2JMAA

R21a spc-sh3:p41 complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
b'MDETGKELVLALYDYQEKSPAEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
molecule tags Structural protein
source organism Gallus gallus
publication title The high-resolution NMR structure of the R21A Spc-SH3:P41 complex: Understanding the determinants of binding affinity by comparison with Abl-SH3
pubmed doi rcsb
total genus 12
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jmaA00
4F16A 4Z89A 2O88A 2DL5A 2LNHB 3EHRA 1WA7A 3QWXX 5FWBA 2M51A 2DL7A 2HBWA 1UJ0A 1Y57A 3SHWA 2O2OA 2ROLA 4JJDA 4J9DA 1HSQA 1H92A 2EQIA 2EVRA 1UGVA 1I07A 2J6OA 1K9AA 2YUQA 1VA7A 1TUCA 3VS7A 4F14A 2YT6A 4RTUA 1AWOA 4JZ3A 2DRKA 3VS3A 4M4ZA 2GNCA 1H3HA 2EGAA 1YWOA 5IH2A 1SHFA 2L2PA 1RUWA 1N5ZA 2AZVA 3REBB 2JS0A 4J9GA 2ECZA 2YUPA 2KE9A 1U3OA 3REAB 3I35A 1GL5A 1PKSA 4ESRA 1YNZA 1YN8A 3SEMA 1ZBJA 3GBQA 5FW9A 1X6GA 2D8HA 3TVTA 2FEIA 3ZL7C 4ORZA 1WXBA 1M30A 2EW3A 1WYXA 4R0KA 3U23A 2W10A 4RTZA 2KT8A 2DBMA 2HDAA 2J6KA 1KIKA 2KXCA 1UUEA 2EYWA 2DJQA 1MV0B 4OMMA 2ED1A 3RBBB 3VS6A 1U5SA 1ZUUA 2FRWA 1KSWA 2DMOA 3RNJA 4HVVA 4D8KA 2DL4A 2D1XA 3IQLA 2A08A 2V1QA 3THKA 1W1FA 4AFZC 2CH4A 1NYGA 1X2KA 4HVWA 2I0NA 2KXDA 4AFQC 5L23A 1SRLA 2BZYA 3VS5A 1CSKA 1JEGA 3R6NA 1QCFA 3H0FA 2G6FX 1NEBA 2XMFA 2FPDA 1ARKA 1GCQC 4OMPA 1WDXA 2D0NA 2KYMA 1ZLMA 4LNPA 1ABOA 4F17A 2X3WD 2RQVA 1Z9QA 1RI9A 1YWPA 4AG2C 2RQWA 2J7IA 3H0IA 3PVLA 4AFSC 3FJ5A 3M0UA 4GBQA 1BBZA 1OEBA 1A0NB 1GCQA 2DF6A 5GJWB 2ABLA 4JJBA 2EGCA 2JW4A 4CC4B 1K1ZA 4ZNXA 2K6DA 2YUNA 2KR3A 1E6HA 2J6FA 4EIKA 1GBQA 3TSWA 2CSQA 4J9EA 1AVZC 3NHNA 2OI3A 2AKLA 1WFWA 4FSSA 2LMJA 1RLPC 2ESWA 1UE9A 2DA9A 3VRYA 2FPFA 1BU1A 2KNBB 2M0YA 1GFCA 1KFZA 2DILA 2O9VA 3TSZA 1LCKA 1MV3A 2L0AA 2B86A 1NLPC 1QWEA 1WLPB 2J06A 2A28A 4HVUA 1GBRA 4LN2A 1W6XA 1QLYA 2GQIA 2DL8A 1UHCA 4CC3A 4QT7A 2RPNA 4RTTA 1GRIA 2DVJA 2PNIA 4LUDA 1VYVA 1K0SA 2YDLA 2QDLA 2ROTA 2C0OA 2OAWA 1T3LA 2EGEA 2FO0A 2BZ8A 2EKHA 2JM9A 1J3TA 1BB9A 5IXBA 2DNUA 3ULRB 1UFFA 1ZSGA 2EYZA 1I1JA 2K7AA 2AZSA 3EG1A 2VWFA 5IXFA 3EG2A 2AK5A 2RNAA 2JMAA 1AWXA 2HSPA 1T0HA 3M0TA 3UATA 4J9FA 1OPLA 2JT4A 5GJVB 3UF4A 4HXJA 2O31A 1SEMA 2CT4A 4WCIA 2LQWA 3EG3A 1VYTA 4RTXA 4AFUC 2P4RA 1JQQA 2LZ6B 1JXOA 1UG1A 2L3SA 2F2WA 3VS2A 1RLQC 1AEYA 1MUZA 3JV3A 2LJ3A 2EYYA 2MCNA 2BZXA 2LJ1A 1H8KA 1TG0A 2KGTA 2CUDA 2JS2A 2RF0A 1ZX6A 1FMKA 2RQTA 2K79A 2SEMA 4LE9A 1AZEA 2VVKA 1M3AA 2X3XD 1X43A 4A63B 4OMLA 2H8HA 1K76A 4KRTA 1YP5A 2HEQA 1M8MA 2O9SA 5ECAA 5IHIA 1S1NA 3M0PA 3KFVA 1Y0MA 2JM8A 1VYUA 3H0HA 1WI7A 3C0CA 1SSHA 2LQNA 2KRSA 1XOVA 4Y92A 4JJCA 3EG0A 2DE0X 4X1VA 2A37A 1I0CA 2LP5A 1E6GA 4AG1C 2JXBA 3H41A 1M3CA 2KEAA 1OV3A 4HCKA 1AZGB 1X27A 2DBKA 2RQUA 1PWTA 2SRCA 2PZ1A 4OMQA 4DEXA 2JTEA 4J9BA 2FG0A 4J9HA 2FRYA 3PVQA 3EGUA 1T3SA 4Z88A 1AWWA 1K4US 2CREA 2KT1A 1CKAA 1CKBA 2VKNA 1ZUYA 2V1RA 5IHNA 2ENMA 1ABQA 1UECA 2HCKA 4OMOA 3NGPA 1B07A 2A36A 2LJ0A 4K11A 2KRMA 2KBTA 1V1CA 2DX1A 5FWCA 3UA7A 1OPKA 3NPFA 1PRLC 4J9CA 1JU5C 4JZ4A 1HJDA 1NYFA 1X2QA 3LH5A 2F2VA 4RTVA 5I22A 2DL3A 1X6BA 2KYBA 4JPBW 2YUOA 1GCPA 2DM1A 2JMCA 4CC7A 1NG2A 1UHFA 2E5KA 3M0QA 2K3BA 1B3QA 1U06A 3EHQA 4IIOA 4IIMA 4DEYA 1G2BA 2FPEA 3I5SA 2LX7A 1NEGA 2YSQA 1WX6A 3M0SA 3I9QA 3A98A 2MIOA 1E7OA 3UA6A 2CUBA 1AWJA 2DLPA 2GTJA 4RUGA 2NUZA 5EC7A 2EYXA 2J05A 1TUDA 3VS1A 3VS4A 1SRMA 2W0ZA 1PRMC 2KROA 2IIMA 1NM7A 1JO8A 5I11A 2D8JA 2RQRA 1OOTA 2PTKA 4GLMA 1SPKA 1QWFA 3I5RA 4E6RA 1AOJA 5IHKA 2C0TA 1T0JA 2GGRA 2L3PA 2AKKA 2BTTA 1IO6A 1AD5A 1M27C 1EFNA 2NWMA 1M3BA 3VRZA 4J9IA 4RTWA 2EBPA 2K9GA 1YCSB 1Z9ZA 2CT3A 4CC2A 2RN8A 4RTYA 2F2XA 3M0RA 5HCKA 1G83A 1WXUA 2DRMA 2OJ2A 3QWYA 1WIEA 4OMNA 1PNJA 1JXMA 2CSIA 2RMOA 2L3QA 2CH4W 2DYBA 2LCSA 1HD3A 1K0XA 1BK2A 1UDLA 1UTIA 1WXTA 1ZUKA 3NMZC 1W70A 3VS0A 2KRNA 1FYNA 2ED0A 1SHGA 1X69A 2EPDA 1GFDA 4LUEA 4D8DA 2MOXA 1KJWA 4Z8AA 2GTOA 3PE0A 1QKXA 2CDTA 3CQTA 3O5ZA 1PKTA 1QKWA 2C0IA 1PHTA 2GBQA 2K2MA 1NLOC 1UJYA
chains in the Genus database with same CATH superfamily
5KYUB 4F16A 1BI3A 4M78D 4E7SA 3E19A 2AT1B 2O88A 3EHRA 3QWXX 2MF2A 1TSFA 3CC2T 3CMAQ 4M78E 3QIIA 3QDFA 4J9DA 3MEVA 2EVRA 1I07A 4KH0B 3A5ZB 2J6OA 3OYMA 2K5LA 1FMWA 3DLLA 2EQJA 4RTUA 5EG2A 1JJ2P 2MI6A 2DRKA 3MP6A 2EGAA 5FU6C 2M02A 1B34B 1W2BS 1SHFA 1R8OB 2HQHA 3REBB 3BDLA 1YJNT 2KE9A 1GL5A 1PKSA 1VQ5Q 2IPOB 3GNGA 1LNXA 5FU7B 2VV5A 3SDZA 4C8QE 1Q81R 3TVTA 3BDUA 3EFOA 2WSCE 4L5GA 3CCQA 1ZSZA 3ER0A 1BCMA 5DY9A 3U23A 4BE0A 1FWZA 2W10A 5KE3A 4FIBA 3JCMd 5GAOq 2DBMA 2HDAA 1WJQA 2KXCA 2DJQA 4C92D 1MV0B 5D6WA 1Q82C 2QDYB 2E4HA 3CPWP 3CC7T 1NJIC 3LGFA 5A2QE 5GAN3 1NBEB 1W2BP 2D1XA 4C5GA 3M59A 4HCBA 1X2KA 4HVWA 4FM4B 3OQ5A 4KUDK 4EMKB 3NFCA 4M75E 1WHLA 4M77C 2X9HA 5KYXB 1CSKA 4FT4A 5DLQE 3C4SA 3RDVA 5GANj 3LW5E 1NEBA 2DZ9A 4C0GA 1JJ2S 1GCQC 2HL5C 3F70A 1QMCA 3G1JA 4PLLA 3OS5A 4F17A 3CD6A 2RQWA 4DA4A 3PVLA 3KUFA 2PU9B 1N8RR 1MMGA 3OYJA 3GP8A 2L5QA 2LC4A 2JW4A 4C92A 4KH1B 1ACMB 2K6DA 4A4KA 2J6FA 1GBQA 1OQKA 4MZPA 1S72A 2CSQA 4J9EA 3X28B 1IHWA 1AVZC 3CCQQ 3NHNA 1BYMA 5CQXA 5GAMf 3VRYA 1K8AU 4KT0E 1BI1A 8ATCB 4JRQA 2RI5A 2LVMA 2O9VA 3OYHA 1MV3A 1WLPB 1D0XA 2RO0A 3OW2A 2RHYA 4JLIA 2DVJA 1D1BA 1K0SA 4QKUA 2OAWA 3JCMc 1T3LA 2FO0A 4OB1B 2F5TX 2JM9A 2RJFA 1BB9A 3ULRB 4M75D 4N4IA 1ZHIA 3EG2A 2AK5A 2Y4XA 2JMAA 1B7TA 1AWXA 3QXEB 3MEUA 3TCJA 4E2FB 1G3YA 1WJSA 4J9FA 2NLUA 2EJGA 5GANe 1SEMA 1Q82R 2CT4A 4WCIA 2E3IA 4OMFB 3PGGA 1QQJA 2OX7A 2IG0A 2M16A 1UEBA 3MP1A 1M90U 2L3SA 4F7UG 1HYOA 1BCOA 3CC2A 3GF5A 4LDVA 1YJNA 2KGTA 2RK2A 2HL3A 2RF0A 2VYTA 3L2QA 4R56A 4XQ3A 4B9WA 1VQNA 4C0DC 4M7AF 3HHTB 2DTIA 2LCCA 4EMHA 2H8HA 5LJ5e 2QEXA 5KCOA 1YP5A 1AT1B 3EGDA 3HRUA 4DBFA 3GIBA 2O9SA 5IHIA 1S1NA 3CCRT 2DFUA 3LGLA 4XTWA 4VUBA 2JM8A 4PJOE 4ZN3A 1YJWT 3RIRA 1SSHA 3CBOA 4EDUA 1QVFP 1XOVA 2DIGA 4JJCA 2LQ8A 4FW1A 2YLCA 5GANh 1KHCA 2DE0X 3JB9H 4KUIA 3H41A 3RUXA 4IUTA 1KD1C 1SSFA 2P0QA 1PWTA 5GMKe 4JRPA 1KC8C 1D0YA 2SRCA 4QVZA 4F7UF 4DEXA 3SD4A 4J9HA 1VQ9Q 2D0QB 3PVQA 4OGCA 3G6EQ 4OGEA 1PC0A 1N8RC 3EGDB 1CKAA 1ABQA 3META 3CD6T 5KCHA 2XI9A 2HKNA 2CP7A 3NGPA 1B07A 2LJ0A 3OYNA 2CZ7B 2KBTA 5FWCA 4PJOB 1OPKA 