5 B;  2EJG A;  1Q81 R;  4Y91 A;  3MEU A;  2J05 A;  5C6S A;  2CDT A;  3SHW A;  3INZ A;  5LJ3 j;  3TEE A;  3JB9 I;  4BE1 A;  2PNI A;  4C8Q B;  1TTH B;  5FU7 B;  1Q81 U;  2XID A;  3X25 B;  1VQ8 T;  1SRM A;  2SRC A;  4J7I A;  1NJI C;  3LLR A;  4X9D A;  1QVG A;  1JO8 A;  3DB3 A;  2O9V A;  1OI1 A;  1D0Y A;  3G71 Q;  1VQ6 Q;  3CCQ Q;  2FVU A;  5KCH A;  2X3W D;  3FB9 A;  3M56 A;  1XNI A;  2R5M A;  3OSV A;  3OSS C;  1R8O B;  4ZGD B;  3JCM W;  2XD0 A;  1AZE A;  2KRN A;  2GFU A;  2R5A A;  5FW9 A;  3RMS A;  4FYX B;  4WTO B;  1WA7 A;  3MHX A;  2CRE A;  1V29 B;  1G5V A;  4E47 A;  2Y4Y A;  4XTU A;  4C0Z A;  3CCM A;  2DL3 A;  3F70 A;  4E7Z A;  4KUL A;  3EFS A;  2YWW A;  3M59 A;  1QMC A;  2RH2 A;  3EG3 A;  3QUI A;  2K6D A;  2CT4 A;  4CRI A;  4EMK A;  3KXT A;  3FC3 A;  3CME Q;  1Z9Q A;  2JZ2 A;  2DYI A;  5IHN A;  4C0D B;  2DLP A;  2HBP A;  1H3Z A;  4JPB W;  4J6W A;  4IUQ A;  4C5E A;  2HNI A;  2ZPH B;  1NPR A;  3CC4 A;  2EW3 A;  4ZGE B;  4J9D A;  1U5S A;  2V8I A;  2MWP A;  2A7Y A;  5I2M A;  1UGR B;  4PJO F;  2QA4 A;  4E7H A;  1YJN A;  5GMK l;  2K2M A;  2O31 A;  1E6H A;  1OPL A;  2XIC A;  5CO7 A;  3PE0 A;  3CCM T;  1VIE A;  2CYZ B;  4O6J A;  3M9Q A;  2YRV A;  4IIM A;  2JTF A;  1QVG S;  2YUQ A;  4RUG A;  1WJS A;  1UTI A;  5GAN d;  2YLC A;  1WX6 A;  2BE9 B;  4EIK A;  4KUD K;  4A4K A;  2VGM A;  1YJW Q;  3CBP A;  4OVA A;  2F5K A;  4V2S A;  3H0F A;  4J9G A;  1D09 B;  4Z8A A;  1G3S A;  4CI0 C;  4Y92 A;  3BDU A;  2QA4 T;  2G6F X;  3QDF A;  3NGP A;  3ZBD A;  1YJN T;  1W1F A;  3UDC A;  3KBG A;  1NEB A;  4BE0 A;  1SEM A;  4GY5 A;  4HVW A;  2ESW A;  4F7U F;  1RI0 A;  4XTV A;  1VQO A;  4R55 A;  5A0D A;  4X9C A;  3PTA A;  5GAN 8;  3CCS A;  3E2U A;  4C8Q C;  2FRY A;  3TRE A;  5FU7 C;  3QZ5 B;  2HSP A;  1Q86 R;  1TOV A;  2DX1 A;  5I22 A;  3CCU A;  1H8K A;  7AT1 B;  4A4G A;  3CCL Q;  2E4H A;  1ZBJ A;  2L3R A;  3C95 A;  3G7Z A;  3EG2 A;  4ZNX A;  3QJ6 A;  5KE2 A;  3U23 A;  2I0N A;  5DY9 A;  5L8R E;  5DM7 R;  2A3L A;  4RTX A;  3SDZ A;  1Q7Y U;  1A0N B;  2KXC A;  1SHF A;  3EHR A;  4JLG A;  1VQL A;  1F1B B;  2HL3 A;  3RKY A;  2D6F A;  1PKS A;  2NYS A;  2VV5 A;  3UA6 A;  1YIJ A;  1Q82 U;  1VQO T;  3JCM V;  5GAO m;  3CCS T;  2ZPE B;  2H3E B;  3CPW A;  4FW2 A;  2E41 A;  2D0N A;  3I55 Q;  1I5L A;  2DL7 A;  4E7L A;  1C6V X;  3CCU T;  4C0D C;  3M54 A;  3DB4 A;  3OYC A;  2LCS A;  1YHQ Q;  2RMO A;  4J9F A;  3BFM A;  2KSS A;  3R6O A;  5GAN 4;  3CPF A;  3VS2 A;  1IHV A;  1C0M A;  3V8L A;  1EIF A;  4EMH A;  4C8Q E;  1HJD A;  