2JMAA

R21a spc-sh3:p41 complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
b'MDETGKELVLALYDYQEKSPAEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title The high-resolution NMR structure of the R21A Spc-SH3:P41 complex: Understanding the determinants of binding affinity by comparison with Abl-SH3
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 12
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jmaA00
2HBWA 2MIOA 4LNPA 1G83A 4GLMA 5GJVB 1ZX6A 2MOXA 4AFZC 4J9EA 2VKNA 2KXCA 1SSHA 1PHTA 1VYUA 1X69A 4F17A 3PVQA 4AFSC 5IHKA 2FPEA 4RTVA 1AWWA 1AD5A 1QKXA 1WXBA 2MCNA 3M0TA 2ROTA 2YUQA 1PKTA 1VYVA 2RQUA 4JPBW 2DF6A 4A63B 1W70A 2I0NA 1N5ZA 1VYTA 1GBQA 1U5SA 3H0IA 2FPDA 1PWTA 3A98A 2L3SA 3REBB 3H0HA 1ZUYA 2BZXA 4Z8AA 2GTJA 5IHNA 2KNBB 3EG3A 1MV0B 2A08A 2DL3A 4IIMA 3VS7A 1JXMA 2BTTA 3EG0A 5IHIA 1Y57A 1Z9ZA 2W10A 1GCQC 4FSSA 1HJDA 1HSQA 4HVWA 2RQTA 2DVJA 1GL5A 3I5RA 1I0CA 1T3SA 2FPFA 4HVUA 5EC7A 2GQIA 2DRMA 4OMOA 1PKSA 2CSIA 4Y92A 2EGCA 2JTEA 3NGPA 2DJQA 3VRYA 1NG2A 3NHNA 2D1XA 2DL7A 2LJ0A 2RQRA 2FRYA 5I22A 5ECAA 1GCQA 5L23A 4D8DA 1NLPC 2CREA 1JQQA 4J9HA 2EQIA 1I07A 2ED0A 2KYBA 2RPNA 2VWFA 1I1JA 2ED1A 2LJ3A 1V1CA 2JW4A 3R6NA 2DBKA 4F14A 4LUDA 4AG1C 4JZ3A 1E6HA 1K9AA 5FW9A 1W1FA 2O88A 2FEIA 2G6FX 2LQWA 1B07A 2JT4A 3NPFA 2CUBA 2VVKA 4CC2A 2YSQA 2PNIA 3VS1A 1M27C 1GRIA 1YCSB 3I9QA 4IIOA 3I5SA 2YUPA 3NMZC 3UATA 1M30A 1PRLC 1UG1A 1AOJA 2K3BA 1T0HA 1IO6A 2BZYA 2SEMA 2O31A 2C0OA 3M0SA 3SEMA 1U06A 1X27A 1SHGA 2J6FA 2ROLA 1GFDA 4RTUA 4AFUC 2M51A 3VS4A 2YUOA 1X6GA 1KIKA 2PTKA 1ZSGA 2NWMA 1LCKA 1ARKA 3TVTA 2AKLA 1X43A 1AVZC 2RN8A 2DM1A 2KT1A 2GGRA 1BU1A 4JZ4A 3EG2A 1JXOA 3EHRA 2LZ6B 2LP5A 1MV3A 2LJ1A 2DBMA 2HCKA 3EG1A 2KRSA 4AFQC 1Z9QA 3VS6A 1ZUKA 3EHQA 2E5KA 2OJ2A 3LH5A 1CKBA 2K9GA 3C0CA 1T0JA 1KJWA 4RUGA 1QLYA 2D8HA 2FO0A 4OMQA 1BB9A 2YDLA 2EW3A 3O5ZA 1OPLA 2F2WA 2J7IA 4HCKA 1GCPA 1SRMA 2K6DA 2RNAA 1H8KA 1WFWA 1K76A 1SPKA 3VRZA 2GTOA 3M0PA 3PE0A 2D8JA 1E6GA 1TUCA 1YWPA 2KROA 1TG0A 2HSPA 4DEYA 3REAB 1B3QA 1KSWA 2J06A 2LMJA 1UHCA 2SRCA 1SHFA 1X6BA 3QWYA 2D0NA 3SHWA 3ULRB 3RNJA 2EKHA 4CC7A 3IQLA 1K0SA 1K4US 1K0XA 2QDLA 1AWJA 2DILA 2EPDA 1RUWA 4ESRA 1CSKA 2DLPA 1NYGA 4JJCA 4RTTA 3M0UA 1UDLA 1RI9A 2RQWA 3CQTA 4J9BA 2A36A 2F2XA 1WLPB 1E7OA 1KFZA 2ENMA 2J6OA 2JMAA 2CH4A 3JV3A 1WDXA 2JM9A 1AEYA 1UHFA 2BZ8A 5GJWB 4QT7A 2C0IA 