1PRLC 4J9CA 1JU5C 2H3JA 5DM7R 4JZ4A 2WSEE 2DZCA 1HJDA 4DBHA 2YWWA 3DB4A 4MZMA 2V8KA 1YITA 4RTVA 4BI8B 3QKJA 3MJXA 4PNOA 3M57A 1NG2A 1UHFA 2E5KA 5CQYA 3M0QA 1VQNQ 1M8VA 1R0BG 3MEAA 1B3QA 4PLIA 3EG9B 1WHGA 4DEYA 1G2BA 2FPEA 1Q86C 2LX7A 4X9CA 3M0SA 2CZ1B 2DVEA 3I9QA 2IVWA 3A98A 1WHHA 3ZBDA 1QCOA 3G4SQ 3JCMJ 1TXQA 4RUGA 2DXTA 2O4XA 5EC7A 1TOVA 1W2BA 3X26B 2XDBA 5HK0A 1SRMA 2QGGA 2KAFA 4JS4A 2IIMA 2K5IA 4NL3A 3NTKA 3ZFJA 2QTVA 4M7AB 1Y96A 3RMQA 2X4XA 4E7LA 2GGRA 4FYYB 1R77A 2AKKA 3CCQT 4FW2A 3ME9A 1M1KU 1IO6A 2EKOA 5GAOn 1EFNA 2QA4Q 4XTYA 1M3BA 3VRZA 3OSSC 3L2VA 3BY7A 1O9SA 5C0MA 2CT3A 2YXYA 3BW1A 4CC2A 2QEXT 2RN8A 1KQSP 4OP0A 2DRMA 1WHKA 3QWYA 2CP5A 4M77B 5DLOA 4BACA 8AT1B 4UC4A 2EYQA 1JXMA 2CSIA 4LDWA 2OTJQ 1YHQQ 2KI7A 1UTIA 1OZ3A 1WXTA 3JCMV 4O5VA 3M58A 1LJOA 1FYNA 1N9SA 4RG2A 1M4ZA 3QBYA 1OX8A 1IHVA 4M7AD 2JJ9A 2R58A 5GAN4 2Y4YA 3JB9I 4Z8AA 2GTOA 1QKXA 5GAN2 3VV0A 2FL7A 3O5ZA 1PKTA 5CKBA 1U8RA 4J6WA 1QKWA 3EH1A 4PJLA 3MKDA 3M5AA 4PJOD 4Z89A 2QQRA 3SFMA 4IUVA 3CCUQ 2E70A 1WA7A 2E5QA 2JUFA 5FWBA 2DL7A 3PIPA 2HBWA 1U1TA 1UJ0A 3SHWA 5LJ5h 3S3MA 1UGVA 1K9AA 1NJIR 5HK3A 1VA7A 4F14A 2OTLA 3J81E 3UT1A 1NJIU 1G3SA 1TH7A 4M4ZA 1H3HA 5D7UA 4ZGEB 1YWOA 2DTHA 4M75G 3OW2P 4BDYA 5IH2A 2QK0A 1RUWA 2AZVA 2NUPB 1YITT 4M78A 1U3OA 2YHTA 4C92C 4ESRA 1YN8A 3AT1B 2OTLQ 3GBQA 3H8ZA 3BE3A 2D8HA 2LTOA 1I5OB 3JB9F 3JCMP 2PVGB 1D09B 4PFOA 6AT1B 1M30A 1BIAA 4A4FA 2KDSA 5M9OA 1K9MR 2J6KA 1QVFS 1UUEA 2EYWA 2OTLT 1VQMA 1VQLA 1G8XA 5J39A 2VGMA 4ANJA 2X4WA 3VS6A 2K3XA 1ZUUA 2COWA 4PFZA 2FRWA 1KSWA 2O01E 4D8KA 3HFNA 2DL4A 5GAMj 2V1QA 3THKA 3C94A 4BDZA 3HPWA 2FZKB 2I0NA 2KXDA 3HFOA 4XTXA 3FIFA 5A0GA 3M4GA 4QVDA 1PG5B 1TUGB 1KHIA 3H0FA 5IT9E 1M90R 2NUTB 2FPDA 4CI0C 5LJ3d 3INZA 3I56T 1WDXA 3CMEA 1ABOA 1UGRB 2RQVA 1Z9QA 2NUTA 2L3RA 1GXIE 4C0DB 3H0IA 4C8QF 2P0KA 3CCJT 2GF7A 3P8BB 3M0UA 4GBQA 4M75A 4MDXA 1OEBA 3EGXB 4EMKC 1YJ9Q 2DF6A 1Q7YR 1QP2A 4M7AG 1VQNT 5GAMd 4CC4B 3P8HA 2FB7A 2Z0WA 2FYKA 1Y7XA 3L1AA 2EQKA 2KR3A 4FYVB 4Y28E 4EIKA 4J7FA 3CMAT 1WHMA 2CP0A 4N4HA 4C5EA 1OU9A 1WFWA 2HMAA 2COZA 2ESWA 4MMKA 2KNBB 2R5MA 5GAOp 1GFCA 2M1HA 5LJ3e 1IGQA 2JOYA 1LCKA 3OS1A 1M1GA 2L0AA 1QWEA 4LN2A 3D7SB 2GQIA 1UHCA 2O4XB 1OU8A 2RPNA 2PNIA 2CP3A 2RH2A 1VQ5T 5LJ5j 5IXBA 2DNUA 2MWPA 1ZSGA 1KG1A 1YIJT 2K7AA 2VASA 2O31A 2DETA 2KY9A 4AFUC 3MP8A 5GMKh 2P4RA 1KD1R 3L2UA 1K8AR 2EAYA 2B8AA 3G4SA 4Y91A 3CCLT 5GMKj 2F2WA 4N0AC 5GMKm 1RAFB 3CC4T 1MUZA 1BI0A 1IB8A 3JV3A 2LJ3A 1IREB 3QJYA 2MCNA 1VQ8T 2V8IA 5KYXA 3M4YA 4OB3B 1H8KA 1TG0A 3I55T 4IUQA 3LH0A 2A3LA 2SEMA 3QSUA 1AZEA 2YRVA 2VVKA 4C8QA 3KXTA 1VQ7A 4OMLA 5CK9A 3E9GA 4M7AC 3NTIA 4M77D 1HK9A 2QA4A 3CCVA 3V8LA 4M78B 4ZTJA 4A4GA 5GAN6 2K5FA 1Y0MA 3L2ZA 5GANg 3H0HA 2E64A 2MK5A 1VQPT 3I55A 1M9SA 4LDUA 3M56A 2LP5A 4A4HA 1E6GA 3X25B 4HCKA 3G71T 2DBKA 4E7IA 2ZPBB 1VQMT 2VC8A 1PD1A 2PZ1A 1WQWA 2F69A 4WTOB 1DJ7B 3EGUA 4L6V5 4Z88A 1AWWA 1VQMQ 2CREA 1CKBA 1K8AC 1ZUYA 2V1RA 3LWIA 2RHZA 2HCKA 3OYBA 1VQPA 1PCXA 1YITQ 4K11A 4ME7A 2KRMA 1RAEB 3DKMA 2XHCA 5CKFA 3C95A 4DQ2A 1IRXA 3MCAB 5CAIA 1VQ4Q 2DK3A 2COYA 3G71A 2F2VA 4HA8A 1N9RA 4C8QG 5I22A 1VQ5A 2JTMA 1G3WA 3OYAA 2ZPIB 4NL2A 2K3BA 2RA2A 1VQ6A 3CCJA 3EHQA 1RL2A 2K2VA 4XK8E 4IIMA 4PJOF 3UPUA 1NEGA 2V8JA 2YSQA 1M2OA 3HP9A 4QQGA 1ZBXA 2VGNA 4XAXB 2CUBA 4BY6B 3CXCS 2LT1A 2NUZA 2EYXA 4FYXB 3X20B 4CRIA 4OB2B 3OYDA 1KQ1A 1S72T 3CMAA 2W0ZA 2HD0A 1NZ9A 1M1KR 5LJ5d 2PVDB 1NM7A 1JO8A 1VQLQ 3VYGA 3VKIA 2RQRA 1OOTA 2HNIA 3CCUA 3CCET 2AIRB 1XNIA 3I5RA 2EIFA 2DD5A 5CO7A 5KYYB 1T0JA 3OBYA 4JRIA 5HKCA 2KVQG 2XK0A 3E9FA 2VUBA 4RTWA 1BKBA 3CMET 1YCSB 1YHQA 1P92A 2WACA 1Z9ZA 2E41A 5A0DA 4JUVA 3OA6A 1G83A 1WIEA 4J6XA 4TVRA 1OYXA 1TWBA 2QYZA 1IZ6A 1PNJA 4D6WA 3EFSA 2LCSA 2RMOA 1BK2A 1ZUKA 1SF9A 3NMZC 1W70A 2LDMA 5FLXE 1WQ7A 3EGXA 3CCVQ 2LT4A 2R5AA 1WZOA 1X69A 5LJ5f 3EAEA 1GFDA 1Y71A 3G71Q 1SKUB 2M0OA 4KGXB 2D6FA 2G3RA 3OMGA 3L2WA 1KJWA 2QASA 4BD3A 3PE0A 2DXUA 4M77F 5GAMh 4ZN1A 2GBQA 4LD6A 2K2MA 4MMLA 3KBGA 4QW2A 2DL5A 2LNHB 2M51A 1VIEA 4L59A 5GMKl 2O2OA 3BFMA 2F1LA 2EQMA 2ROLA 4JJDA 1H92A 1C1AA 1PD0A 2YUQA 4PFPA 3M54A 4E7HA 1VQOT 3VS7A 4LXCA 3JCMb 3RESA 2FVUA 4C8QD 2YT6A 5LJ3h 3HL8A 1AWOA 4PJNA 2VXFA 3VS3A 2GNCA 3OYIA 2LNVA 3LYIA 4J5YA 2QA4T 1N5ZA 4IKFA 1TTHB 2JS0A 2YUPA 4DBQA 1Q7YU 3QO3A 4XU1A 3REAB 3I35A 2E65A 1YNZA 4JJNK 1M5Q1 3M9QA 5FW9A 1X6GA 2P0PA 1RAAB 4Q5WA 2OTJT 5GAOm 1B34A 4ORZA 1WYXA 3SWNB 4RTZA 2KT8A 5IAYA 1KIKA 2XU8A 3CCJQ 2LRQA 3OYEA 4P5NA 3RBBB 5GANf 1U5SA 4HT9A 1VQ8A 3EG9A 2CS7A 4HVVA 5KYWA 2VB6A 2MPXC 2JVVA 1OI1A 4C92B 3QHSA 3IQLA 3JCMg 4R55A 4PK4A 1W1FA 4DBRA 3E1SA 2GFUA 2XG8D 5L23A 1U1SA 2BZYA 4C8QB 1D1CA 3VS5A 3RKWA 3PIOA 2OTJA 3WVEB 4F04B 1JEGA 3V8KA 3R6NA 1ZQ1A 4BY6C 2G6FX 2EWNA 2XMFA 4M77G 1WPYA 1ARKA 4OMPA 2EJ9A 2D0NA 1YIJQ 1ZLMA 3QZ5B 2E1HA 4LNPA 5I2MA 1YI2T 3NTHA 4M78G 4N4GA 2J7IA 2JTFA 3JSCA 3MHXA 3FJ5A 3VJPA 1BBZA 1N27A 1JRIA 4GY5A 2GFAA 4QQDA 5GJWB 2ABLA 4J7IA 4JJBA 2EGCA 1K1ZA 2L89A 3MPUB 5CVIA 1E6HA 2PQWA 3QZ9B 1PM3A 3QUIA 4JDSA 2K3YA 3TSWA 2E6NA 1K73C 4FSSA 1VQKQ 2LMJA 1UE9A 2DA9A 2X35A 2RHUA 2FPFA 1I8FA 1BU1A 2M0YA 2DILA 3UDCA 2L8DA 1I5LA 5IN1A 5FRMA 2B86A 3TREA 4HT8A 2A28A 4HVUA 1X6OA 1VQKT 3FDRA 4PKCC 1MMDA 4RTTA 4WF2A 1ZA2B 4LUDA 1VYVA 2YDLA 2ROTA 1YHQT 2RHXA 4J8OA 3URGA 3JB9D 2EGEA 2BZ8A 2EKHA 3A8LB 2PUKB 3GPLA 1FXXA 2JN0A 1UFFA 1I1JA 2XD0A 3I56Q 4ZGJB 3EG1A 2VWFA 3OBWA 5IXFA 3JAME 5GAN5 4BUGA 1RAIB 1OX9A 3HTRA 2HSPA 3RERA 4PJJA 1T0HA 5J3BA 3UATA 1OPLA 4BI3A 3UF4A 1VQ6Q 3JCMX 1VYTA 3FEOA 3WXMB 4RTXA 1MNDA 4E7JA 1YI2Q 3I56A 1JXOA 1UG1A 3CXCA 4A54A 2DIQA 3VS2A 4N0AA 4RCBA 3MO8A 2EYYA 2RK1A 4AMCA 3HRSA 4M7DE 4C92E 2LJ1A 2DD4A 2XIDA 1S72Q 1Y07A 1VIFA 1FMKA 4LE9A 2K79A 1RADB 1KQSA 3CCMQ 3G6EA 2VXEA 2X3XD 1X43A 2BE7D 4A63B 1NPRA 4O6JA 2X4JA 3JCMh 2DXBA 4M7DF 5ECAA 2HKQB 5FRNA 3KFVA 3UWNA 1WI7A 1NPPA 3R6OA 3C0CA 3CCMA 1VQPQ 1Q95G 1WNLA 4MDWA 5KYWB 2KRSA 1KD1U 1C0MA 2ZZDA 4X9DA 1QP3A 1PSFA 1M3CA 4XU2A 1X27A 5J26A 3QJ6A 5GAMe 2RQUA 1H3ZA 1TS9A 2CZ6B 2ZGWA 3CCEQ 2MWOA 1I81A 1SG5A 2QQ9A 2FG0A 3CC7A 2NUPA 1WGSA 2FRYA 4EMGA 1T3SA 2KMTA 3V7RA 5KYUA 1Q86R 1V29B 3EFRA 1TU0B 1D1AA 