1M90 R;  1KD1 R;  3RES A;  2LDM A;  1VQL T;  1I4K 1;  1FMV A;  2OTJ A;  2DXB A;  1NYG A;  4II1 A;  1M90 U;  1W6X A;  1PKT A;  1N27 A;  5LJ3 e;  1ZUY A;  2E12 A;  2VC8 A;  1PCX A;  2RI3 A;  1NM7 A;  2IVW A;  2YT6 A;  4JZ3 A;  2YRC A;  2A28 A;  2OTL A;  4FW1 A;  2RF0 A;  1RAE B;  2MWO A;  1Q7Y C;  3I56 Q;  1WPY A;  2OX7 A;  1Y57 A;  3C0C A;  3CCE A;  3OYJ A;  2LP5 A;  1D0X A;  1N8R R;  2EGC A;  3E19 A;  2QQ9 A;  4EPC A;  1OZ2 A;  5CQX A;  5FWC A;  3VS3 A;  1EZZ B;  5D7U A;  1Q82 C;  2A0F B;  3CBO A;  1FYN A;  1NE8 A;  4ZN3 A;  2NUP A;  2KI7 A;  3CCJ A;  5GAM h;  2X4J A;  2SEM A;  2OTJ T;  2L5Q A;  3OMC A;  4OB1 B;  3CPW S;  5LJ3 f;  2ZPF B;  4C8Q D;  1QQJ A;  2VGN A;  1WXU A;  4QKU A;  1K8A R;  4PFZ A;  4ZN1 A;  1WXT A;  3A8L B;  4C8Q A;  1KQ2 A;  3BDL A;  2HQX A;  1SPK A;  2OTL T;  3RER A;  1Y71 A;  4JJN K;  2LT4 A;  1PRL C;  3CCE T;  4M78 D;  3O5Z A;  4C92 B;  4J9B A;  2DM1 A;  1VYU A;  1K9M U;  2YLB A;  3JCM P;  2K5L A;  4VUB A;  1M1F A;  4J9I A;  1WQW A;  1H92 A;  5EG2 A;  4KBM B;  2BUD A;  1BIA A;  1GCQ C;  4X1V A;  4M7A C;  2DBK A;  3CCJ T;  2HL5 C;  2RQU A;  4WCI A;  5GAM g;  5GAN 2;  3LYI A;  2HEQ A;  3PIO A;  3L2R A;  3FDR A;  1NPP A;  1VQN A;  3Q1J A;  1IXD A;  3NMZ C;  3FEO A;  2VVK A;  4GBQ A;  5GAO l;  4WF2 A;  3VUZ A;  2ROT A;  4PLL A;  2DJZ A;  4J9H A;  1K1Z A;  4FT2 A;  2DET A;  5KE3 A;  4LE9 A;  4ZTJ A;  3OYG A;  3CC2 Q;  2NUT B;  3MEV A;  3BW1 A;  3J81 E;  1S72 T;  1AT1 B;  4D8D A;  2FHD A;  1ZUK A;  3E9F A;  1VYT A;  1VQ9 Q;  4L59 A;  3QHS A;  2K4Y A;  3LH5 A;  2QDL A;  4J6X A;  3VRZ A;  4KH1 B;  2MI6 A;  2CUD A;  1AHJ B;  3GNG A;  2COZ A;  2MOX A;  4PJO B;  2CP3 A;  5I11 A;  1X01 A;  1Z9Z A;  1KQS A;  1TWB A;  2KRS A;  4FM4 B;  2BE7 D;  1RUW A;  2AK5 A;  2DIL A;  3G71 A;  3QZ9 B;  4E6R A;  2EIF A;  2FZC B;  2PUK B;  4C8Q G;  2P0K A;  4DBQ A;  1K9M C;  2LX7 A;  1D1C A;  3OS1 A;  3MP1 A;  5I2S A;  5GAO n;  4JJB A;  3L1A A;  1B07 A;  3A5Z B;  4KGX B;  4BY6 C;  3NTK A;  2VB6 A;  2MYS A;  2PTK A;  5FRM A;  1WHM A;  2DER A;  2EGE A;  2QAZ A;  1T3S A;  4LD6 A;  1HYO A;  1FMW A;  3OYK A;  1CSK A;  1UB4 A;  2BTT A;  4LDU A;  2QTV A;  2H8H A;  5GJV B;  3CC7 T;  1BI2 A;  2DNU A;  3M58 A;  4PJJ A;  1YJ9 Q;  2GBQ A;  2PVG B;  2QYZ A;  2LJ1 A;  2RA2 A;  2V1R A;  2RJE A;  3QYG B;  3JCM c;  3CME A;  4AFQ C;  5J39 A;  1WJR A;  4PJL A;  1I5O B;  2L89 A;  3OS5 A;  1TSF A;  4JZ4 A;  2J6F A;  3G71 T;  1QKX A;  3VS6 A;  4F7U B;  1G3T A;  2KT1 A;  3P8H A;  4JUV A;  3D7S B;  2ZPI