2DA9A 2X3WD 2K7AA 1RLPC 4RTWA 1UJ0A 1AWXA 5IXBA 2JS0A 4LE9A 3VS5A 3M0RA 2EYYA 2KYMA 3VS3A 5IXFA 4J9IA 2LX7A 4R0KA 1WX6A 2DYBA 1S1NA 2KE9A 2H8HA 2X3XD 2O2OA 1X2QA 1TUDA 2CUDA 1NM7A 1RLQC 1PRMC 1OV3A 1WIEA 1ZLMA 3FJ5A 2KRNA 5IH2A 1AZGB 1QCFA 2HEQA 4J9CA 2AK5A 4JJDA 2EYXA 3GBQA 3ZL7C 2EBPA 4K11A 4HVVA 4JJBA 4HXJA 4Z88A 4OMLA 4WCIA 1NEGA 1NYFA 1UTIA 2V1QA 3I35A 2A28A 4J9FA 2XMFA 4Z89A 1UUEA 1WA7A 2DNUA 1M3CA 2CSQA 3UA7A 2ECZA 1ABQA 3M0QA 1YNZA 1WI7A 1NEBA 2J6KA 3UF4A 3TSWA 2CT4A 2JXBA 3KFVA 2F2VA 4CC3A 1GBRA 1X2KA 2ESWA 2DRKA 1JU5C 2LNHB 4LUEA 4X1VA 2YUNA 2OI3A 1M3AA 1H3HA 2GBQA 4F16A 4OMNA 1CKAA 1FYNA 2B86A 4EIKA 2LQNA 1NLOC 1ZUUA 5I11A 4LN2A 4OMPA 3RBBB 5FWCA 2K79A 2EGEA 1EFNA 1HD3A 1QWFA 1ZBJA 2AZVA 4E6RA 1J3TA 1UGVA 1QWEA 2FG0A 2P4RA 2NUZA 2JM8A 2K2MA 3TSZA 4RTZA 4KRTA 1AWOA 2AZSA 2KT8A 2IIMA 2L0AA 2RF0A 2DMOA 2V1RA 2AKKA 3H0FA 2EYZA 2GNCA 2EVRA 2PZ1A 1UJYA 1W6XA 2L3QA 4DEXA 2CDTA 2RQVA 1G2BA 1A0NB 4ORZA 1SRLA 3U23A 3VS2A 4J9DA 3QWXX 4M4ZA 4RTYA 2KGTA 4CC4B 1UECA 2O9SA 1OEBA 1YN8A 4ZNXA 1H92A 1ABOA 2W0ZA 2CH4W 2ABLA 2LCSA 1UFFA 1M3BA 5HCKA 2DE0X 1MUZA 2DL5A 1BBZA 2YT6A 1QKWA 2C0TA 1JEGA 1WXTA 4RTXA 1OPKA 1U3OA 1OOTA 1Y0MA 2A37A 2DX1A 5FWBA 1K1ZA 4J9GA 1YP5A 1JO8A 2HDAA 2O9VA 4D8KA 1T3LA 2M0YA 1GFCA 4GBQA 1XOVA 2DL8A 3PVLA 2L2PA 1M8MA 3H41A 1UE9A 2KR3A 4OMMA 1WXUA 2KXDA 2KRMA 2JMCA 1BK2A 2OAWA 2L3PA 3THKA 4AG2C 3VS0A 2CT3A 1AZEA 1PNJA 2EYWA 3UA6A 1YWOA 3EGUA 2DL4A 2FRWA 2J05A 1VA7A 2RMOA 2KBTA 1FMKA 2EGAA 2JS2A 1SEMA 2KEAA 1WYXA
chains in the Genus database with same CATH superfamily
3L42A 1U8RA 2DPPB 4C92G 3HFOA 5GJVB 1ZX6A 2MOXA 1VQ8T 1KC8U 1ZA2B 3JCMd 1YJWA 1VQ5Q 3GF5A 3A1PA 3OSSC 3CPWA 3A5ZB 3CC7Q 3E2UA 3PVQA 1Q82C 1D09B 1Y71A 4PJOD 2FPEA 1AD5A 1WXBA 4YTLA 2ROTA 2CZ6B 2LTOA 1WJRA 2DF6A 4RG2A 4A63B 5GMKj 3OBWA 9ATCB 1S72Q 1VQ7T 5M9OA 1U5SA 2FPDA 1PWTA 2FZCB 2OTJA 2LT1A 1M2VB 4OP0A 2BZXA 3PIOA 1YJWT 2GTJA 3OYGA 4M77D 1RAEB 2KNBB 2XU8A 1WHKA 2LT4A 4HCBA 3LH0A 4ZN1A 1Z9ZA 5CK9A 5KYUB 5KE3A 3OS1A 1OULA 5LJ3d 2P0QA 3CMEA 4WTOB 5EC7A 2ZPGB 4L59A 3QUIA 1QVGS 3RR6A 1R77A 3J7AF 4V2SA 1M1KU 3OYKA 1WQ7A 3NHNA 4J6YA 2LJ0A 3ZFJA 1VQLA 3X24B 3C94A 5I22A 4Q5WA 4D8DA 3CPFA 3JB9I 1QP3A 3SDZA 3P8DA 3HRSA 4J9HA 3LGFA 5GAMf 4C5IA 2E1HA 5GAOq 1OZ3A 1I1JA 2BKDN 2LJ3A 4C8QC 2JW4A 1VQ9T 3R6NA 4XTUA 2DBKA 1BI3A 4AG1C 1K9AA 4JLIA 5IAYA 4FYWB 