1QVGS 1UECA 4OMOA 2XKOC 1Y96B 1RACB 2A36A 1ZA1B 2BKDN 4RG8A 2HQXA 2E12A 4QVCA 1V1CA 3S3OA 2E3HA 3NPFA 3PFSA 2JZ2A 2I2LA 1X2QA 2QQBA 5CKDA 2DL3A 1VQ7T 1X6BA 1YJ9T 3JCMf 4CC7A 2JMCA 4M75B 1U06A 1KQSS 4IIOA 1K9MU 2NYSA 1OZ2A 4YTLA 5LJ3g 1WX6A 1W4SA 4BI4A 3OW2S 2X4YA 4PJOG 4X34A 1E7OA 3UA6A 2QQSA 4XU3A 2DLPA 2CZ0B 2GTJA 4OF1A 1UGSB 5LJ3j 3JRZA 1YJWQ 4FL6A 1G3TA 2ZPHB 3VS1A 4IURA 3VS4A 3OYCA 1VUBA 5CCAA 3CPWA 4HCZA 2KROA 4NS5A 3GLXA 4PJOA 1XQHA 3FJPA 1QVFA 2D8JA 3PMTA 4GLMA 2YRCA 4E6RA 1AOJA 4XTZA 5IHKA 4EPCA 3JCMe 2C0TA 3DB3A 2L3PA 4GLKA 2BTTA 1AD5A 1VQKA 2NWMA 3FB9A 2ZAEA 4II1A 2DEUA 2CP6A 1VOMA 5KE2A 3VU3C 4J9IA 2EBPA 4DOVA 1K73R 2K9GA 3G7ZA 3J7AF 3CMEQ 3FRNA 3OYFA 1UGQB 2E10A 3QYHB 1VQ9T 1QCNA 4FT2A 2CYZB 4M78C 4RTYA 5KH6A 2OJ2A 3VUZA 4M7DC 2ZPGB 3X24B 1KK7A 2GCXA 4OMNA 1G5VA 1K9MC 1ZSZC 2K4YA 3ZEHA 2LX9A 2CH4W 1K0XA 1HD3A 1R0CB 1UDLA 1JJ2A 1V76A 1UGPB 3VS0A 1K73U 2KRNA 1MHNA 2ED0A 1SHGA 2EPDA 3A8GB 4KGVB 2DO3A 1YCYA 4F7UB 2DAQA 5AYFA 2CDTA 3CQTA 4E47A 2C0IA 1PHTA 1Q81U 3SWNA 4KRTA 1NLOC 3L2RA 1UJYA 5GAN8 1JB0E 3G6ET 3TQ7P 1XTDA 3LWHA 4C8QC 3QG1A 2R57A 2ZPEB 1YFNA 2K57A 5I2SA 2P84A 1Y57A 2DYIA 4PJOC 5GAMg 1HSQA 2A0FB 2EQIA 4ZTFA 1LPLA 3OSVA 1F1BB 3CCMT 1RAHB 1TUCA 4JRKA 3CBMA 3A1PA 4JZ3A 3I55Q 1KC8R 1O75A 4E7KA 4V2SA 3A8HB 2L2PA 1KC8U 4EMKA 3A8OB 4J9GA 4KULA 2ECZA 3EH2A 3JB9G 4F7UA 3DLMA 3RR6A 5CIUA 2QG9B 1ZSZB 3SEMA 1ZBJA 3HKSA 5FROA 5C6SA 1AHJB 1M2VB 2FEIA 5CKHA 2DERA 3ZL7C 5LL6S 4FYWB 1WXBA 2EW3A 4IUUA 4R0KA 5LJ5g 3CCVT 3O8VA 2GQVA 9ATCB 2RD1A 3G4ST 2F5KA 3V7SA 3OS2A 4FSXA 4OMMA 2ED1A 3CC4A 1YJ9A 4AT1B 4JLGA 2DMOA 1HXDA 3RNJA 5GANd 2A08A 3QYGB 4AFZC 1EZZB 2CH4A 5D6XA 1NYGA 1NE8A 1QVGA 4AFQC 1SRLA 4ATOA 1D0ZA 1H641 1VQ7Q 4RMOA 3SWNC 1QCFA 4RKUE 1FX7A 2OAUA 2FZGB 4ELYC 1VQ4T 1UB4A 4C92F 3ASKA 2KYMA 3TEEA 4B6MA 4NOYA 2X3WD 1RI9A 1YWPA 4M77A 4XTUA 3V8JA 4AG2C 1RAGB 2PVOB 3CPFA 1VQ6T 4ZGDB 2DJZA 4AFSC 2LQKA 3AHUA 4M78F 2XICA 3OB9A 1A0NB 1GCQA 3MEWA 5I21A 1WJRA 1D3BB 3JB9J 4QQ6A 4ZNXA 4OVAA 3QDRB 3M55A 2YUNA 2ZCFB 2HAXA 2RB6A 1D3BA 2D9TA 5GAN7 3OS0A 4LDYA 4M7DB 3S3NA 1VQ4A 2OI3A 2AKLA 2PUOB 1RLPC 3CCEA 3CCUT 4FCYA 2HBPA 2BIVA 1X75C 1KFZA 5FU6B 4A4EA 3TSZA 2DKGA 5CKEA 4M7AE 2QQAA 1NLPC 2J06A 1GBRA 2HZYA 1W6XA 1QLYA 3CPWS 2DL8A 4CC3A 4QT7A 5KYYA 4IUPA 1GRIA 3CCLA 3CC2Q 2QDLA 2C0OA 2E6ZA 2RHIA 2X51A 4M77E 1J3TA 4OB0B 2EYZA 2AZSA 2RNAA 2DPPB 2QEXQ 3EFOB 5D6YA 3M0TA 1RI0A 2KK4A 3T9NA 2JT4A 5GJVB 2QAZA 2QI2A 4HXJA 3CCRQ 5GAOr 3CCSQ 2LQWA 3EG3A 2RI2A 4C5IA 1KQ2A 3OYKA 2P4TA 2RJDA 4M75C 2YLBA 3OYYA 2XDPA 1IGUA 3LX7A 1JQQA 2LZ6B 4LD9K 3PT9A 3FLGA 1VQLT 1QVPA 2RJEA 2RJCA 1RLQC 3H9NA 2BE9B 1AEYA 1QW1A 1LVKA 2BZXA 4M7AA 2MAMA 2HSEB 1YIJA 3VYHB 1EX4A 2CUDA 2JS2A 1ZX6A 1BIBA 2A7YA 2RQTA 4E7ZA 4KBMB 1X01A 2BUDA 2DEQA 1VQOQ 4BE2A 3PNWC 1M3AA 1C6VX 1VQ9A 1M2VA 2AHJB 3CEYA 3L42A 1K76A 1PSEA 1MMAA 2WSFE 2HEQA 2RM4A 1Q82U 1M8MA 3M0PA 1XJWB 4JS5A 1VYUA 1YI2A 2Y90A 5L8RE 1VQOA 7AT1B 1MGQA 1I4K1 2LQNA 3FC3A 4Y92A 3Q1JA 1EIFA 3EG0A 1YJNQ 3OYLA 4X1VA 2A37A 1I0CA 1MMNA 3M53A 2M9UA 4AG1C 2JXBA 3CC7Q 2KEAA 1OV3A 1AZGB 3OMCA 1IXDA 2H3EB 2JNGA 3P8DA 4C92G 3LLRA 2QXFA 4J83A 4RCCA 2QGFB 2ZPFB 4OMQA 4XTVA 5AT1B 4ELZC 3OYGA 2JTEA 4J9BA 1YBYA 4XU0A 5GMKi 3CCSA 3GNFB 1K4US 2KT1A 2VKNA 3RKXA 5FU7C 3PTAA 5IHNA 2CGHA 2ENMA 4J6YA 1N6AA 3QPHA 2CP2A 4M75F 3A8MB 2CKKA 2YRDA 5HY6A 2DX1A 2HQEA 3UA7A 4DOWA 1WHJA 1NYFA 2KSSA 1M1KC 3LH5A 1LOJA 2KYBA 4JPBW 2YUOA 1GCPA 2DM1A 3H6ZA 3C12A 1M1FA 3CCLQ 4M7DA 3HSBA 3PMIA 1MNEA 3CCST 3I5SA 1JBMA 4F7UE 3WVDB 4BB7A 2RI3A 3JCMW 2DTOA 2MIOA 1N8RU 3VUBA 3CXCP 1QVGP 3TU4K 3HRTA 1AWJA 4LDXA 4PL6A 2EQUA 2FHDA 2MMPA 4Z02A 3N5BB 2J05A 1TUDA 4B9XA 3CCRA 2LCLA 1PRMC 3OY9A 5I11A 3CC4Q 2PTKA 1SPKA 1QWFA 4M7DD 4HCCA 3J80E 3E2UA 5CR2A 3V7CA 4A53A 1M27C 4PJMA 2QTXA 4HKEA 2XDDA 4FU6A 3CD6Q 3S6WA 3JCMQ 2EFIA 1Q86U 3CBPA 2DXCA 4C5HA 2V26A 2EJFA 2F2XA 4C0ZA 3M0RA 5HCKA 1WXUA 4KGZB 1RABB 2MYSA 2L3QA 3SB2A 3RKYA 2DYBA 1BI2A 4M7DG 1YJWA 1OULA 1Q81C 1Q7YC 2C06A 4LUEA 4D8DA 4MZTA 4C0FA 2MOXA 4BE1A 3GOXA 5LJ3f 3RMSA 2ATCB 2KQWA 1FMVA 1VQ8Q 5A0LA 5GAOl 1M90C 2FZCB 5KYNA
chains in the Genus database with same CATH topology
4F16A 4Z89A 2O88A 2DL5A 2LNHB 3EHRA 1WA7A 3QWXX 5FWBA 2M51A 2DL7A 2HBWA 1UJ0A 1Y57A 3SHWA 2O2OA 2ROLA 4JJDA 4J9DA 1HSQA 1H92A 2EQIA 2EVRA 1UGVA 1I07A 2J6OA 1K9AA 2YUQA 1VA7A 1TUCA 3VS7A 4F14A 2YT6A 4RTUA 1AWOA 4JZ3A 2DRKA 3VS3A 4M4ZA 2GNCA 1H3HA 2EGAA 1YWOA 5IH2A 1SHFA 2L2PA 1RUWA 1N5ZA 2AZVA 3REBB 2JS0A 4J9GA 2ECZA 2YUPA 2KE9A 1U3OA 3REAB 3I35A 1GL5A 1PKSA 4ESRA 1YNZA 1YN8A 3SEMA 1ZBJA 3GBQA 5FW9A 1X6GA 2D8HA 3TVTA 2FEIA 3ZL7C 4ORZA 1WXBA 1M30A 2EW3A 1WYXA 4R0KA 3U23A 2W10A 4RTZA 2KT8A 2DBMA 2HDAA 2J6KA 1KIKA 2KXCA 1UUEA 2EYWA 2DJQA 1MV0B 4OMMA 2ED1A 3RBBB 3VS6A 1U5SA 1ZUUA 2FRWA 1KSWA 2DMOA 3RNJA 4HVVA 4D8KA 2DL4A 2D1XA 3IQLA 2A08A 2V1QA 3THKA 1W1FA 4AFZC 2CH4A 1NYGA 1X2KA 4HVWA 2I0NA 2KXDA 4AFQC 5L23A 1SRLA 2BZYA 3VS5A 1CSKA 1JEGA 3R6NA 1QCFA 3H0FA 2G6FX 1NEBA 2XMFA 2FPDA 1ARKA 1GCQC 4OMPA 1WDXA 2D0NA 2KYMA 1ZLMA 4LNPA 1ABOA 4F17A 2X3WD 2RQVA 1Z9QA 1RI9A 1YWPA 4AG2C 2RQWA 2J7IA 3H0IA 3PVLA 4AFSC 3FJ5A 3M0UA 4GBQA 1BBZA 1OEBA 1A0NB 1GCQA 2DF6A 5GJWB 2ABLA 4JJBA 2EGCA 2JW4A 4CC4B 1K1ZA 4ZNXA 2K6DA 2YUNA 2KR3A 1E6HA 2J6FA 4EIKA 1GBQA 3TSWA 2CSQA 4J9EA 1AVZC 3NHNA 2OI3A 2AKLA 1WFWA 4FSSA 2LMJA 1RLPC 2ESWA 1UE9A 2DA9A 3VRYA 2FPFA 1BU1A 2KNBB 2M0YA 1GFCA 1KFZA 2DILA 2O9VA 3TSZA 1LCKA 1MV3A 2L0AA 2B86A 1NLPC 1QWEA 1WLPB 2J06A 2A28A 4HVUA 1GBRA 4LN2A 1W6XA 1QLYA 2GQIA 2DL8A 1UHCA 4CC3A 4QT7A 2RPNA 4RTTA 1GRIA 2DVJA 2PNIA 4LUDA 1VYVA 1K0SA 2YDLA 2QDLA 2ROTA 2C0OA 2OAWA 1T3LA 2EGEA 2FO0A 2BZ8A 2EKHA 2JM9A 1J3TA 1BB9A 5IXBA 2DNUA 3ULRB 1UFFA 1ZSGA 2EYZA 1I1JA 2K7AA 2AZSA 3EG1A 2VWFA 5IXFA 3EG2A 2AK5A 2RNAA 2JMAA 1AWXA 2HSPA 1T0HA 3M0TA 3UATA 4J9FA 1OPLA 2JT4A 5GJVB 3UF4A 4HXJA 2O31A 1SEMA 2CT4A 4WCIA 2LQWA 3EG3A 1VYTA 4RTXA 4AFUC 2P4RA 1JQQA 2LZ6B 1JXOA 1UG1A 2L3SA 2F2WA 3VS2A 1RLQC 1AEYA 1MUZA 3JV3A 2LJ3A 2EYYA 2MCNA 2BZXA 2LJ1A 1H8KA 1TG0A 2KGTA 2CUDA 2JS2A 2RF0A 1ZX6A 1FMKA 2RQTA 2K79A 2SEMA 4LE9A 1AZEA 2VVKA 1M3AA 2X3XD 1X43A 