B;  1X6G A;  4XTZ A;  2FB7 A;  1K9A A;  1X6O A;  3WVE B;  4M77 B;  2M0O A;  2EJF A;  4E7J A;  1BBZ A;  3UF4 A;  3EG9 B;  3A8G B;  2EBP A;  2CZ1 B;  3V7S A;  1IHW A;  1VQP Q;  4M75 F;  4BAC A;  4RG2 A;  3RKW A;  1R0C B;  3MO8 A;  4KRT A;  2GTJ A;  4QVD A;  1SKU B;  4BI8 B;  2O01 E;  1KQS S;  1KC8 R;  2RQW A;  2B8A A;  2EYY A;  1KQ1 A;  4M7A D;  2XG8 D;  1TUC A;  2JTE A;  1GCQ A;  2DAQ A;  2EYQ A;  2RHI A;  3M0U A;  1OZ3 A;  3CME T;  4M7A A;  1KHC A;  1N5Z A;  1RL2 A;  1YJW A;  3G1J A;  1NG2 A;  2XDP A;  3EHQ A;  1WDX A;  2CSQ A;  2QQA A;  2GQI A;  2X9H A;  2JTM A;  4HCZ A;  2C0O A;  2RQV A;  3GLX A;  4M7D B;  3L42 A;  8ATC B;  3JB9 D;  2LJ3 A;  2F1L A;  2EAY A;  1M3C A;  2A08 A;  2D8H A;  2LQN A;  2HCK A;  3QXE B;  5GAM d;  3CMA A;  3NHN A;  1UHF A;  3C12 A;  2FYK A;  1G3Y A;  3ER0 A;  1LVK A;  2L0A A;  2VXF A;  3SB2 A;  3L2Z A;  4FT4 A;  2GNC A;  4A63 B;  2F2X A;  1K73 R;  4FYV B;  3VS4 A;  5GMK h;  1KFZ A;  4PJO C;  3EGD A;  4HXJ A;  4ORZ A;  1JB0 E;  2HDA A;  3L2Q A;  1YI2 Q;  3QPH A;  1YJW T;  4OB3 B;  3CCL A;  3ULR B;  4C92 F;  2JXB A;  4XU2 A;  4JDS A;  2RPN A;  2KRM A;  4IUU A;  1PC0 A;  3QYH B;  1AWX A;  4C92 E;  4AFU C;  1EFN A;  5CQY A;  3P8B B;  4Y28 E;  5HK0 A;  5GMK e;  1NEG A;  5GMK i;  3CBM A;  1XTD A;  2KK4 A;  5FU6 B;  2P4R A;  2V8K A;  2EQU A;  4XK8 E;  2DD4 A;  2FPF A;  3CMA T;  4FSS A;  3G6E Q;  4B9X A;  1BI1 A;  4LXC A;  2AT1 B;  3QWY A;  3M53 A;  3DKM A;  1B7T A;  2CZ7 B;  1BIB A;  3BE3 A;  5GAN 6;  1YP5 A;  4PFP A;  4EDU A;  2BIV A;  5GAN 5;  3HTR A;  1GFD A;  2O2O A;  2YUO A;  3I55 A;  3QJY A;  1GCP A;  4M7A G;  3UAT A;  3I9Q A;  1OU9 A;  4B9W A;  5FWB A;  5GAM j;  1JQQ A;  3JCM b;  3V7R A;  1KJW A;  1ABO A;  2QAS A;  1YHQ A;  5CR2 A;  3A8H B;  4CC7 A;  1WHJ A;  2YDL A;  2EQK A;  3OMG A;  2V8J A;  1QCO A;  2W0Z A;  4DEX A;  1Q81 C;  4PJO E;  5IT9 E;  3V7C A;  1N9S A;  3JB9 G;  2ED0 A;  3HKS A;  2LQ8 A;  1ZSZ B;  2DTI A;  2YUN A;  3M4Y A;  1VQ5 Q;  3X26 B;  3LGF A;  1PSF A;  4J9E A;  1VQM Q;  2EQI A;  2PUO B;  2RHZ A;  1BKB A;  1D3B B;  3I55 T;  3OYA A;  1OU8 A;  4N0A C;  4RTT A;  2AKK A;  4FSX A;  1AWJ A;  4PJN A;  1GBQ A;  2AZS A;  2HBW A;  2CSI A;  5LL6 S;  3CC4 T;  3PNW C;  1I8F A;  1VQ8 Q;  1IGQ A;  1U06 A;  2C0T A;  3S6W A;  1XQH A;  2ZPB B;  1PWT A;  2WSE E;  3H6Z A;  4ANJ A;  4ZGJ B;  1QVP A;  2NUT A;  1NYF A;  2J6K A;  4DA4 A;  1G83 A;  1VYV A;  2ED1 A;  3CPW P;  2L8D A;  2ZAE A;  3UPU A;  2QGG A;  3GP8 A;  4PJO D;  1MMN A;  3RBB B;  3V8J A;  