2XHCA 2HMAA 4M75E 3JCMf 1VQLT 3UDCA 4RG8A 2HQEA 4LXCA 3NPFA 2CUBA 5D7UA 1IGQA 3CCMA 2VVKA 4CC2A 3GIBA 3VS1A 1M27C 1YCSB 4PJNA 3S3NA 3LW5E 2HNIA 3CXCP 2RK1A 3OS5A 1M30A 3CD6Q 1YHQA 1IO6A 3SD4A 4ZGDB 4Z02A 2PUKB 1KC8C 1SHGA 2JTMA 1GFDA 4M7AA 2M51A 3VS4A 1QVGA 1G3SA 1IRXA 2PTKA 3L2VA 3M9QA 4M7AG 1I8FA 1EZZB 5LJ3f 4A4FA 3OYLA 1WJSA 3P8BB 1WHGA 4PKCC 1BU1A 1YI2T 3X20B 4M75A 4ZTFA 1YFNA 4XTZA 3TEEA 2LJ1A 4B6MA 2HCKA 3EG1A 4AFQC 3UT1A 4M75G 1Q7YR 2QA4A 3V8LA 1Y07A 3CCEQ 4PJJA 5J26A 2PVGB 3TREA 3VS6A 1ZSZC 3JSCA 5I2MA 4NL3A 3LH5A 1CKBA 2R5AA 3LGLA 2EQKA 4C5EA 1T0JA 2MAMA 1QLYA 3QKJA 3WXMB 2YRVA 3I56Q 3O5ZA 4PJOE 1OPLA 2F2WA 2J7IA 5DLQE 3JCMc 1GCPA 2K6DA 3JCMP 1Q81R 1IHWA 1H8KA 1WFWA 1K76A 1ZHIA 3H8ZA 3HL8A 3M0PA 3PE0A 2M9UA 1VQOA 2DXTA 2KROA 2V8IA 2HSPA 1VQ5A 4DEYA 3L2ZA 3REAB 1B3QA 3CC7A 4XTWA 2LMJA 5LJ5e 1YBYA 2QA4T 1AT1B 1BKBA 2D0NA 3SHWA 3ULRB 1PD1A 1M1KC 3CMAQ 3CC4T 2QDLA 2FHDA 3JAME 4M77E 4OB2B 4F7UA 1N8RU 1S72A 4F7UG 1TH7A 2DIGA 2LC4A 4LDVA 3J81E 3CQTA 1UEBA 2KMTA 2QDYB 1WLPB 5KYXA 4XK8E 4P5NA 4DA4A 2RI3A 2ENMA 2J6OA 2JMAA 4PJOF 3CC7T 3EG9A 1Y96B 2QQRA 3VYGA 2VYTA 1M90R 1PSEA 2X3WD 2K7AA 4RTWA 3CCQT 1UJ0A 3DKMA 1RAAB 2XD0A 2EYYA 4C92B 4ME7A 2LX7A 4R0KA 1WX6A 1C1AA 4C92C 2H8HA 4KUIA 2O2OA 1X2QA 1TUDA 4M77F 1NM7A 1WIEA 2YLBA 2NUPA 2KQWA 2CGHA 5LJ3h 1ZLMA 4FT2A 2KRNA 5IH2A 1AZGB 1BCOA 2AK5A 1RAFB 4JJDA 1TU0B 2EYXA 3ZL7C 4K11A 2EJ9A 4HVVA 3EH1A 5LL6S 1F1BB 2RA2A 2V1QA 3C4SA 4J9FA 2XMFA 4Z89A 2JJ9A 4UC4A 2HD0A 3RIRA 1WHJA 2CSQA 3JCMV 3M0QA 2R57A 5GAMj 4RKUE 1ZQ1A 3VUZA 2J6KA 3CCUT 4BACA 2HQXA 2CT4A 5GANj 2KI7A 1X2KA 2ESWA 5GAN7 2DRKA 1G8XA 3OYHA 4LUEA 3OA6A 2GBQA 4OMNA 4KUDK 3QJ6A 3PMIA 1R0CB 3MEWA 2I2LA 2DO3A 1G5VA 3F70A 3OSVA 3RBBB 4C92D 5CAIA 4MZPA 1JJ2P 1ZBJA 2HSEB 3QHSA 4GLKA 2X51A 1J3TA 2GFUA 3CD6A 1UGVA 2FG0A 2K2VA 3BY7A 2K2MA 5AYFA 4E7KA 5HK3A 1AWOA 2CP0A 1RAGB 1FMVA 2KT8A 2DMOA 2V1RA 2R58A 4IUUA 1RAIB 1NJIR 2EYZA 3DB3A 1V29B 2EVRA 2MWOA 4MZMA 2PQWA 4X9CA 3ER0A 4B9XA 4E2FB 2RHZA 4ELYC 1N8RC 3VS2A 1RI0A 3QWXX 3CCEA 2QQBA 2LCLA 3MPUB 1Q81U 2O9SA 1N9SA 2EJGA 2DVEA 4XTVA 5CKEA 2AT1B 1JEGA 2E5QA 3I56A 2IPOB 4RTXA 3VKIA 2CS7A 4FU6A 3BDLA 1U3OA 3HRTA 3MKDA 4J9GA 1K8AR 4DQ2A 3L2UA 2K5FA 1YJNT 5A2QE 1YJ9Q 5FROA 4BB7A 1TS9A 5KYYB 1M8MA 1UE9A 1OX9A 4OMMA 1WXUA 3CCET 1WHHA 3MP1A 2E6ZA 1QVPA 3HPWA 1KQSA 4IUTA 2H3EB 2A3LA 3CMAA 3M4GA 