4A63B 4OMLA 2H8HA 1K76A 4KRTA 1YP5A 2HEQA 1M8MA 2O9SA 5ECAA 5IHIA 1S1NA 3M0PA 3KFVA 1Y0MA 2JM8A 1VYUA 3H0HA 1WI7A 3C0CA 1SSHA 2LQNA 2KRSA 1XOVA 4Y92A 4JJCA 3EG0A 2DE0X 4X1VA 2A37A 1I0CA 2LP5A 1E6GA 4AG1C 2JXBA 3H41A 1M3CA 2KEAA 1OV3A 4HCKA 1AZGB 1X27A 2DBKA 2RQUA 1PWTA 2SRCA 2PZ1A 4OMQA 4DEXA 2JTEA 4J9BA 2FG0A 4J9HA 2FRYA 3PVQA 3EGUA 1T3SA 4Z88A 1AWWA 1K4US 2CREA 2KT1A 1CKAA 1CKBA 2VKNA 1ZUYA 2V1RA 5IHNA 2ENMA 1ABQA 1UECA 2HCKA 4OMOA 3NGPA 1B07A 2A36A 2LJ0A 4K11A 2KRMA 2KBTA 1V1CA 2DX1A 5FWCA 3UA7A 1OPKA 3NPFA 1PRLC 4J9CA 1JU5C 4JZ4A 1HJDA 1NYFA 1X2QA 3LH5A 2F2VA 4RTVA 5I22A 2DL3A 1X6BA 2KYBA 4JPBW 2YUOA 1GCPA 2DM1A 2JMCA 4CC7A 1NG2A 1UHFA 2E5KA 3M0QA 2K3BA 1B3QA 1U06A 3EHQA 4IIOA 4IIMA 4DEYA 1G2BA 2FPEA 3I5SA 2LX7A 1NEGA 2YSQA 1WX6A 3M0SA 3I9QA 3A98A 2MIOA 1E7OA 3UA6A 2CUBA 1AWJA 2DLPA 2GTJA 4RUGA 2NUZA 5EC7A 2EYXA 2J05A 1TUDA 3VS1A 3VS4A 1SRMA 2W0ZA 1PRMC 2KROA 2IIMA 1NM7A 1JO8A 5I11A 2D8JA 2RQRA 1OOTA 2PTKA 4GLMA 1SPKA 1QWFA 3I5RA 4E6RA 1AOJA 5IHKA 2C0TA 1T0JA 2GGRA 2L3PA 2AKKA 2BTTA 1IO6A 1AD5A 1M27C 1EFNA 2NWMA 1M3BA 3VRZA 4J9IA 4RTWA 2EBPA 2K9GA 1YCSB 1Z9ZA 2CT3A 4CC2A 2RN8A 4RTYA 2F2XA 3M0RA 5HCKA 1G83A 1WXUA 2DRMA 2OJ2A 3QWYA 1WIEA 4OMNA 1PNJA 1JXMA 2CSIA 2RMOA 2L3QA 2CH4W 2DYBA 2LCSA 1HD3A 1K0XA 1BK2A 1UDLA 1UTIA 1WXTA 1ZUKA 3NMZC 1W70A 3VS0A 2KRNA 1FYNA 2ED0A 1SHGA 1X69A 2EPDA 1GFDA 4LUEA 4D8DA 2MOXA 1KJWA 4Z8AA 2GTOA 3PE0A 1QKXA 2CDTA 3CQTA 3O5ZA 1PKTA 1QKWA 2C0IA 1PHTA 2GBQA 2K2MA 1NLOC 1UJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F16 A;  4Z89 A;  2O88 A;  2DL5 A;  2LNH B;  3EHR A;  1WA7 A;  3QWX X;  5FWB A;  2M51 A;  2DL7 A;  2HBW A;  1UJ0 A;  1Y57 A;  3SHW A;  2O2O A;  2ROL A;  4JJD A;  4J9D A;  1HSQ A;  1H92 A;  2EQI A;  2EVR A;  1UGV A;  1I07 A;  2J6O A;  1K9A A;  2YUQ A;  1VA7 A;  1TUC A;  3VS7 A;  4F14 A;  2YT6 A;  4RTU A;  1AWO A;  4JZ3 A;  2DRK A;  3VS3 A;  4M4Z A;  2GNC A;  1H3H A;  2EGA A;  1YWO A;  5IH2 A;  1SHF A;  2L2P A;  1RUW A;  1N5Z A;  2AZV A;  3REB B;  2JS0 A;  4J9G A;  2ECZ A;  2YUP A;  2KE9 A;  1U3O A;  3REA B;  3I35 A;  1GL5 A;  1PKS A;  4ESR A;  1YNZ A;  1YN8 A;  3SEM A;  1ZBJ A;  3GBQ A;  5FW9 A;  1X6G A;  2D8H A;  3TVT A;  2FEI A;  3ZL7 C;  4ORZ A;  1WXB A;  1M30 A;  2EW3 A;  1WYX A;  4R0K A;  3U23 A;  2W10 A;  4RTZ A;  2KT8 A;  2DBM A;  2HDA A;  2J6K A;  1KIK A;  2KXC A;  1UUE A;  2EYW A;  2DJQ A;  1MV0 B;  4OMM A;  2ED1 A;  3RBB B;  3VS6 A;  1U5S A;  1ZUU A;  2FRW A;  1KSW A;  2DMO A;  3RNJ A;  4HVV A;  4D8K A;  2DL4 A;  2D1X A;  3IQL A;  2A08 A;  2V1Q A;  3THK A;  1W1F A;  4AFZ C;  2CH4 A;  1NYG A;  1X2K A;  4HVW A;  2I0N A;  2KXD A;  4AFQ C;  5L23 A;  1SRL A;  2BZY A;  3VS5 A;  1CSK A;  1JEG A;  3R6N A;  1QCF A;  3H0F A;  2G6F X;  1NEB A;  2XMF A;  2FPD A;  1ARK A;  1GCQ C;  4OMP A;  1WDX A;  2D0N A;  2KYM A;  1ZLM A;  4LNP A;  1ABO A;  4F17 A;  2X3W D;  2RQV A;  1Z9Q A;  1RI9 A;  1YWP A;  4AG2 C;  2RQW A;  2J7I A;  3H0I A;  3PVL A;  4AFS C;  3FJ5 A;  3M0U A;  4GBQ A;  1BBZ A;  1OEB A;  1A0N B;  1GCQ A;  2DF6 A;  5GJW B;  2ABL A;  4JJB A;  2EGC A;  2JW4 A;  4CC4 B;  1K1Z A;  4ZNX A;  2K6D A;  2YUN A;  2KR3 A;  1E6H A;  2J6F A;  4EIK A;  1GBQ A;  3TSW A;  2CSQ A;  4J9E A;  1AVZ C;  3NHN A;  2OI3 A;  2AKL A;  1WFW A;  4FSS A;  2LMJ A;  1RLP C;  2ESW A;  1UE9 A;  2DA9 A;  3VRY A;  2FPF A;  1BU1 A;  2KNB B;  2M0Y A;  1GFC A;  1KFZ A;  2DIL A;  2O9V A;  3TSZ A;  1LCK A;  1MV3 A;  2L0A A;  2B86 A;  1NLP C;  1QWE A;  1WLP B;  2J06 A;  2A28 A;  4HVU A;  1GBR A;  4LN2 A;  1W6X A;  1QLY A;  2GQI A;  2DL8 A;  1UHC A;  4CC3 A;  4QT7 A;  2RPN A;  4RTT A;  1GRI A;  2DVJ A;  2PNI A;  4LUD A;  1VYV A;  1K0S A;  2YDL A;  2QDL A;  2ROT A;  2C0O A;  2OAW A;  1T3L A;  2EGE A;  2FO0 A;  2BZ8 A;  2EKH A;  2JM9 A;  1J3T A;  1BB9 A;  5IXB A;  2DNU A;  3ULR B;  1UFF A;  1ZSG A;  2EYZ A;  1I1J A;  2K7A A;  2AZS A;  3EG1 A;  2VWF A;  5IXF A;  3EG2 A;  2AK5 A;  2RNA A;  2JMA A;  1AWX A;  2HSP A;  1T0H A;  3M0T A;  3UAT A;  4J9F A;  1OPL A;  2JT4 A;  5GJV B;  3UF4 A;  4HXJ A;  2O31 A;  1SEM A;  2CT4 A;  4WCI A;  2LQW A;  3EG3 A;  1VYT A;  4RTX A;  4AFU C;  2P4R A;  1JQQ A;  2LZ6 B;  1JXO A;  1UG1 A;  2L3S A;  2F2W A;  3VS2 A;  1RLQ C;  1AEY A;  1MUZ A;  3JV3 A;  2LJ3 A;  2EYY A;  2MCN A;  2BZX A;  2LJ1 A;  1H8K A;  1TG0 A;  2KGT A;  2CUD A;  2JS2 A;  2RF0 A;  1ZX6 A;  1FMK A;  2RQT A;  2K79 A;  2SEM A;  4LE9 A;  1AZE A;  2VVK A;  1M3A A;  2X3X D;  1X43 A;  4A63 B;  4OML A;  2H8H A;  1K76 A;  4KRT A;  1YP5 A;  2HEQ A;  1M8M A;  2O9S A;  5ECA A;  5IHI A;  1S1N A;  3M0P A;  3KFV A;  1Y0M A;  2JM8 A;  1VYU A;  3H0H A;  1WI7 A;  3C0C A;  1SSH A;  2LQN A;  2KRS A;  1XOV A;  4Y92 A;  4JJC A;  3EG0 A;  2DE0 X;  4X1V A;  2A37 A;  1I0C A;  2LP5 A;  1E6G A;  4AG1 C;  2JXB A;  3H41 A;  1M3C A;  2KEA A;  1OV3 A;  4HCK A;  1AZG B;  1X27 A;  2DBK A;  2RQU A;  1PWT A;  2SRC A;  2PZ1 A;  4OMQ A;  4DEX A;  2JTE A;  4J9B A;  2FG0 A;  4J9H A;  2FRY A;  3PVQ A;  3EGU A;  1T3S A;  4Z88 A;  1AWW A;  1K4U S;  2CRE A;  2KT1 A;  1CKA A;  1CKB A;  2VKN A;  1ZUY A;  2V1R A;  5IHN A;  2ENM A;  1ABQ A;  1UEC A;  2HCK A;  4OMO A;  3NGP A;  1B07 A;  2A36 A;  2LJ0 A;  4K11 A;  2KRM A;  2KBT A;  1V1C A;  2DX1 A;  5FWC A;  3UA7 A;  1OPK A;  3NPF A;  1PRL C;  4J9C A;  1JU5 C;  4JZ4 A;  1HJD A;  1NYF A;  1X2Q A;  3LH5 A;  2F2V A;  4RTV A;  5I22 A;  2DL3 A;  1X6B A;  2KYB A;  4JPB W;  2YUO A;  1GCP A;  2DM1 A;  2JMC A;  4CC7 A;  1NG2 A;  1UHF A;  2E5K A;  3M0Q A;  2K3B A;  1B3Q A;  1U06 A;  3EHQ A;  4IIO A;  4IIM A;  4DEY A;  1G2B A;  2FPE A;  3I5S A;  2LX7 A;  1NEG A;  2YSQ A;  1WX6 A;  3M0S A;  3I9Q A;  3A98 A;  2MIO A;  1E7O A;  3UA6 A;  2CUB A;  1AWJ A;  2DLP A;  2GTJ A;  4RUG A;  2NUZ A;  5EC7 A;  2EYX A;  2J05 A;  1TUD A;  3VS1 A;  3VS4 A;  1SRM A;  2W0Z A;  1PRM C;  2KRO A;  2IIM A;  1NM7 A;  1JO8 A;  5I11 A;  2D8J A;  2RQR A;  1OOT A;  2PTK A;  4GLM A;  1SPK A;  1QWF A;  3I5R A;  4E6R A;  1AOJ A;  5IHK A;  2C0T A;  1T0J A;  2GGR A;  2L3P A;  2AKK A;  2BTT A;  1IO6 A;  1AD5 A;  1M27 C;  1EFN A;  2NWM A;  1M3B A;  3VRZ A;  4J9I A;  4RTW A;  2EBP A;  2K9G A;  1YCS B;  1Z9Z A;  2CT3 A;  4CC2 A;  2RN8 A;  4RTY A;  2F2X A;  3M0R A;  5HCK A;  1G83 A;  1WXU A;  2DRM A;  2OJ2 A;  3QWY A;  1WIE A;  4OMN A;  1PNJ A;  1JXM A;  2CSI A;  2RMO A;  2L3Q A;  2CH4 W;  2DYB A;  2LCS A;  1HD3 A;  1K0X A;  1BK2 A;  1UDL A;  1UTI A;  1WXT A;  1ZUK A;  3NMZ C;  1W70 A;  3VS0 A;  2KRN A;  1FYN A;  2ED0 A;  1SHG A;  1X69 A;  2EPD A;  1GFD A;  4LUE A;  4D8D A;  2MOX A;  1KJW A;  4Z8A A;  2GTO A;  3PE0 A;  1QKX A;  2CDT A;  3CQT A;  3O5Z A;  1PKT A;  1QKW A;  2C0I A;  1PHT A;  2GBQ A;  2K2M A;  1NLO C;  1UJY A; 