4A53 A;  4HT9 A;  2I2L A;  2K57 A;  4F7U E;  3M0R A;  1GBR A;  3JCM h;  4PJO A;  2J6O A;  4M77 F;  3CEY A;  5CKF A;  1AEY A;  3A8O B;  4L6V 5;  4EMG A;  4M77 E;  4MZP A;  1QVF S;  2KT8 A;  1CKB A;  1Y96 B;  4FYY B;  4UC4 A;  1Q86 U;  4BI4 A;  4RCB A;  2DIQ A;  3X20 B;  4CC4 B;  2X35 A;  3FLG A;  3SFM A;  4E7I A;  4N4I A;  2LCL A;  4OF1 A;  3EG0 A;  5FU6 C;  3JCM e;  2XKO C;  3URG A;  1TG0 A;  4A4F A;  1DJ7 B;  5ECA A;  1LCK A;  2J06 A;  5A0L A;  1D1B A;  3X28 B;  2V1Q A;  1RAH B;  1SF9 A;  4KH0 B;  2E70 A;  2WSF E;  1BCO A;  2DK3 A;  2PVD B;  1J3T A;  4M7D F;  5HKC A;  1GFC A;  1ZA1 B;  1WFW A;  2DL4 A;  2JNG A;  1B3Q A;  5J26 A;  3WVD B;  1M1K R;  3OQ5 A;  4M7D E;  3JCM g;  2KMT A;  3RDV A;  1M2V B;  3VU3 C;  4XU0 A;  2CZ6 B;  2M0Y A;  4HVV A;  4F7U A;  3O8V A;  2BZ8 A;  1VQ9 A;  1IB8 A;  1I07 A;  1N9R A;  5IHK A;  1QP2 A;  4M77 A;  1CKA A;  2DTO A;  3EFO B;  3HRS A;  1N6A A;  5KYW B;  1YFN A;  1ZSZ C;  4M75 B;  1KD1 U;  1YIJ T;  1Q86 C;  3TSW A;  2O4X B;  1W4S A;  2L3Q A;  2HQE A;  4LD9 K;  1X43 A;  4F16 A;  1U1T A;  2X4W A;  4QVZ A;  1MV0 B;  4JRP A;  4PJO G;  3M5A A;  4RTU A;  2AKL A;  4O5V A;  3OYF A;  1X2K A;  3CD6 Q;  3H0H A;  4F14 A;  4N0A A;  3HRU A;  2RK1 A;  4DQ2 A;  1G3W A;  2KEA A;  1PM3 A;  4J9C A;  3VS1 A;  4PL6 A;  1VA7 A;  1NLO C;  5CKD A;  2LTO A;  2RQT A;  4IIO A;  1VQ9 T;  2DIG A;  1N8R U;  4M7D A;  5IN1 A;  2COY A;  1YJ9 A;  2EYX A;  3KUF A;  3QG1 A;  5KYY B;  3GBQ A;  1OYX A;  4OMQ A;  5M9O A;  5FRO A;  5AYF A;  2RN8 A;  1UE9 A;  4ELZ C;  2M1H A;  4JS4 A;  2JT4 A;  5I21 A;  2L3P A;  3MJX A;  3FJP A;  2DEQ A;  2HD0 A;  2RD1 A;  3HP9 A;  2CP7 A;  4JRI A;  2VUB A;  4TVR A;  2HSE B;  4JJD A;  3DLL A;  5GMK j;  1ZLM A;  2LNV A;  4IUP A;  2K3Y A;  1K8A U;  5GAM e;  2HQH A;  3ME9 A;  4A4E A;  4DOV A;  1BB9 A;  4BDZ A;  5GAO r;  4HCB A;  2EQM A;  2C06 A;  2CP2 A;  1VQP A;  4BDY A;  4F7U G;  1VQ4 A;  3G4S A;  1M1G A;  1M90 C;  1KD1 C;  3QSU A;  1KQS P;  1Y7X A;  4QVC A;  2DL5 A;  2RHX A;  1YJ9 T;  4Z02 A;  1KK7 A;  2KY9 A;  4LDY A;  1PD1 A;  2PU9 B;  1W2B S;  4OGC A;  2JM9 A;  2HAX A;  2AZV A;  2KQW A;  3I5S A;  1UEB A;  1R0B G;  4AT1 B;  1IZ6 A;  1G8X A;  4YTL A;  4FL6 A;  2A37 A;  1D0Z A;  2BZX A;  3FIF A;  3LH0 A;  2OAU A;  2XMF A;  1UJY A;  2LCC A;  3LWH A;  4LNP A;  1SSH A;  1VQL Q;  1WXB A;  4X34 A;  5GAM f;  1N8R C;  2Y90 A;  1G2B A;  8AT1 B;  5KH6 A;  1P92 A;  3OYB A;  3HFN A;  1LJO A;  1VQ4 T;  1UUE A;  1Y07 A;  2GF7 A;  4Q5W A;  3G4S T;  2ABL A;  2HMA