2EYWA 3UA6A 2DZCA 1AHJB 5CQXA 2J05A 1VA7A 1FMKA 3WVEB 1EIFA 4XU1A 2Y4XA 2XK0A 5LJ5g 1M90U 2MIOA 4LNPA 2K3XA 1G83A 1IZ6A 2X35A 4M75B 3MEVA 4CRIA 1D3BA 4QVZA 2BIVA 3G71T 4AFSC 1Q86R 4QQDA 5CQYA 2FVUA 1WPYA 3EGXB 2DETA 5IN1A 3M0TA 2QEXT 2MYSA 2YUQA 2GFAA 1PKTA 3G4ST 1VUBA 2LDMA 4MDWA 4EMGA 3QIIA 3H0IA 4OGEA 1QMCA 2CYZB 3CBPA 3M4YA 5D6XA 2VXFA 3ZBDA 3EG3A 1MV0B 2A08A 2DL3A 3I55Q 4IIMA 4M7AD 2DJZA 2W10A 3M56A 1GCQC 1HSQA 4HVWA 2RQTA 2DVJA 2DTHA 3I5RA 4A4HA 2FPFA 2DD5A 2HQHA 4HVUA 3OYJA 5GAN8 4ANJA 3A8MB 4M75D 2VV5A 5GMKh 4Y92A 2EGCA 5KYXB 1WZOA 1PD0A 4HKEA 3OYCA 3CCLT 2DJQA 3BDUA 1NG2A 3VRYA 5I2SA 1IXDA 4X9DA 2RQRA 2OTLT 4Y28E 1D0YA 5L23A 4PJLA 1NLPC 3OW2S 4PJOB 1JQQA 1KQ2A 3QO3A 3EFOA 3QJYA 5CKFA 1I07A 2JN0A 1Q81C 4PJOC 2RPNA 1TWBA 2E3IA 1M8VA 2RHIA 3CCVT 5J3BA 1B34A 5GAOl 1IREB 3VUBA 1NJIU 2OX7A 2NUPB 4DBQA 1E6HA 2DAQA 5FW9A 3OYAA 1W1FA 2O88A 1R0BG 5GMKm 4R55A 3EAEA 4N0AA 2CP3A 2HAXA 4M77C 1KQ1A 3EFSA 1JB0E 4FL6A 1SKUB 1W4SA 5GANd 2CP5A 1K73U 2E70A 3OMGA 3I9QA 4IIOA 2XI9A 3I5SA 3QG1A 4BDYA 2C06A 1M4ZA 3NMZC 3VJPA 4M7DE 3DB4A 1AOJA 3S3MA 1M90C 2BZYA 2SEMA 1VQOQ 1RL2A 4HT9A 2ZPHB 3SEMA 1U06A 1X27A 2J6FA 2ROLA 4AFUC 3H6ZA 5L8RE 2YUOA 1X6GA 4LDUA 2COYA 2NWMA 1ARKA 2AKLA 1X43A 4R56A 1YJ9A 1KD1U 2DM1A 5HKCA 3MP6A 2ZCFB 4PLLA 1FXXA 3FJPA 1QCOA 2EFIA 1JXOA 3EHRA 2LZ6B 3OW2A 3RERA 1FWZA 1YIJQ 2YRCA 1H3ZA 2WSCE 1ZUKA 2V8JA 2XG8D 2K9GA 5GAOp 3C0CA 3R6OA 2L5QA 4RUGA 3C95A 2D8HA 4OMQA 4M7DF 1R8OB 4QVCA 1ZA1B 2EQMA 2YDLA 1LOJA 4F04B 4HCKA 1Q86U 1VQNQ 1M9SA 1BIBA 1SRMA 1SPKA 4M7DA 2GTOA 1TUCA 7AT1B 1SSFA 4M7DG 1KSWA 4LDWA 5GMKi 5C6SA 4N4GA 2J06A 4CI0C 2OTJT 2K5LA 1SHFA 2SRCA 4KBMB 3URGA 4J5YA 3OB9A 1PG5B 3A8HB 1MMAA 1AWJA 4PK4A 3S6WA 2RB6A 4XTXA 2QQAA 5GAN6 4M7AE 4RTTA 5GANf 3L2RA 5CCAA 3CMET 3O8VA 4XTYA 2RQWA 2P4TA 4XAXB 4J9BA 2A36A 1QQJA 2CZ7B 3HFNA 5CKHA 3I55A 2JM9A 1AEYA 4EMKB 3OQ5A 1FX7A 2BE7D 1NJIC 4EMKC 2D6FA 2DA9A 1AWXA 5IXBA 2JS0A 3QYGB 5KH6A 3VS3A 4EDUA 4J9IA 3X26B 5FRNA 2VXEA 2DYBA 4KT0E 1S1NA 4DOWA 2DZ9A 1D3BB 1RLQC 1K73C 2LCCA 2K57A 2YXYA 2RK2A 4M7AF 3FJ5A 3QPHA 1YCYA 3FIFA 2HEQA 2F69A 2DK3A 2GF7A 4JJBA 2WSFE 2MI6A 4OMLA 1NEGA 1NYFA 1UTIA 3I35A 3LLRA 1UUEA 3PIPA 3CCMT 5DM7R 2DNUA 1M3CA 4NL2A 3UA7A 3RKWA 4M75F 2LRQA 4F7UE 3SWNA 3TSWA 3KFVA 1GBRA 4BUGA 5HK0A 3EGDA 8AT1B 1KD1C 4X1VA 4HA8A 3NFCA 2EIFA 2YUNA 5AT1B 1H3HA 1WNLA 