#chains in the Genus database with same CATH topology
 5KYU B;  4F16 A;  1BI3 A;  4M78 D;  4E7S A;  3E19 A;  2AT1 B;  2O88 A;  3EHR A;  3QWX X;  2MF2 A;  1TSF A;  3CC2 T;  3CMA Q;  4M78 E;  3QII A;  3QDF A;  4J9D A;  3MEV A;  2EVR A;  1I07 A;  4KH0 B;  3A5Z B;  2J6O A;  3OYM A;  2K5L A;  1FMW A;  3DLL A;  2EQJ A;  4RTU A;  5EG2 A;  1JJ2 P;  2MI6 A;  2DRK A;  3MP6 A;  2EGA A;  5FU6 C;  2M02 A;  1B34 B;  1W2B S;  1SHF A;  1R8O B;  2HQH A;  3REB B;  3BDL A;  1YJN T;  2KE9 A;  1GL5 A;  1PKS A;  1VQ5 Q;  2IPO B;  3GNG A;  1LNX A;  5FU7 B;  2VV5 A;  3SDZ A;  4C8Q E;  1Q81 R;  3TVT A;  3BDU A;  3EFO A;  2WSC E;  4L5G A;  3CCQ A;  1ZSZ A;  3ER0 A;  1BCM A;  5DY9 A;  3U23 A;  4BE0 A;  1FWZ A;  2W10 A;  5KE3 A;  4FIB A;  3JCM d;  5GAO q;  2DBM A;  2HDA A;  1WJQ A;  2KXC A;  2DJQ A;  4C92 D;  1MV0 B;  5D6W A;  1Q82 C;  2QDY B;  2E4H A;  3CPW P;  3CC7 T;  1NJI C;  3LGF A;  5A2Q E;  5GAN 3;  1NBE B;  1W2B P;  2D1X A;  4C5G A;  3M59 A;  4HCB A;  1X2K A;  4HVW A;  4FM4 B;  3OQ5 A;  4KUD K;  4EMK B;  3NFC A;  4M75 E;  1WHL A;  4M77 C;  2X9H A;  5KYX B;  1CSK A;  4FT4 A;  5DLQ E;  3C4S A;  3RDV A;  5GAN j;  3LW5 E;  1NEB A;  2DZ9 A;  4C0G A;  1JJ2 S;  1GCQ C;  2HL5 C;  3F70 A;  1QMC A;  3G1J A;  4PLL A;  3OS5 A;  4F17 A;  3CD6 A;  2RQW A;  4DA4 A;  3PVL A;  3KUF A;  2PU9 B;  1N8R R;  1MMG A;  3OYJ A;  3GP8 A;  2L5Q A;  2LC4 A;  2JW4 A;  4C92 A;  4KH1 B;  1ACM B;  2K6D A;  4A4K A;  2J6F A;  1GBQ A;  1OQK A;  4MZP A;  1S72 A;  2CSQ A;  4J9E A;  3X28 B;  1IHW A;  1AVZ C;  3CCQ Q;  3NHN A;  1BYM A;  5CQX A;  5GAM f;  3VRY A;  1K8A U;  4KT0 E;  1BI1 A;  8ATC B;  4JRQ A;  2RI5 A;  2LVM A;  2O9V A;  3OYH A;  1MV3 A;  1WLP B;  1D0X A;  2RO0 A;  3OW2 A;  2RHY A;  4JLI A;  2DVJ A;  1D1B A;  1K0S A;  4QKU A;  2OAW A;  3JCM c;  1T3L A;  2FO0 A;  4OB1 B;  2F5T X;  2JM9 A;  2RJF A;  1BB9 A;  3ULR B;  4M75 D;  4N4I A;  1ZHI A;  3EG2 A;  2AK5 A;  2Y4X A;  2JMA A;  1B7T A;  1AWX A;  3QXE B;  3MEU A;  3TCJ A;  4E2F B;  1G3Y A;  1WJS A;  4J9F A;  2NLU A;  2EJG A;  5GAN e;  1SEM A;  1Q82 R;  2CT4 A;  4WCI A;  2E3I A;  4OMF B;  3PGG A;  1QQJ A;  2OX7 A;  2IG0 A;  2M16 A;  1UEB A;  3MP1 A;  1M90 U;  2L3S A;  4F7U G;  1HYO A;  1BCO A;  3CC2 A;  3GF5 A;  4LDV A;  1YJN A;  2KGT A;  2RK2 A;  2HL3 A;  2RF0 A;  2VYT A;  3L2Q A;  4R56 A;  4XQ3 A;  4B9W A;  1VQN A;  4C0D C;  4M7A F;  3HHT B;  2DTI A;  2LCC A;  4EMH A;  2H8H A;  5LJ5 e;  2QEX A;  5KCO A;  1YP5 A;  1AT1 B;  3EGD A;  3HRU A;  4DBF A;  3GIB A;  2O9S A;  5IHI A;  1S1N A;  3CCR T;  2DFU A;  3LGL A;  4XTW A;  4VUB A;  2JM8 A;  4PJO E;  4ZN3 A;  1YJW T;  3RIR A;  1SSH A;  3CBO A;  4EDU A;  1QVF P;  1XOV A;  2DIG A;  4JJC A;  2LQ8 A;  4FW1 A;  2YLC A;  5GAN h;  1KHC A;  2DE0 X;  3JB9 H;  4KUI A;  3H41 A;  3RUX A;  4IUT A;  1KD1 C;  1SSF A;  2P0Q A;  1PWT A;  5GMK e;  4JRP A;  1KC8 C;  1D0Y A;  2SRC A;  4QVZ A;  4F7U F;  4DEX A;  3SD4 A;  4J9H A;  1VQ9 Q;  2D0Q B;  3PVQ A;  4OGC A;  3G6E Q;  4OGE A;  1PC0 A;  1N8R C;  3EGD B;  1CKA A;  1ABQ A;  3MET A;  3CD6 T;  5KCH A;  2XI9 A;  2HKN A;  2CP7 A;  3NGP A;  1B07 A;  2LJ0 A;  3OYN A;  2CZ7 B;  2KBT A;  5FWC A;  4PJO B;  1OPK A;  1PRL C;  4J9C A;  1JU5 C;  2H3J A;  5DM7 R;  4JZ4 A;  2WSE E;  2DZC A;  1HJD A;  4DBH A;  2YWW A;  3DB4 A;  4MZM A;  2V8K A;  1YIT A;  4RTV A;  4BI8 B;  3QKJ A;  3MJX A;  4PNO A;  3M57 A;  1NG2 A;  1UHF A;  2E5K A;  5CQY A;  3M0Q A;  1VQN Q;  1M8V A;  1R0B G;  3MEA A;  1B3Q A;  4PLI A;  3EG9 B;  1WHG A;  4DEY A;  1G2B A;  2FPE A;  1Q86 C;  2LX7 A;  4X9C A;  3M0S A;  2CZ1 B;  2DVE A;  3I9Q A;  2IVW A;  3A98 A;  1WHH A;  3ZBD A;  1QCO A;  3G4S Q;  3JCM J;  1TXQ A;  4RUG A;  2DXT A;  2O4X A;  5EC7 A;  1TOV A;  1W2B A;  3X26 B;  2XDB A;  5HK0 A;  1SRM A;  2QGG A;  2KAF A;  4JS4 A;  2IIM A;  2K5I A;  4NL3 A;  3NTK A;  3ZFJ A;  2QTV A;  4M7A B;  1Y96 A;  3RMQ A;  2X4X A;  4E7L A;  2GGR A;  4FYY B;  1R77 A;  2AKK A;  3CCQ T;  4FW2 A;  3ME9 A;  1M1K U;  1IO6 A;  2EKO A;  5GAO n;  1EFN A;  2QA4 Q;  4XTY A;  1M3B A;  3VRZ A;  3OSS C;  3L2V A;  3BY7 A;  1O9S A;  5C0M A;  2CT3 A;  2YXY A;  3BW1 A;  4CC2 A;  2QEX T;  2RN8 A;  1KQS P;  4OP0 A;  2DRM A;  1WHK A;  3QWY A;  2CP5 A;  4M77 B;  5DLO A;  4BAC A;  8AT1 B;  4UC4 A;  2EYQ A;  1JXM A;  2CSI A;  4LDW A;  2OTJ Q;  1YHQ Q;  2KI7 A;  1UTI A;  1OZ3 A;  1WXT A;  3JCM V;  4O5V A;  3M58 A;  1LJO A;  1FYN A;  1N9S A;  4RG2 A;  1M4Z A;  3QBY A;  1OX8 A;  1IHV A;  4M7A D;  2JJ9 A;  2R58 A;  5GAN 4;  2Y4Y A;  3JB9 I;  4Z8A A;  2GTO A;  1QKX A;  5GAN 2;  3VV0 A;  2FL7 A;  3O5Z A;  1PKT A;  5CKB A;  1U8R A;  4J6W A;  1QKW A;  3EH1 A;  4PJL A;  3MKD A;  3M5A A;  4PJO D;  4Z89 A;  2QQR A;  3SFM A;  4IUV A;  3CCU Q;  2E70 A;  1WA7 A;  2E5Q A;  2JUF A;  5FWB A;  2DL7 A;  3PIP A;  2HBW A;  1U1T A;  1UJ0 A;  3SHW A;  5LJ5 h;  3S3M A;  1UGV A;  1K9A A;  1NJI R;  5HK3 A;  1VA7 A;  4F14 A;  2OTL A;  3J81 E;  3UT1 A;  1NJI U;  1G3S A;  1TH7 A;  4M4Z A;  1H3H A;  5D7U A;  4ZGE B;  1YWO A;  2DTH A;  4M75 G;  3OW2 P;  4BDY A;  5IH2 A;  2QK0 A;  1RUW A;  2AZV A;  2NUP B;  1YIT T;  4M78 A;  1U3O A;  2YHT A;  4C92 C;  4ESR A;  1YN8 A;  3AT1 B;  2OTL Q;  3GBQ A;  3H8Z A;  3BE3 A;  2D8H A;  2LTO A;  1I5O B;  3JB9 F;  3JCM P;  2PVG B;  1D09 B;  4PFO A;  6AT1 B;  1M30 A;  1BIA A;  4A4F A;  2KDS A;  5M9O A;  1K9M R;  2J6K A;  1QVF S;  1UUE A;  2EYW A;  2OTL T;  1VQM A;  1VQL A;  1G8X A;  5J39 A;  2VGM A;  4ANJ A;  2X4W A;  3VS6 