A;  3JCM d;  2FRW A;  3S3M A;  1UDL A;  1OX8 A;  4LUD A;  3OYL A;  3ZEH A;  3AHU A;  2E6Z A;  3TCJ A;  2RJF A;  4M75 C;  1QWF A;  1K8A C;  3NTI A;  4JS5 A;  1RLP C;  1YI2 A;  2DEU A;  1ZSZ A;  2HKQ B;  1VQN T;  2AIR B;  2GFA A;  4B6M A;  1VQ6 A;  3OYN A;  3CCQ A;  1UGP B;  4RMO A;  3CXC S;  1WHH A;  3MCA B;  4D8K A;  2DRK A;  1K0S A;  3CCR Q;  3CCV Q;  4KGV B;  3HL8 A;  2DXT A;  4FYW B;  2EGA A;  1D3B A;  2OTJ Q;  2XI9 A;  4RTY A;  1RAB B;  4A4H A;  2RJD A;  3G6E A;  2EFI A;  3LX7 A;  2JVV A;  1T0H A;  1I1J A;  1UG1 A;  2DZ9 A;  2RNA A;  3HSB A;  3RMQ A;  1X75 C;  3JB9 H;  1LPL A;  3EGX B;  4HCC A;  2F2W A;  3A98 A;  4F04 B;  4BI3 A;  2MCN A;  4HVU A;  3RNJ A;  3EGU A;  1YI2 T;  1PSE A;  2JS0 A;  3PIP A;  1VQ6 T;  2DMO A;  4QT7 A;  3CCQ T;  4RCC A;  5FRN A;  1VQK Q;  5L23 A;  4HCK A;  2XHC A;  3MEA A;  1AD5 A;  1HD3 A;  2P84 A;  1X6B A;  1M9S A;  2V26 A;  1KSW A;  1TUG B;  1Y96 A;  4AG2 C;  2E10 A;  2X51 A;  3MP8 A;  3C94 A;  4C92 C;  1NJI R;  5GAN 3;  1PHT A;  4M4Z A;  4M75 E;  2VXE A;  2Z0W A;  5GJW B;  2DRM A;  2B86 A;  1TS9 A;  2JJ9 A;  2DXU A;  1YWO A;  5C0M A;  2P0Q A;  1IO6 A;  2D8J A;  1HSQ A;  1VQ5 A;  3MP6 A;  3PFS A;  4A54 A;  1VQM A;  4AFS C;  1KC8 U;  1S72 Q;  4BD3 A;  2K5F A;  1B34 B;  3JCM J;  2K3X A;  2KGT A;  3H0I A;  5D6W A;  1HK9 A;  1LNX A;  2RHY A;  4XU1 A;  4DBF A;  5GAO p;  3ASK A;  4IUV A;  2RI2 A;  1VQ8 A;  1JJ2 P;  2KNB B;  1YIT Q;  4XTY A;  2K5I A;  2BKD N;  1ZX6 A;  1RAD B;  3PGG A;  3SWN B;  3EH1 A;  2EPD A;  1M27 C;  5CKE A;  2CZ0 B;  2K7A A;  1RI9 A;  4LDV A;  1K4U S;  3M0T A;  2Y4X A;  3L2U A;  3THK A;  2LQW A;  2D1X A;  3A1P A;  1I0C A;  1M3B A;  4MML A;  4JRQ A;  2G3R A;  2CT3 A;  2NUP B;  2KYB A;  1WNL A;  2JN0 A;  5LJ5 j;  2W10 A;  3S3O A;  4C5H A;  1PNJ A;  3OS0 A;  1VQ5 T;  1K73 U;  1KIK A;  2ZPG B;  2JS2 A;  1VQM T;  3EFO A;  1GXI E;  1LOJ A;  2QEX Q;  2DBM A;  2DVJ A;  1WGS A;  1QVF P;  4OB2 B;  5KYW A;  3CC7 Q;  5CKH A;  3OYD A;  4M75 A;  3GPL A;  3C4S A;  3EG1 A;  2XK0 A;  2O4X A;  2GCX A;  1YN8 A;  4F17 A;  2DA9 A;  1V76 A;  4C0G A;  3PT9 A;  3UT1 A;  2QI2 A;  5HY6 A;  3FJ5 A;  3JCM Q;  4AMC A;  2H3J A;  4L5G A;  3T9N A;  4CC3 A;  2OI3 A;  4DBH A;  9ATC B;  1K76 A;  4OMP A;  4Z88 A;  1JJ2 A;  4PNO A;  1ZHI A;  1KC8 C;  1WI7 A;  3MPU B;  4M78 B;  2KRO A;  2PVO B;  5DLQ E;  2KDS A;  5HCK A;  2WSC E;  3VJP A;  4AFZ C;  4RTZ A;  1RAI B;  3JV3 A;  5IXB A;  3JCM X;  2CGH A;  2QXF A;  3RUX A;  1M8M A;  3LWI A;  5KYY A;  2L3S A;  2ENM A;  