3AHUA 2DXBA 1YHQT 1RABB 5GAN5 2RHYA 2B86A 4EIKA 1NLOC 4E7ZA 1ZUUA 6AT1B 5I11A 4LN2A 3JB9G 2K79A 1VQKQ 3CXCS 4ZGEB 4E6RA 3H9NA 5GAMh 1Q86C 1IB8A 2D0QB 1NPRA 2JM8A 5J39A 5GANh 3TSZA 2O4XA 4FCYA 2JUFA 2AZSA 4F7UF 2IIMA 2NLUA 1QVFP 5GAN3 1RACB 2PVDB 8ATCB 2RJDA 3H0FA 4ZN3A 2DD4A 5D6WA 2PZ1A 3JCMh 2L3QA 3CC2Q 1D1AA 2G3RA 2CDTA 2OAUA 2RQVA 1M1FA 3HTRA 4C0FA 3VU3C 2P0KA 4BI4A 1G2BA 4WF2A 2EJFA 4J8OA 3FB9A 2LQ8A 4OVAA 1YIJA 3U23A 1VQOT 1VQ5T 3E19A 4RTYA 3E1SA 1C6VX 1UECA 2NYSA 1YN8A 1H92A 5EG2A 2COZA 2JZ2A 2WACA 1UFFA 3M55A 2LX9A 5HCKA 2DL5A 5LJ5j 1OU9A 1M1GA 4PJMA 2A37A 1VQNA 3M58A 4M78A 1C0MA 1YP5A 3NTIA 4A4KA 1S72T 4EPCA 1GFCA 4M78G 1XOVA 3PVLA 2L2PA 3MEUA 3LWHA 2KR3A 2KRMA 4E7LA 1KG1A 2KAFA 2L3PA 3QDFA 4AG2C 2X4JA 4BDZA 1Q82R 2FZKB 2RM4A 3CXCA 1RAHB 2EQJA 2DL4A 1KQSP 1VIEA 5A0LA 1VQNT 3VYHB 2KEAA 3FEOA 3M54A 3JB9H 4TVRA 4GLMA 4X34A 4AFZC 3JCMe 5FRMA 3M57A 1SSHA 4HT8A 1PHTA 3N5BB 4RTVA 1AWWA 2DKGA 2MCNA 1MMNA 4A53A 1UGSB 4L5GA 1VQ4Q 4E7JA 1VYVA 2E6NA 2RQUA 3LX7A 4JPBW 4BY6B 2XKOC 1XTDA 2I0NA 3UWNA 5GAOm 4JRQA 1N5ZA 4MZTA 5KYWA 1VQPQ 1VYTA 4BY6C 1UB4A 3GNGA 4OGCA 4M7DB 2KDSA 3A98A 2L3SA 4XU3A 3REBB 1WJQA 3G6EQ 4M7DC 4FSXA 2EYQA 4Z8AA 4ZGJB 3T9NA 1D1CA 2CP2A 2X4XA 3VS7A 2BTTA 3EG0A 5IHIA 2CP7A 1WQWA 3INZA 4AT1B 4FSSA 1HJDA 5LJ3e 1Q7YU 1GL5A 1T3SA 1I5LA 2LVMA 1W2BP 2RJEA 1D0XA 1NPPA 2XIDA 3QSUA 1PKSA 2KK4A 1VQ8Q 2HKNA 1BI1A 2JTEA 3NGPA 4KH0B 3CD6T 3OBYA 3X28B 1SG5A 3EH2A 3MEAA 4IKFA 5ECAA 4LDYA 2DEUA 3V8JA 4PNOA 2IVWA 1BCMA 1I4K1 2ED0A 2KYBA 1VQKA 2ED1A 1GXIE 4GY5A 3MHXA 4M7DD 2E64A 2R5MA 4LUDA 3FRNA 4JZ3A 4ELZC 4BD3A 2DXUA 2G6FX 1B07A 3QBYA 2JT4A 3BE3A 1D0ZA 4M7AB 4C8QA 2K4YA 4QQ6A 3OS0A 3RUXA 3CC2A 5DLOA 4M7AC 3I56T 3HHTB 4C8QG 1GRIA 4FW2A 5KCHA 2YUPA 3C12A 3EGDB 3E9GA 3JRZA 1PRLC 1T0HA 1UGRB 4M75C 2BUDA 4DBFA 3P8HA 4RTUA 3CMAT 3CCJQ 2VGNA 2XDBA 1NZ9A 1KIKA 3OYNA 3CPWP 3TVTA 5CIUA 1NBEB 1VQ9Q 3E9FA 3MJXA 2GGRA 4JZ4A 3EG2A 1B7TA 3M5AA 1MV3A 2DBMA 3TQ7P 1O9SA 1VQ6Q 1EX4A 3OY9A 5A0GA 5FLXE 1WGSA 2OJ2A 4BE1A 1M1KR 1MNDA 2F5TX 4DOVA 2HZYA 1H641 5CVIA 4F7UB 3BW1A 2QQSA 5GAMg 1LVKA 4HCZA 4XU2A 1TUGB 2YHTA 3G7ZA 3OYFA 1Q7YC 1NE8A 5GANg 1OQKA 1ZSZA 1UHCA 2CKKA 3EG9B 4PFZA 5LJ5d 4ATOA 3QWYA 3M53A 3PMTA 1QW1A 4CC7A 2COWA 2QI2A 3GLXA 3JB9D 1VQ4A 1K4US 4FM4B 2NUTA 2A7YA 4M78B 2DILA 3JCMg 2EPDA 1VQPA 3OYDA 1KK7A 3G6EA 1UDLA 1YI2Q 2L8DA 