A;  2K3X A;  1ZUU A;  2COW A;  4PFZ A;  2FRW A;  1KSW A;  2O01 E;  4D8K A;  3HFN A;  2DL4 A;  5GAM j;  2V1Q A;  3THK A;  3C94 A;  4BDZ A;  3HPW A;  2FZK B;  2I0N A;  2KXD A;  3HFO A;  4XTX A;  3FIF A;  5A0G A;  3M4G A;  4QVD A;  1PG5 B;  1TUG B;  1KHI A;  3H0F A;  5IT9 E;  1M90 R;  2NUT B;  2FPD A;  4CI0 C;  5LJ3 d;  3INZ A;  3I56 T;  1WDX A;  3CME A;  1ABO A;  1UGR B;  2RQV A;  1Z9Q A;  2NUT A;  2L3R A;  1GXI E;  4C0D B;  3H0I A;  4C8Q F;  2P0K A;  3CCJ T;  2GF7 A;  3P8B B;  3M0U A;  4GBQ A;  4M75 A;  4MDX A;  1OEB A;  3EGX B;  4EMK C;  1YJ9 Q;  2DF6 A;  1Q7Y R;  1QP2 A;  4M7A G;  1VQN T;  5GAM d;  4CC4 B;  3P8H A;  2FB7 A;  2Z0W A;  2FYK A;  1Y7X A;  3L1A A;  2EQK A;  2KR3 A;  4FYV B;  4Y28 E;  4EIK A;  4J7F A;  3CMA T;  1WHM A;  2CP0 A;  4N4H A;  4C5E A;  1OU9 A;  1WFW A;  2HMA A;  2COZ A;  2ESW A;  4MMK A;  2KNB B;  2R5M A;  5GAO p;  1GFC A;  2M1H A;  5LJ3 e;  1IGQ A;  2JOY A;  1LCK A;  3OS1 A;  1M1G A;  2L0A A;  1QWE A;  4LN2 A;  3D7S B;  2GQI A;  1UHC A;  2O4X B;  1OU8 A;  2RPN A;  2PNI A;  2CP3 A;  2RH2 A;  1VQ5 T;  5LJ5 j;  5IXB A;  2DNU A;  2MWP A;  1ZSG A;  1KG1 A;  1YIJ T;  2K7A A;  2VAS A;  2O31 A;  2DET A;  2KY9 A;  4AFU C;  3MP8 A;  5GMK h;  2P4R A;  1KD1 R;  3L2U A;  1K8A R;  2EAY A;  2B8A A;  3G4S A;  4Y91 A;  3CCL T;  5GMK j;  2F2W A;  4N0A C;  5GMK m;  1RAF B;  3CC4 T;  1MUZ A;  1BI0 A;  1IB8 A;  3JV3 A;  2LJ3 A;  1IRE B;  3QJY A;  2MCN A;  1VQ8 T;  2V8I A;  5KYX A;  3M4Y A;  4OB3 B;  1H8K A;  1TG0 A;  3I55 T;  4IUQ A;  3LH0 A;  2A3L A;  2SEM A;  3QSU A;  1AZE A;  2YRV A;  2VVK A;  4C8Q A;  3KXT A;  1VQ7 A;  4OML A;  5CK9 A;  3E9G A;  4M7A C;  3NTI A;  4M77 D;  1HK9 A;  2QA4 A;  3CCV A;  3V8L A;  4M78 B;  4ZTJ A;  4A4G A;  5GAN 6;  2K5F A;  1Y0M A;  3L2Z A;  5GAN g;  3H0H A;  2E64 A;  2MK5 A;  1VQP T;  3I55 A;  1M9S A;  4LDU A;  3M56 A;  2LP5 A;  4A4H A;  1E6G A;  3X25 B;  4HCK A;  3G71 T;  2DBK A;  4E7I A;  2ZPB B;  1VQM T;  2VC8 A;  1PD1 A;  2PZ1 A;  1WQW A;  2F69 A;  4WTO B;  1DJ7 B;  3EGU A;  4L6V 5;  4Z88 A;  1AWW A;  1VQM Q;  2CRE A;  1CKB A;  1K8A C;  1ZUY A;  2V1R A;  3LWI A;  2RHZ A;  2HCK A;  3OYB A;  1VQP A;  1PCX A;  1YIT Q;  4K11 A;  4ME7 A;  2KRM A;  1RAE B;  3DKM A;  2XHC A;  5CKF A;  3C95 A;  4DQ2 A;  1IRX A;  3MCA B;  5CAI A;  1VQ4 Q;  2DK3 A;  2COY A;  3G71 A;  2F2V A;  4HA8 A;  1N9R A;  4C8Q G;  5I22 A;  1VQ5 A;  2JTM A;  1G3W A;  3OYA A;  2ZPI B;  4NL2 A;  2K3B A;  2RA2 A;  1VQ6 A;  3CCJ A;  3EHQ A;  1RL2 A;  2K2V A;  4XK8 E;  4IIM A;  4PJO F;  3UPU A;  1NEG A;  2V8J A;  2YSQ A;  1M2O A;  3HP9 A;  4QQG A;  1ZBX A;  2VGN A;  4XAX B;  2CUB A;  4BY6 B;  3CXC S;  2LT1 A;  2NUZ A;  2EYX A;  4FYX B;  3X20 B;  4CRI A;  4OB2 B;  3OYD A;  1KQ1 A;  1S72 T;  3CMA A;  2W0Z A;  2HD0 A;  1NZ9 A;  1M1K R;  5LJ5 d;  2PVD B;  1NM7 A;  1JO8 A;  1VQL Q;  3VYG A;  3VKI A;  2RQR A;  1OOT A;  2HNI A;  3CCU A;  3CCE T;  2AIR B;  1XNI A;  3I5R A;  2EIF A;  2DD5 A;  5CO7 A;  5KYY B;  1T0J A;  3OBY A;  4JRI A;  5HKC A;  2KVQ G;  2XK0 A;  3E9F A;  2VUB A;  4RTW A;  1BKB A;  3CME T;  1YCS B;  1YHQ A;  1P92 A;  2WAC A;  1Z9Z A;  2E41 A;  5A0D A;  4JUV A;  3OA6 A;  1G83 A;  1WIE A;  4J6X A;  4TVR A;  1OYX A;  1TWB A;  2QYZ A;  1IZ6 A;  1PNJ A;  4D6W A;  3EFS A;  2LCS A;  2RMO A;  1BK2 A;  1ZUK A;  1SF9 A;  3NMZ C;  1W70 A;  2LDM A;  5FLX E;  1WQ7 A;  3EGX A;  3CCV Q;  2LT4 A;  2R5A A;  1WZO A;  1X69 A;  5LJ5 f;  3EAE A;  1GFD A;  1Y71 A;  3G71 Q;  1SKU B;  2M0O A;  4KGX B;  2D6F A;  2G3R A;  3OMG A;  3L2W A;  1KJW A;  2QAS A;  4BD3 A;  3PE0 A;  2DXU A;  4M77 F;  5GAM h;  4ZN1 A;  2GBQ A;  4LD6 A;  2K2M A;  4MML A;  3KBG A;  4QW2 A;  2DL5 A;  2LNH B;  2M51 A;  1VIE A;  4L59 A;  5GMK l;  2O2O A;  3BFM A;  2F1L A;  2EQM A;  2ROL A;  4JJD A;  1H92 A;  1C1A A;  1PD0 A;  2YUQ A;  4PFP A;  3M54 A;  4E7H A;  1VQO T;  3VS7 A;  4LXC A;  3JCM b;  3RES A;  2FVU A;  4C8Q D;  2YT6 A;  5LJ3 h;  3HL8 A;  1AWO A;  4PJN A;  2VXF A;  3VS3 A;  2GNC A;  3OYI A;  2LNV A;  3LYI A;  4J5Y A;  2QA4 T;  1N5Z A;  4IKF A;  1TTH B;  2JS0 A;  2YUP A;  4DBQ A;  1Q7Y U;  3QO3 A;  4XU1 A;  3REA B;  3I35 A;  2E65 A;  1YNZ A;  4JJN K;  1M5Q 1;  3M9Q A;  5FW9 A;  1X6G A;  2P0P A;  1RAA B;  4Q5W A;  2OTJ T;  5GAO m;  1B34 A;  4ORZ A;  1WYX A;  3SWN B;  4RTZ A;  2KT8 A;  5IAY A;  1KIK A;  2XU8 A;  3CCJ Q;  2LRQ A;  3OYE A;  4P5N A;  3RBB B;  5GAN f;  1U5S A;  4HT9 A;  1VQ8 A;  3EG9 A;  2CS7 A;  4HVV A;  5KYW A;  2VB6 A;  2MPX C;  2JVV A;  1OI1 A;  4C92 B;  3QHS A;  3IQL A;  3JCM g;  4R55 A;  4PK4 A;  1W1F A;  4DBR A;  3E1S A;  2GFU A;  2XG8 D;  5L23 A;  1U1S A;  2BZY A;  4C8Q B;  1D1C A;  3VS5 A;  3RKW A;  3PIO A;  2OTJ A;  3WVE B;  4F04 B;  1JEG A;  3V8K A;  3R6N A;  1ZQ1 A;  4BY6 C;  2G6F X;  2EWN A;  2XMF A;  4M77 G;  1WPY A;  1ARK A;  4OMP A;  2EJ9 A;  2D0N A;  1YIJ Q;  1ZLM A;  3QZ5 B;  2E1H A;  4LNP A;  5I2M A;  1YI2 T;  3NTH A;  4M78 G;  4N4G A;  2J7I A;  2JTF A;  3JSC A;  3MHX A;  3FJ5 A;  3VJP A;  1BBZ A;  1N27 A;  1JRI A;  4GY5 A;  2GFA A;  4QQD A;  5GJW B;  2ABL A;  4J7I A;  4JJB A;  2EGC A;  1K1Z A;  2L89 A;  3MPU B;  5CVI A;  1E6H A;  2PQW A;  3QZ9 B;  1PM3 A;  3QUI A;  4JDS A;  2K3Y A;  3TSW A;  2E6N A;  1K73 C;  4FSS A;  1VQK Q;  2LMJ A;  1UE9 A;  2DA9 A;  2X35 A;  2RHU A;  2FPF A;  1I8F A;  1BU1 A;  2M0Y A;  2DIL A;  3UDC A;  2L8D A;  1I5L A;  5IN1 A;  5FRM A;  2B86 A;  3TRE A;  4HT8 A;  2A28 A;  4HVU A;  1X6O A;  1VQK T;  3FDR A;  4PKC C;  1MMD A;  4RTT A;  4WF2 A;  1ZA2 B;  4LUD A;  1VYV A;  2YDL A;  2ROT A;  1YHQ T;  2RHX A;  4J8O A;  3URG A;  3JB9 D;  2EGE A;  2BZ8 A;  2EKH A;  3A8L B;  2PUK B;  3GPL A;  1FXX A;  2JN0 A;  1UFF A;  1I1J A;  2XD0 A;  3I56 Q;  4ZGJ B;  3EG1 A;  2VWF A;  3OBW A;  5IXF A;  3JAM E;  5GAN 5;  4BUG A;  1RAI B;  1OX9 A;  3HTR A;  2HSP A;  3RER A;  4PJJ A;  1T0H A;  5J3B A;  3UAT A;  1OPL A;  4BI3 A;  3UF4 A;  1VQ6 Q;  3JCM X;  1VYT A;  3FEO A;  3WXM B;  4RTX A;  1MND A;  4E7J A;  1YI2 Q;  3I56 A;  1JXO A;  1UG1 A;  3CXC A;  4A54 A;  2DIQ A;  3VS2 A;  4N0A A;  4RCB A;  3MO8 A;  2EYY A;  2RK1 