4OMO A;  1TUD A;  4OP0 A;  3EAE A;  2E3H A;  2F69 A;  1V1C A;  2X4Y A;  2O88 A;  2M02 A;  2J7I A;  3OYE A;  2XDD A;  5A2Q E;  3CCL T;  2X4X A;  2D0Q B;  4QW2 A;  3VS7 A;  4OGE A;  4FCY A;  4J7F A;  1VQ7 Q;  1OPK A;  1M5Q 1;  1RAC B;  2VYT A;  4RTV A;  4MDX A;  1QVF A;  4LDX A;  2FPD A;  3OYY A;  4KGZ B;  2BZY A;  1FMK A;  4KUI A;  4OMN A;  1UEC A;  4M77 C;  1M4Z A;  2ZZD A;  3VS0 A;  4MZT A;  4C92 D;  1QW1 A;  2E65 A;  3RIR A;  1M2O A;  6AT1 B;  1YCY A;  3J80 E;  3RKX A;  1K73 C;  1Q95 G;  3TU4 K;  4R56 A;  4C92 A;  3LGL A;  3H9N A;  3QDR B;  1RAG B;  2CH4 W;  5KYX B;  3JB9 J;  4ME7 A;  4XQ3 A;  3OW2 P;  3EFR A;  3TVT A;  2CP6 A;  1WHK A;  3OYI A;  5CCA A;  2PQW A;  1JXM A;  4XAX B;  2WAC A;  1E6G A;  4PLI A;  4M75 G;  4K11 A;  2LX9 A;  3CD6 A;  5A0G A;  1RLQ C;  1H64 1;  3I56 A;  1K0X A;  2CP5 A;  1WHL A;  2FO0 A;  1I81 A;  2QK0 A;  3SEM A;  4RTW A;  1YHQ T;  2QTX A;  1YCS B;  4M7D C;  2EWN A;  1JJ2 S;  4BUG A;  4QQD A;  3MET A;  2HKN A;  3SWN C;  1XJW B;  4XTW A;  5EC7 A;  2MMP A;  4PJM A;  2MAM A;  2QQB A;  2EYW A;  3PVL A;  4J6Y A;  4FU6 A;  3IQL A;  1BK2 A;  3PMT A;  1YNZ A;  4HKE A;  3CMA Q;  1MMD A;  4E2F B;  4PKC C;  1H3H A;  1TXQ A;  2DKG A;  1GL5 A;  3OW2 A;  4XU3 A;  3CD6 T;  1QLY A;  1GRI A;  3I56 T;  2NWM A;  2QQS A;  4E7K A;  3BY7 A;  3M55 A;  1U1S A;  3GOX A;  1UGV A;  1BI3 A;  1ACM B;  2YHT A;  2E3I A;  2LVM A;  2QDY B;  2LQK A;  1T3L A;  2AHJ B;  1QKW A;  2RB6 A;  3REB B;  5GAO q;  2OAW A;  2RM4 A;  3GNF B;  1OQK A;  4C92 G;  2DZC A;  1W2B P;  1Q7Y R;  4C5G A;  4M78 C;  1WLP B;  2MF2 A;  2FPE A;  2JMC A;  2RJC A;  1OUL A;  2YRD A;  5IAY A;  5IXF A;  2R57 A;  2L2P A;  2KAF A;  3GIB A;  2EYZ A;  5AT1 B;  4OML A;  4R0K A;  1IRE B;  3JSC A;  5GAN j;  2EQJ A;  3MKD A;  4GLK A;  2JM8 A;  2DL8 A;  1UJ0 A;  2JW4 A;  2GTO A;  3KFV A;  3EGX A;  4M7A B;  1Q82 R;  1QCN A;  1UHC A;  2KR3 A;  4KT0 E;  2R58 A;  3DLM A;  3CCM Q;  4OMF B;  3CC2 A;  3HRT A;  2LZ6 B;  5FLX E;  1M1K U;  3UWN A;  3OYH A;  2GQV A;  1OX9 A;  2IIM A;  4Z89 A;  3GF5 A;  4M77 D;  2QGF B;  1FX7 A;  3JCM f;  3L2W A;  5CVI A;  3A8M B;  5LJ5 h;  3HHT B;  3WXM B;  3OBW A;  3EG9 A;  2K2V A;  5GAN 7;  5KYU B;  2IG0 A;  1ZA2 B;  2X3X D;  3JAM E;  3CC4 Q;  5LJ3 h;  3M0Q A;  2XDB A;  4PFO A;  4C8Q F;  2K3B A;  2QA4 Q; 
#chains in the Genus database with same CATH homology