3META 4KGVB 2QG9B 1E7OA 2X4YA 1KFZA 4C0DB 2CH4A 3CCSQ 2MF2A 4C0DC 2B8AA 1UHFA 5GJWB 4QT7A 1WHLA 1K9MR 3HRUA 2ZGWA 2XICA 1VQ4T 4LDXA 2F5KA 4LE9A 4EMHA 3VS5A 1X75C 3M0RA 3UPUA 3ME9A 2KYMA 2WSEE 1Y7XA 3ZEHA 3L2QA 2E10A 4E7IA 1VQ8A 2IG0A 1X6OA 1SF9A 2CUDA 3KBGA 4JS4A 2O01E 3TU4K 1PRMC 1OV3A 4A4GA 3FLGA 5LJ3g 3EFRA 1K8AU 4KULA 1G3TA 3GBQA 3SB2A 5GMKe 3CC4Q 4Z88A 3OMCA 2A28A 4M78D 4ZTJA 2VC8A 1WA7A 2ZPIB 4C92A 1OZ2A 5KYWB 3GNFB 1YNZA 3WVDB 3OS2A 1NEBA 1VOMA 3V7SA 1QVGP 4RCCA 2F2VA 4CC3A 4FT4A 1RADB 1JU5C 2LNHB 2QGGA 2OI3A 1M3AA 1HXDA 3RMSA 3JB9J 1KHCA 2RHXA 5LJ5f 1FYNA 4JDSA 3Q1JA 3CCQQ 4PL6A 1PM3A 2ZPEB 1LNXA 2RI2A 2MMPA 3V8KA 2EGEA 4QVDA 1HD3A 1WHMA 1QWFA 1YJ9T 2AZVA 2EQUA 3QZ9B 3HKSA 1TOVA 1QWEA 2P4RA 1N8RR 2YRDA 2RI5A 3S3OA 1MGQA 3PTAA 4JS5A 2L0AA 2RF0A 3CCJA 2E4HA 3DLLA 4JRPA 2AKKA 4FYXB 2MWPA 5CKBA 2RJCA 4A54A 1ACMB 1UJYA 1VQ9A 2FL7A 3CCUQ 1A0NB 4ORZA 1SRLA 4FW1A 1P92A 4PFPA 1VQ6A 1PC0A 4J9DA 4M4ZA 3TCJA 2KGTA 1OEBA 1MHNA 2W0ZA 2LCSA 4KH1B 1M3BA 2QTXA 3CCJT 2JVVA 4KGZB 2DE0X 1BBZA 4C8QB 2C0TA 1K1ZA 1XQHA 3DLMA 1MMGA 1VQMQ 2HDAA 2O9VA 4D8KA 1T3LA 3G1JA 5C0MA 4GBQA 3RESA 1KHIA 4NOYA 2ATCB 5KYNA 2BE9B 5GAOn 3PT9A 3A8OB 4FYYB 3H41A 1VQ6T 2MK5A 1BK2A 2E12A 2CZ1B 1Q95G 1TTHB 3I55T 1PNJA 2KVQG 1YWOA 2AHJB 4BE2A 3EGUA 2XDPA 4O6JA 4PLIA 5CO7A 1K8AC 2RMOA 2KBTA 3JCMQ 4OB3B 2EGAA 1K9MU 5LJ5h 4JUVA 1YI2A 1OX8A 1FMWA 1G3YA 2HBWA 1QCNA 3GOXA 5KYYA 2X4WA 3LWIA 4J9EA 3CCSA 2VKNA 2KXCA 3A8LB 2X9HA 4FYVB 1VYUA 2RHUA 1X69A 4F17A 3JB9F 2VASA 4KGXB 5IHKA 1TSFA 1QKXA 2QYZA 4C8QD 4N4IA 2CP6A 1W70A 1JBMA 1YJNQ 1GBQA 4M78E 4JJNK 3MP8A 3H0HA 1ZUYA 5GAOr 1U1TA 3CCST 3FC3A 1ZSZB 3JCMJ 5IHNA 3CBOA 5GMKl 1YITQ 3CC4A 3EGXA 1Y57A 2JNGA 5GAN4 4NS5A 2NUTB 4J6WA 3OYEA 2KY9A 3EFOB 4RCBA 4JRKA 3V7RA 1I0CA 5CR2A 3OYBA 3LYIA 2GQIA 2DRMA 4OMOA 4QQGA 1B34B 2HBPA 2CSIA 4RMOA 4J83A 3RKXA 4XU0A 2YWWA 2QGFB 3KUFA 3OYYA 2D1XA 2DL7A 4FIBA 2Z0WA 3G71Q 3QDRB 2FRYA 1OU8A 3CCQA 1GCQA 5HY6A 4M78F 4IUPA 2ZZDA 2CREA 4N0AC 2QEXQ 4E7HA 2EQIA 1PSFA 2DTIA 3G4SQ 2VWFA 1V1CA 2K3YA 2ZPBB 3OYIA 2LQKA 4F14A 1BI0A 5KCOA 3CCRQ 1BI2A 3CEYA 1YIJT 2FEIA 2LQWA 1QVFS 4J7IA 4E7SA 4PJOA 2E41A 3X25B 5GAMe 1QP2A 3FDRA 4IUVA 4PJOG 2YSQA 5GANe 2PNIA 3AT1B 4II1A 3CCUA 1IGUA 1G3WA 4Y91A 2Y4YA 2DEQA 1XNIA 2HL5C 3UATA 3CCLQ 1UG1A 3MO8A 2EKOA 2K3BA 1K9MC 3NTHA 2O31A 2C0OA 4M77A 3M0SA 2OTLQ 1VIFA 4C0ZA 