A;  4AMC A;  3HRS A;  4M7D E;  4C92 E;  2LJ1 A;  2DD4 A;  2XID A;  1S72 Q;  1Y07 A;  1VIF A;  1FMK A;  4LE9 A;  2K79 A;  1RAD B;  1KQS A;  3CCM Q;  3G6E A;  2VXE A;  2X3X D;  1X43 A;  2BE7 D;  4A63 B;  1NPR A;  4O6J A;  2X4J A;  3JCM h;  2DXB A;  4M7D F;  5ECA A;  2HKQ B;  5FRN A;  3KFV A;  3UWN A;  1WI7 A;  1NPP A;  3R6O A;  3C0C A;  3CCM A;  1VQP Q;  1Q95 G;  1WNL A;  4MDW A;  5KYW B;  2KRS A;  1KD1 U;  1C0M A;  2ZZD A;  4X9D A;  1QP3 A;  1PSF A;  1M3C A;  4XU2 A;  1X27 A;  5J26 A;  3QJ6 A;  5GAM e;  2RQU A;  1H3Z A;  1TS9 A;  2CZ6 B;  2ZGW A;  3CCE Q;  2MWO A;  1I81 A;  1SG5 A;  2QQ9 A;  2FG0 A;  3CC7 A;  2NUP A;  1WGS A;  2FRY A;  4EMG A;  1T3S A;  2KMT A;  3V7R A;  5KYU A;  1Q86 R;  1V29 B;  3EFR A;  1TU0 B;  1D1A A;  1QVG S;  1UEC A;  4OMO A;  2XKO C;  1Y96 B;  1RAC B;  2A36 A;  1ZA1 B;  2BKD N;  4RG8 A;  2HQX A;  2E12 A;  4QVC A;  1V1C A;  3S3O A;  2E3H A;  3NPF A;  3PFS A;  2JZ2 A;  2I2L A;  1X2Q A;  2QQB A;  5CKD A;  2DL3 A;  1VQ7 T;  1X6B A;  1YJ9 T;  3JCM f;  4CC7 A;  2JMC A;  4M75 B;  1U06 A;  1KQS S;  4IIO A;  1K9M U;  2NYS A;  1OZ2 A;  4YTL A;  5LJ3 g;  1WX6 A;  1W4S A;  4BI4 A;  3OW2 S;  2X4Y A;  4PJO G;  4X34 A;  1E7O A;  3UA6 A;  2QQS A;  4XU3 A;  2DLP A;  2CZ0 B;  2GTJ A;  4OF1 A;  1UGS B;  5LJ3 j;  3JRZ A;  1YJW Q;  4FL6 A;  1G3T A;  2ZPH B;  3VS1 A;  4IUR A;  3VS4 A;  3OYC A;  1VUB A;  5CCA A;  3CPW A;  4HCZ A;  2KRO A;  4NS5 A;  3GLX A;  4PJO A;  1XQH A;  3FJP A;  1QVF A;  2D8J A;  3PMT A;  4GLM A;  2YRC A;  4E6R A;  1AOJ A;  4XTZ A;  5IHK A;  4EPC A;  3JCM e;  2C0T A;  3DB3 A;  2L3P A;  4GLK A;  2BTT A;  1AD5 A;  1VQK A;  2NWM A;  3FB9 A;  2ZAE A;  4II1 A;  2DEU A;  2CP6 A;  1VOM A;  5KE2 A;  3VU3 C;  4J9I A;  2EBP A;  4DOV A;  1K73 R;  2K9G A;  3G7Z A;  3J7A F;  3CME Q;  3FRN A;  3OYF A;  1UGQ B;  2E10 A;  3QYH B;  1VQ9 T;  1QCN A;  4FT2 A;  2CYZ B;  4M78 C;  4RTY A;  5KH6 A;  2OJ2 A;  3VUZ A;  4M7D C;  2ZPG B;  3X24 B;  1KK7 A;  2GCX A;  4OMN A;  1G5V A;  1K9M C;  1ZSZ C;  2K4Y A;  3ZEH A;  2LX9 A;  2CH4 W;  1K0X A;  1HD3 A;  1R0C B;  1UDL A;  1JJ2 A;  1V76 A;  1UGP B;  3VS0 A;  1K73 U;  2KRN A;  1MHN A;  2ED0 A;  1SHG A;  2EPD A;  3A8G B;  4KGV B;  2DO3 A;  1YCY A;  4F7U B;  2DAQ A;  5AYF A;  2CDT A;  3CQT A;  4E47 A;  2C0I A;  1PHT A;  1Q81 U;  3SWN A;  4KRT A;  1NLO C;  3L2R A;  1UJY A;  5GAN 8;  1JB0 E;  3G6E T;  3TQ7 P;  1XTD A;  3LWH A;  4C8Q C;  3QG1 A;  2R57 A;  2ZPE B;  1YFN A;  2K57 A;  5I2S A;  2P84 A;  1Y57 A;  2DYI A;  4PJO C;  5GAM g;  1HSQ A;  2A0F B;  2EQI A;  4ZTF A;  1LPL A;  3OSV A;  1F1B B;  3CCM T;  1RAH B;  1TUC A;  4JRK A;  3CBM A;  3A1P A;  4JZ3 A;  3I55 Q;  1KC8 R;  1O75 A;  4E7K A;  4V2S A;  3A8H B;  2L2P A;  1KC8 U;  4EMK A;  3A8O B;  4J9G A;  4KUL A;  2ECZ A;  3EH2 A;  3JB9 G;  4F7U A;  3DLM A;  3RR6 A;  5CIU A;  2QG9 B;  1ZSZ B;  3SEM A;  1ZBJ A;  3HKS A;  5FRO A;  5C6S A;  1AHJ B;  1M2V B;  2FEI A;  5CKH A;  2DER A;  3ZL7 C;  5LL6 S;  4FYW B;  1WXB A;  2EW3 A;  4IUU A;  4R0K A;  5LJ5 g;  3CCV T;  3O8V A;  2GQV A;  9ATC B;  2RD1 A;  3G4S T;  2F5K A;  3V7S A;  3OS2 A;  4FSX A;  4OMM A;  2ED1 A;  3CC4 A;  1YJ9 A;  4AT1 B;  4JLG A;  2DMO A;  1HXD A;  3RNJ A;  5GAN d;  2A08 A;  3QYG B;  4AFZ C;  1EZZ B;  2CH4 A;  5D6X A;  1NYG A;  1NE8 A;  1QVG A;  4AFQ C;  1SRL A;  4ATO A;  1D0Z A;  1H64 1;  1VQ7 Q;  4RMO A;  3SWN C;  1QCF A;  4RKU E;  1FX7 A;  2OAU A;  2FZG B;  4ELY C;  1VQ4 T;  1UB4 A;  4C92 F;  3ASK A;  2KYM A;  3TEE A;  4B6M A;  4NOY A;  2X3W D;  1RI9 A;  1YWP A;  4M77 A;  4XTU A;  3V8J A;  4AG2 C;  1RAG B;  2PVO B;  3CPF A;  1VQ6 T;  4ZGD B;  2DJZ A;  4AFS C;  2LQK A;  3AHU A;  4M78 F;  2XIC A;  3OB9 A;  1A0N B;  1GCQ A;  3MEW A;  5I21 A;  1WJR A;  1D3B B;  3JB9 J;  4QQ6 A;  4ZNX A;  4OVA A;  3QDR B;  3M55 A;  2YUN A;  2ZCF B;  2HAX A;  2RB6 A;  1D3B A;  2D9T A;  5GAN 7;  3OS0 A;  4LDY A;  4M7D B;  3S3N A;  1VQ4 A;  2OI3 A;  2AKL A;  2PUO B;  1RLP C;  3CCE A;  3CCU T;  4FCY A;  2HBP A;  2BIV A;  1X75 C;  1KFZ A;  5FU6 B;  4A4E A;  3TSZ A;  2DKG A;  5CKE A;  4M7A E;  2QQA A;  1NLP C;  2J06 A;  1GBR A;  2HZY A;  1W6X A;  1QLY A;  3CPW S;  2DL8 A;  4CC3 A;  4QT7 A;  5KYY A;  4IUP A;  1GRI A;  3CCL A;  3CC2 Q;  2QDL A;  2C0O A;  2E6Z A;  2RHI A;  2X51 A;  4M77 E;  1J3T A;  4OB0 B;  2EYZ A;  2AZS A;  2RNA A;  2DPP B;  2QEX Q;  3EFO B;  5D6Y A;  3M0T A;  1RI0 A;  2KK4 A;  3T9N A;  2JT4 A;  5GJV B;  2QAZ A;  2QI2 A;  4HXJ A;  3CCR Q;  5GAO r;  3CCS Q;  2LQW A;  3EG3 A;  2RI2 A;  4C5I A;  1KQ2 A;  3OYK A;  2P4T A;  2RJD A;  4M75 C;  2YLB A;  3OYY A;  2XDP A;  1IGU A;  3LX7 A;  1JQQ A;  2LZ6 B;  4LD9 K;  3PT9 A;  3FLG A;  1VQL T;  1QVP A;  2RJE A;  2RJC A;  1RLQ C;  3H9N A;  2BE9 B;  1AEY A;  1QW1 A;  1LVK A;  2BZX A;  4M7A A;  2MAM A;  2HSE B;  1YIJ A;  3VYH B;  1EX4 A;  2CUD A;  2JS2 A;  1ZX6 A;  1BIB A;  2A7Y A;  2RQT A;  4E7Z A;  4KBM B;  1X01 A;  2BUD A;  2DEQ A;  1VQO Q;  4BE2 A;  3PNW C;  1M3A A;  1C6V X;  1VQ9 A;  1M2V A;  2AHJ B;  3CEY A;  3L42 A;  1K76 A;  1PSE A;  1MMA A;  2WSF E;  2HEQ A;  2RM4 A;  1Q82 U;  1M8M A;  3M0P A;  1XJW B;  4JS5 A;  1VYU A;  1YI2 A;  2Y90 A;  5L8R E;  1VQO A;  7AT1 B;  1MGQ A;  1I4K 1;  2LQN A;  3FC3 A;  4Y92 A;  3Q1J A;  1EIF A;  3EG0 A;  1YJN Q;  3OYL A;  4X1V A;  2A37 A;  1I0C A;  1MMN A;  3M53 A;  2M9U A;  4AG1 C;  2JXB A;  3CC7 Q;  2KEA A;  1OV3 A;  1AZG B;  3OMC A;  1IXD A;  2H3E B;  2JNG A;  3P8D A;  4C92 G;  3LLR A;  2QXF A;  4J83 A;  4RCC A;  2QGF B;  2ZPF B;  4OMQ A;  4XTV A;  5AT1 B;  4ELZ C;  3OYG A;  2JTE A;  4J9B A;  1YBY A;  4XU0 A;  5GMK i;  3CCS A;  3GNF B;  1K4U S;  2KT1 A;  2VKN A;  3RKX A;  5FU7 C;  3PTA A;  5IHN A;  2CGH A;  2ENM A;  4J6Y A;  1N6A A;  3QPH A;  2CP2 A;  4M75 F;  3A8M B;  2CKK A;  2YRD A;  5HY6 A;  2DX1 A;  2HQE A;  3UA7 A;  4DOW A;  1WHJ A;  1NYF A;  2KSS A;  1M1K C;  3LH5 A;  1LOJ A;  2KYB A;  4JPB W;  2YUO A;  1GCP A;  2DM1 A;  3H6Z A;  3C12 A;  1M1F A;  3CCL Q;  4M7D A;  3HSB A;  3PMI A;  1MNE A;  3CCS T;  3I5S A;  1JBM A;  4F7U E;  3WVD B;  4BB7 A;  2RI3 A;  3JCM W;  2DTO A;  2MIO A;  1N8R U;  3VUB A;  3CXC P;  1QVG P;  3TU4 K;  3HRT A;  1AWJ A;  4LDX A;  4PL6 A;  2EQU A;  2FHD A;  2MMP A;  4Z02 A;  3N5B B;  2J05 A;  1TUD A;  4B9X A;  3CCR A;  2LCL A;  1PRM C;  3OY9 A;  5I11 A;  3CC4 Q;  2PTK A;  1SPK A;  1QWF A;  4M7D D;  4HCC A;  3J80 E;  3E2U A;  5CR2 A;  3V7C A;  4A53 A;  1M27 C;  4PJM A;  2QTX A;  4HKE A;  2XDD A;  4FU6 A;  3CD6 Q;  3S6W A;  3JCM Q;  2EFI A;  1Q86 U;  3CBP A;  2DXC A;  4C5H A;  2V26 A;  2EJF A;  2F2X A;  4C0Z A;  3M0R A;  5HCK A;  1WXU A;  4KGZ B;  1RAB B;  2MYS A;  2L3Q A;  3SB2 A;  3RKY A;  2DYB A;  1BI2 A;  4M7D G;  1YJW A;  1OUL A;  1Q81 C;  1Q7Y C;  2C06 A;  4LUE A;  4D8D A;  4MZT A;  4C0F A;  2MOX A;  4BE1 A;  3GOX A;  5LJ3 f;  3RMS A;  2ATC B;  2KQW A;  1FMV A;  1VQ8 Q;  5A0L A;  5GAO l;  1M90 C;  2FZC B;  5KYN A; 