 1UTI A;  1WX6 A;  1M3A A;  4EIK A;  2FRW A;  1E7O A;  1UDL A;  1OV3 A;  2LJ3 A;  5IH2 A;  1JU5 C;  1M3C A;  2A08 A;  2D8H A;  2LQN A;  2HCK A;  4LUD A;  1AVZ C;  3NHN A;  1UHF A;  1QWF A;  2L0A A;  1PRM C;  1RLP C;  1AWO A;  2GNC A;  3H0F A;  4J9G A;  4A63 B;  3H41 A;  2F2X A;  3PVQ A;  4Z8A A;  3VS4 A;  1KFZ A;  4D8K A;  2DRK A;  4Y92 A;  1K0S A;  2FEI A;  2G6F X;  1M30 A;  3NGP A;  2RQR A;  1JEG A;  4HXJ A;  4ORZ A;  1W1F A;  2EGA A;  2HDA A;  1NEB A;  3NPF A;  4RTY A;  1AWW A;  3ULR B;  1BU1 A;  2JMA A;  1SEM A;  2JXB A;  2RPN A;  2KRM A;  4HVW A;  2ESW A;  1AWX A;  1T0H A;  2E5K A;  3REA B;  4AFU C;  1EFN A;  3R6N A;  1I1J A;  2FRY A;  1NEG A;  1UG1 A;  2HSP A;  2RNA A;  2DX1 A;  2P4R A;  1MV3 A;  5I22 A;  1H8K A;  2FPF A;  2F2W A;  2VKN A;  3A98 A;  4FSS A;  1ZBJ A;  2MCN A;  3QWY A;  4HVU A;  3RNJ A;  3EGU A;  2JS0 A;  3EG2 A;  4ZNX A;  2DMO A;  4QT7 A;  1YP5 A;  3U23 A;  2I0N A;  5L23 A;  1ZUU A;  4HCK A;  1AOJ A;  4RTX A;  1A0N B;  1AD5 A;  2KXC A;  1GFD A;  1SHF A;  2O2O A;  2YUO A;  3EHR A;  1HD3 A;  1GCP A;  1X6B A;  3UAT A;  1KSW A;  3I9Q A;  1PKS A;  5FWB A;  4AG2 C;  1JQQ A;  3UA6 A;  2K9G A;  1PHT A;  1KJW A;  4M4Z A;  1ABO A;  5GJW B;  2DRM A;  2B86 A;  1YWO A;  4LN2 A;  4CC7 A;  2LJ0 A;  1ZSG A;  2YDL A;  1IO6 A;  2D0N A;  2D8J A;  2C0I A;  1HSQ A;  2DL7 A;  3I35 A;  2W0Z A;  4DEX A;  4AFS C;  2ED0 A;  2LCS A;  2LMJ A;  2RMO A;  4J9F A;  2CUB A;  2KGT A;  3H0I A;  2PZ1 A;  1T0J A;  2ECZ A;  2YUN A;  2LNH B;  3VS2 A;  2KXD A;  2KNB B;  1Y0M A;  1MUZ A;  4GLM A;  4J9E A;  1HJD A;  2EQI A;  3M0P A;  1ZX6 A;  1X2Q A;  1OEB A;  2EPD A;  1M27 C;  4RTT A;  2K7A A;  1RI9 A;  1NYG A;  2AKK A;  1W6X A;  1PKT A;  1QCF A;  1K4U S;  1AWJ A;  1OOT A;  2EVR A;  1WIE A;  2M51 A;  3M0T A;  1WYX A;  1ZUY A;  1GBQ A;  2AZS A;  2HBW A;  3THK A;  2CSI A;  2LQW A;  2D1X A;  1I0C A;  1M3B A;  1NM7 A;  2YT6 A;  1U06 A;  2C0T A;  4JZ3 A;  1U3O A;  2CT3 A;  2KE9 A;  2KYB A;  1PWT A;  2A28 A;  2W10 A;  3VS5 A;  1KIK A;  1PNJ A;  2RF0 A;  2JS2 A;  1Y57 A;  2DBM A;  1NYF A;  2DVJ A;  3C0C A;  3CQT A;  2J6K A;  2LP5 A;  1G83 A;  1VYV A;  2FG0 A;  2EGC A;  2ED1 A;  4ESR A;  2F2V A;  3EG1 A;  1XOV A;  1YN8 A;  2NUZ A;  2DA9 A;  2C0O A;  2O9S A;  5FWC A;  4F17 A;  3RBB B;  3VS3 A;  2YSQ A;  3M0R A;  3FJ5 A;  1GBR A;  1FYN A;  2J6O A;  3M0S A;  1AEY A;  4CC3 A;  2OI3 A;  1K76 A;  2KT8 A;  1CKB A;  4OMP A;  2YUP A;  3VRY A;  2SEM A;  4Z88 A;  3TSZ A;  1WI7 A;  4CC4 B;  1WXU A;  2KRO A;  5HCK A;  4AFZ C;  2KYM A;  3JV3 A;  4RTZ A;  5IXB A;  2K79 A;  1WXT A;  3EG0 A;  2OJ2 A;  1X27 A;  2CH4 A;  1M8M A;  1SPK A;  2L3S A;  1TG0 A;  