3VV0A 2PUOB 4M77G 4O5VA 2CZ0B 1TXQA 2GQVA 1VQMA 1ZSGA 1LCKA 1AVZC 2RN8A 2VUBA 2A0FB 3CCVQ 3L1AA 2KT1A 3GPLA 4C5HA 2LP5A 2KRSA 2L3RA 1LPLA 4BE0A 1Z9QA 3A8GB 3EHQA 2E5KA 1KJWA 4PFOA 2FO0A 5FU7B 1KQSS 1BB9A 3M59A 3JCMW 1VQMT 2EW3A 5FU7C 2PVOB 3SFMA 4C8QE 1PCXA 2RNAA 4L6V5 1QVFA 3VRZA 2QK0A 4B9WA 2D8JA 1E6GA 1YWPA 1TG0A 4E47A 4QW2A 4QKUA 1M2VA 2M02A 3L2WA 1X6BA 5I21A 3RNJA 2QTVA 2EKHA 1ZBXA 3IQLA 1D1BA 1K0SA 1K0XA 5KYUA 1BIAA 5DY9A 2M16A 2Y90A 1RUWA 4ESRA 1YJNA 1CSKA 2DLPA 2ZAEA 1NYGA 4VUBA 4JJCA 5FU6B 3M0UA 3ASKA 1M5Q1 5FU6C 2AIRB 1JJ2S 5LJ3j 1VQ7Q 1RI9A 4IURA 2F2XA 4LD9K 1YITA 3JV3A 3OYMA 1K73R 1WDXA 1O75A 1YJWQ 1V76A 4C8QF 2BZ8A 1JRIA 2C0IA 1RLPC 3MCAB 2RD1A 3KXTA 5IXFA 1KC8R 4AMCA 1W2BS 3BFMA 3QZ5B 1VQKT 1N6AA 2HL3A 2KE9A 2DYIA 2X3XD 1OYXA 4MMKA 3SWNB 2DERA 3PNWC 3SWNC 4BI3A 4OB0B 3G71A 1YITT 4EMKA 2OTJQ 1KD1R 2QXFA 1QCFA 4J9CA 2HKQB 4DBHA 2EBPA 3QYHB 2RO0A 3JCMX 2QEXA 4XQ3A 4HXJA 3NTKA 4WCIA 3G4SA 4D6WA 2GCXA 2PU9B 2E3HA 2ECZA 3CC2T 1ABQA 1WI7A 3PFSA 3UF4A 3CMEQ 1M2OA 1Q82U 2JXBA 3CCRA 2LNVA 3J80E 2V8KA 4JRIA 4J7FA 2FB7A 4DBRA 1I5OB 4LD6A 2O4XB 4F16A 5CKDA 1VQLQ 5GAN2 4OB1B 2M1HA 1CKAA 3GP8A 2H3JA 2LQNA 3OW2P 1JJ2A 4HCCA 3CBMA 4OMPA 3HP9A 1X01A 2ZPFB 5FWCA 1EFNA 3JCMb 1MMDA 4MDXA 1BYMA 1XJWB 3CCLA 3CCRT 2P84A 5A0DA 2JTFA 2NUZA 2OTLA 4RTZA 4KRTA 2L89A 4OMFB 4J6XA 2DIQA 1W2BA 1N27A 2V26A 3RMQA 2FYKA 2K5IA 5IT9E 3CPWS 2GNCA 3CCMQ 2YLCA 1N9RA 3CCVA 3RDVA 1W6XA 4JLGA 4DEXA 4N4HA 4M78C 2DTOA 3V7CA 2VB6A 1LJOA 4C92E 4IUQA 4C5GA 2QASA 2D9TA 4OF1A 3D7SB 2F1LA 2M0OA 5D6YA 4CC4B 3PGGA 3HSBA 4ZNXA 2QQ9A 1YHQQ 1ABOA 2EAYA 2CH4W 2ABLA 1MUZA 2YT6A 2MPXC 1QKWA 1WXTA 1OPKA 1Y0MA 1OOTA 4MMLA 2DX1A 5FWBA 5KE2A 4A4EA 1JO8A 1OI1A 2M0YA 1VQPT 1IHVA 1UGQB 2VGMA 3QXEB 1MNEA 2DL8A 2QAZA 3G6ET 2RJFA 1DJ7B 2KXDA 2DFUA 2JMCA 1HYOA 2OAWA 4C0GA 3THKA 2RH2A 4M77B 1HK9A 3VS0A 2E65A 1Y96A 2CT3A 2JOYA 2FZGB 2QA4Q 1AZEA 1U1SA 3RKYA 4C92F 5GAMd 2DXCA 2KSSA 2FRWA 4BI8B 2EWNA 2XDDA 2JS2A 1I81A 1SEMA 2P0PA 1VQ7A 1UGPB 1JXMA 1WYXA
chains in the Genus database with same CATH topology