#chains in the Genus database with same CATH homology
 4F16 A;  4Z89 A;  2O88 A;  2DL5 A;  2LNH B;  3EHR A;  1WA7 A;  3QWX X;  5FWB A;  2M51 A;  2DL7 A;  2HBW A;  1UJ0 A;  1Y57 A;  3SHW A;  2O2O A;  2ROL A;  4JJD A;  4J9D A;  1HSQ A;  1H92 A;  2EQI A;  2EVR A;  1UGV A;  1I07 A;  2J6O A;  1K9A A;  2YUQ A;  1VA7 A;  1TUC A;  3VS7 A;  4F14 A;  2YT6 A;  4RTU A;  1AWO A;  4JZ3 A;  2DRK A;  3VS3 A;  4M4Z A;  2GNC A;  1H3H A;  2EGA A;  1YWO A;  5IH2 A;  1SHF A;  2L2P A;  1RUW A;  1N5Z A;  2AZV A;  3REB B;  2JS0 A;  4J9G A;  2ECZ A;  2YUP A;  2KE9 A;  1U3O A;  3REA B;  3I35 A;  1GL5 A;  1PKS A;  4ESR A;  1YNZ A;  1YN8 A;  3SEM A;  1ZBJ A;  3GBQ A;  5FW9 A;  1X6G A;  2D8H A;  3TVT A;  2FEI A;  3ZL7 C;  4ORZ A;  1WXB A;  1M30 A;  2EW3 A;  1WYX A;  4R0K A;  3U23 A;  2W10 A;  4RTZ A;  2KT8 A;  2DBM A;  2HDA A;  2J6K A;  1KIK A;  2KXC A;  1UUE A;  2EYW A;  2DJQ A;  1MV0 B;  4OMM A;  2ED1 A;  3RBB B;  3VS6 A;  1U5S A;  1ZUU A;  2FRW A;  1KSW A;  2DMO A;  3RNJ A;  4HVV A;  4D8K A;  2DL4 A;  2D1X A;  3IQL A;  2A08 A;  2V1Q A;  3THK A;  1W1F A;  4AFZ C;  2CH4 A;  1NYG A;  1X2K A;  4HVW A;  2I0N A;  2KXD A;  4AFQ C;  5L23 A;  1SRL A;  2BZY A;  3VS5 A;  1CSK A;  1JEG A;  3R6N A;  1QCF A;  3H0F A;  2G6F X;  1NEB A;  2XMF A;  2FPD A;  1ARK A;  1GCQ C;  4OMP A;  1WDX A;  2D0N A;  2KYM A;  1ZLM A;  4LNP A;  1ABO A;  4F17 A;  2X3W D;  2RQV A;  1Z9Q A;  1RI9 A;  1YWP A;  4AG2 C;  2RQW A;  2J7I A;  3H0I A;  3PVL A;  4AFS C;  3FJ5 A;  3M0U A;  4GBQ A;  1BBZ A;  1OEB A;  1A0N B;  1GCQ A;  2DF6 A;  5GJW B;  2ABL A;  4JJB A;  2EGC A;  2JW4 A;  4CC4 B;  1K1Z A;  4ZNX A;  2K6D A;  2YUN A;  2KR3 A;  1E6H A;  2J6F A;  4EIK A;  1GBQ A;  3TSW A;  2CSQ A;  4J9E A;  1AVZ C;  3NHN A;  2OI3 A;  2AKL A;  1WFW A;  4FSS A;  2LMJ A;  1RLP C;  2ESW A;  1UE9 A;  2DA9 A;  3VRY A;  2FPF A;  1BU1 A;  2KNB B;  2M0Y A;  1GFC A;  1KFZ A;  2DIL A;  2O9V A;  3TSZ A;  1LCK A;  1MV3 A;  2L0A A;  2B86 A;  1NLP C;  1QWE A;  1WLP B;  2J06 A;  2A28 A;  4HVU A;  1GBR A;  4LN2 A;  1W6X A;  1QLY A;  2GQI A;  2DL8 A;  1UHC A;  4CC3 A;  4QT7 A;  2RPN A;  4RTT A;  1GRI A;  2DVJ A;  2PNI A;  4LUD A;  1VYV A;  1K0S A;  2YDL A;  2QDL A;  2ROT A;  2C0O A;  2OAW A;  1T3L A;  2EGE A;  2FO0 A;  2BZ8 A;  2EKH A;  2JM9 A;  1J3T A;  1BB9 A;  5IXB A;  2DNU A;  3ULR B;  1UFF A;  1ZSG A;  2EYZ A;  1I1J A;  2K7A A;  2AZS A;  3EG1 A;  2VWF A;  5IXF A;  3EG2 A;  2AK5 A;  2RNA A;  2JMA A;  1AWX A;  2HSP A;  1T0H A;  3M0T A;  3UAT A;  4J9F A;  1OPL A;  2JT4 A;  5GJV B;  3UF4 A;  4HXJ A;  2O31 A;  1SEM A;  2CT4 A;  4WCI A;  2LQW A;  3EG3 A;  1VYT A;  4RTX A;  4AFU C;  2P4R A;  1JQQ A;  2LZ6 B;  1JXO A;  1UG1 A;  2L3S A;  2F2W A;  3VS2 A;  1RLQ C;  1AEY A;  1MUZ A;  3JV3 A;  2LJ3 A;  2EYY A;  2MCN A;  2BZX A;  2LJ1 A;  1H8K A;  1TG0 A;  2KGT A;  2CUD A;  2JS2 A;  2RF0 A;  1ZX6 A;  1FMK A;  2RQT A;  2K79 A;  2SEM A;  4LE9 A;  1AZE A;  2VVK A;  1M3A A;  2X3X D;  1X43 A;  4A63 B;  4OML A;  2H8H A;  1K76 A;  4KRT A;  1YP5 A;  2HEQ A;  1M8M A;  2O9S A;  5ECA A;  5IHI A;  1S1N A;  3M0P A;  3KFV A;  1Y0M A;  2JM8 A;  1VYU A;  3H0H A;  1WI7 A;  3C0C A;  1SSH A;  2LQN A;  2KRS A;  1XOV A;  4Y92 A;  4JJC A;  3EG0 A;  2DE0 X;  4X1V A;  2A37 A;  1I0C A;  2LP5 A;  1E6G A;  4AG1 C;  2JXB A;  3H41 A;  1M3C A;  2KEA A;  1OV3 A;  4HCK A;  1AZG B;  1X27 A;  2DBK A;  2RQU A;  1PWT A;  2SRC A;  2PZ1 A;  4OMQ A;  4DEX A;  2JTE A;  4J9B A;  2FG0 A;  4J9H A;  2FRY A;  3PVQ A;  3EGU A;  1T3S A;  4Z88 A;  1AWW A;  1K4U S;  2CRE A;  2KT1 A;  1CKA A;  1CKB A;  2VKN A;  1ZUY A;  2V1R A;  5IHN A;  2ENM A;  1ABQ A;  1UEC A;  2HCK A;  4OMO A;  3NGP A;  1B07 A;  2A36 A;  2LJ0 A;  4K11 A;  2KRM A;  2KBT A;  1V1C A;  2DX1 A;  5FWC A;  3UA7 A;  1OPK A;  3NPF A;  1PRL C;  4J9C A;  1JU5 C;  4JZ4 A;  1HJD A;  1NYF A;  1X2Q A;  3LH5 A;  2F2V A;  4RTV A;  5I22 A;  2DL3 A;  1X6B A;  2KYB A;  4JPB W;  2YUO A;  1GCP A;  2DM1 A;  2JMC A;  4CC7 A;  1NG2 A;  1UHF A;  2E5K A;  3M0Q A;  2K3B A;  1B3Q A;  1U06 A;  3EHQ A;  4IIO A;  4IIM A;  4DEY A;  1G2B A;  2FPE A;  3I5S A;  2LX7 A;  1NEG A;  2YSQ A;  1WX6 A;  3M0S A;  3I9Q A;  3A98 A;  2MIO A;  1E7O A;  3UA6 A;  2CUB A;  1AWJ A;  2DLP A;  2GTJ A;  4RUG A;  2NUZ A;  5EC7 A;  2EYX A;  2J05 A;  1TUD A;  3VS1 A;  3VS4 A;  1SRM A;  2W0Z A;  1PRM C;  2KRO A;  2IIM A;  1NM7 A;  1JO8 A;  5I11 A;  2D8J A;  2RQR A;  1OOT A;  2PTK A;  4GLM A;  1SPK A;  1QWF A;  3I5R A;  4E6R A;  1AOJ A;  5IHK A;  2C0T A;  1T0J A;  2GGR A;  2L3P A;  2AKK A;  2BTT A;  1IO6 A;  1AD5 A;  1M27 C;  1EFN A;  2NWM A;  1M3B A;  3VRZ A;  4J9I A;  4RTW A;  2EBP A;  2K9G A;  1YCS B;  1Z9Z A;  2CT3 A;  4CC2 A;  2RN8 A;  4RTY A;  2F2X A;  3M0R A;  5HCK A;  1G83 A;  1WXU A;  2DRM A;  2OJ2 A;  3QWY A;  1WIE A;  4OMN A;  1PNJ A;  1JXM A;  2CSI A;  2RMO A;  2L3Q A;  2CH4 W;  2DYB A;  2LCS A;  1HD3 A;  1K0X A;  1BK2 A;  1UDL A;  1UTI A;  1WXT A;  1ZUK A;  3NMZ C;  1W70 A;  3VS0 A;  2KRN A;  1FYN A;  2ED0 A;  1SHG A;  1X69 A;  2EPD A;  1GFD A;  4LUE A;  4D8D A;  2MOX A;  1KJW A;  4Z8A A;  2GTO A;  3PE0 A;  1QKX A;  2CDT A;  3CQT A;  3O5Z A;  1PKT A;  1QKW A;  2C0I A;  1PHT A;  2GBQ A;  2K2M A;  1NLO C;  1UJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...