1NLP C;  3QWX X;  2ENM A;  2DF6 A;  4OMO A;  1TUD A;  1S1N A;  1LCK A;  5ECA A;  1V1C A;  4LUE A;  2J06 A;  2O88 A;  1PRL C;  2J7I A;  2V1Q A;  3O5Z A;  4J9B A;  3VS7 A;  1AZG B;  1JXO A;  2DM1 A;  4DEY A;  1VYU A;  1OPK A;  4RTV A;  2GGR A;  4J9I A;  1J3T A;  1H92 A;  2FPD A;  2BZY A;  1GFC A;  1FMK A;  1GCQ C;  4OMN A;  1WFW A;  2DL4 A;  2DE0 X;  1B3Q A;  1UEC A;  4X1V A;  4AG1 C;  3VS0 A;  2EKH A;  2DBK A;  4CC2 A;  2RQU A;  4WCI A;  2ROL A;  2HEQ A;  1ARK A;  2VWF A;  2M0Y A;  3NMZ C;  4HVV A;  2VVK A;  4GBQ A;  2CH4 W;  2BZ8 A;  2KBT A;  2ROT A;  1I07 A;  5IHK A;  4J9H A;  1SRL A;  1K1Z A;  3TVT A;  4LE9 A;  1CKA A;  4RUG A;  1JXM A;  1ABQ A;  1E6G A;  3ZL7 C;  4K11 A;  1X69 A;  1RLQ C;  1SHG A;  1K0X A;  2DJQ A;  4D8D A;  1UFF A;  2FO0 A;  3TSW A;  3SEM A;  1ZUK A;  4RTW A;  1VYT A;  2L3Q A;  1X43 A;  4F16 A;  1YCS B;  3LH5 A;  2QDL A;  1MV0 B;  3VRZ A;  1W70 A;  2CUD A;  4RTU A;  2AKL A;  2MIO A;  2MOX A;  2A36 A;  3I5R A;  3UA7 A;  5IHI A;  5I11 A;  1Z9Z A;  1X2K A;  4OMM A;  2KRS A;  1QWE A;  5EC7 A;  3H0H A;  2DYB A;  4F14 A;  1YWP A;  4JJC A;  1RUW A;  2KEA A;  2AK5 A;  2EYW A;  2DIL A;  4J9C A;  3PVL A;  3VS1 A;  4E6R A;  1VA7 A;  1NLO C;  2J05 A;  2CDT A;  3SHW A;  2RQT A;  3IQL A;  1BK2 A;  2PNI A;  4IIO A;  2LX7 A;  1YNZ A;  2EYX A;  4JJB A;  1B07 A;  1SRM A;  2SRC A;  3GBQ A;  1H3H A;  2PTK A;  4OMQ A;  1JO8 A;  2O9V A;  2EGE A;  1T3S A;  1GL5 A;  2RN8 A;  1QLY A;  1CSK A;  1GRI A;  2BTT A;  2NWM A;  1UE9 A;  2H8H A;  2JT4 A;  2X3W D;  5GJV B;  2L3P A;  1UGV A;  2DNU A;  4JJD A;  1T3L A;  2GBQ A;  2LJ1 A;  1QKW A;  1AZE A;  2KRN A;  1ZLM A;  5FW9 A;  2V1R A;  1WA7 A;  4AFQ C;  3REB B;  2CRE A;  2OAW A;  1BB9 A;  2DL3 A;  4JZ4 A;  2J6F A;  1QKX A;  3VS6 A;  1WLP B;  2FPE A;  2KT1 A;  2JMC A;  5IXF A;  3EG3 A;  2L2P A;  2K6D A;  2EYZ A;  1X6G A;  4OML A;  2DL5 A;  2CT4 A;  4R0K A;  1K9A A;  1Z9Q A;  2JM8 A;  2DL8 A;  1UJ0 A;  2JW4 A;  2GTO A;  3KFV A;  1BBZ A;  3UF4 A;  5IHN A;  1UHC A;  2DLP A;  2KR3 A;  2EBP A;  2LZ6 B;  2JM9 A;  4JPB W;  2AZV A;  3I5S A;  4KRT A;  2GTJ A;  2IIM A;  4Z89 A;  2A37 A;  2EW3 A;  2BZX A;  4J9D A;  2XMF A;  1U5S A;  1UJY A;  2RQW A;  2EYY A;  4LNP A;  1SSH A;  1TUC A;  2JTE A;  1WXB A;  1GCQ A;  2K2M A;  3M0U A;  2O31 A;  1G2B A;  1E6H A;  1OPL A;  1N5Z A;  3PE0 A;  2X3X D;  1NG2 A;  3EHQ A;  1WDX A;  2CSQ A;  3M0Q A;  2GQI A;  4IIM A;  1UUE A;  2YUQ A;  2K3B A;  2ABL A;  2RQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...