2HBWA 2MIOA 4LNPA 1G83A 4GLMA 5GJVB 1ZX6A 2MOXA 4AFZC 4J9EA 2VKNA 2KXCA 1SSHA 1PHTA 1VYUA 1X69A 4F17A 3PVQA 4AFSC 5IHKA 2FPEA 4RTVA 1AWWA 1AD5A 1QKXA 1WXBA 2MCNA 3M0TA 2ROTA 2YUQA 1PKTA 1VYVA 2RQUA 4JPBW 2DF6A 4A63B 1W70A 2I0NA 1N5ZA 1VYTA 1GBQA 1U5SA 3H0IA 2FPDA 1PWTA 3A98A 2L3SA 3REBB 3H0HA 1ZUYA 2BZXA 4Z8AA 2GTJA 5IHNA 2KNBB 3EG3A 1MV0B 2A08A 2DL3A 4IIMA 3VS7A 1JXMA 2BTTA 3EG0A 5IHIA 1Y57A 1Z9ZA 2W10A 1GCQC 4FSSA 1HJDA 1HSQA 4HVWA 2RQTA 2DVJA 1GL5A 3I5RA 1I0CA 1T3SA 2FPFA 4HVUA 5EC7A 2GQIA 2DRMA 4OMOA 1PKSA 2CSIA 4Y92A 2EGCA 2JTEA 3NGPA 2DJQA 3VRYA 1NG2A 3NHNA 2D1XA 2DL7A 2LJ0A 2RQRA 2FRYA 5I22A 5ECAA 1GCQA 5L23A 4D8DA 1NLPC 2CREA 1JQQA 4J9HA 2EQIA 1I07A 2ED0A 2KYBA 2RPNA 2VWFA 1I1JA 2ED1A 2LJ3A 1V1CA 2JW4A 3R6NA 2DBKA 4F14A 4LUDA 4AG1C 4JZ3A 1E6HA 1K9AA 5FW9A 1W1FA 2O88A 2FEIA 2G6FX 2LQWA 1B07A 2JT4A 3NPFA 2CUBA 2VVKA 4CC2A 2YSQA 2PNIA 3VS1A 1M27C 1GRIA 1YCSB 3I9QA 4IIOA 3I5SA 2YUPA 3NMZC 3UATA 1M30A 1PRLC 1UG1A 1AOJA 2K3BA 1T0HA 1IO6A 2BZYA 2SEMA 2O31A 2C0OA 3M0SA 3SEMA 1U06A 1X27A 1SHGA 2J6FA 2ROLA 1GFDA 4RTUA 4AFUC 2M51A 3VS4A 2YUOA 1X6GA 1KIKA 2PTKA 1ZSGA 2NWMA 1LCKA 1ARKA 3TVTA 2AKLA 1X43A 1AVZC 2RN8A 2DM1A 2KT1A 2GGRA 1BU1A 4JZ4A 3EG2A 1JXOA 3EHRA 2LZ6B 2LP5A 1MV3A 2LJ1A 2DBMA 2HCKA 3EG1A 2KRSA 4AFQC 1Z9QA 3VS6A 1ZUKA 3EHQA 2E5KA 2OJ2A 3LH5A 1CKBA 2K9GA 3C0CA 1T0JA 1KJWA 4RUGA 1QLYA 2D8HA 2FO0A 4OMQA 1BB9A 2YDLA 2EW3A 3O5ZA 1OPLA 2F2WA 2J7IA 4HCKA 1GCPA 1SRMA 2K6DA 2RNAA 1H8KA 1WFWA 1K76A 1SPKA 3VRZA 2GTOA 3M0PA 3PE0A 2D8JA 1E6GA 1TUCA 1YWPA 2KROA 1TG0A 2HSPA 4DEYA 3REAB 1B3QA 1KSWA 2J06A 2LMJA 1UHCA 2SRCA 1SHFA 1X6BA 3QWYA 2D0NA 3SHWA 3ULRB 3RNJA 2EKHA 4CC7A 3IQLA 1K0SA 1K4US 1K0XA 2QDLA 1AWJA 2DILA 2EPDA 1RUWA 4ESRA 1CSKA 2DLPA 1NYGA 4JJCA 4RTTA 3M0UA 1UDLA 1RI9A 2RQWA 3CQTA 4J9BA 2A36A 2F2XA 1WLPB 1E7OA 1KFZA 2ENMA 2J6OA 2JMAA 2CH4A 3JV3A 1WDXA 2JM9A 1AEYA 1UHFA 2BZ8A 5GJWB 4QT7A 2C0IA 2DA9A 2X3WD 2K7AA 1RLPC 4RTWA 1UJ0A 1AWXA 5IXBA 2JS0A 4LE9A 3VS5A 3M0RA 2EYYA 2KYMA 3VS3A 5IXFA 4J9IA 2LX7A 4R0KA 1WX6A 2DYBA 1S1NA 2KE9A 2H8HA 2X3XD 2O2OA 1X2QA 1TUDA 2CUDA 1NM7A 1RLQC 1PRMC 1OV3A 1WIEA 1ZLMA 3FJ5A 2KRNA 5IH2A 1AZGB 1QCFA 2HEQA 4J9CA 2AK5A 4JJDA 2EYXA 3GBQA 3ZL7C 2EBPA 4K11A 4HVVA 4JJBA 4HXJA 4Z88A 4OMLA 4WCIA 1NEGA 1NYFA 1UTIA 2V1QA 3I35A 2A28A 4J9FA 2XMFA 4Z89A 1UUEA 1WA7A 2DNUA 1M3CA 2CSQA 3UA7A 2ECZA 1ABQA 3M0QA 1YNZA 1WI7A 1NEBA 2J6KA 3UF4A 3TSWA 2CT4A 2JXBA 3KFVA 2F2VA 4CC3A 1GBRA 1X2KA 2ESWA 2DRKA 1JU5C 2LNHB 4LUEA 4X1VA 2YUNA 2OI3A 1M3AA 1H3HA 2GBQA 4F16A 4OMNA 1CKAA 1FYNA 2B86A 4EIKA 2LQNA 1NLOC 1ZUUA 5I11A 4LN2A 4OMPA 3RBBB 5FWCA 2K79A 2EGEA 1EFNA 1HD3A 1QWFA 1ZBJA 2AZVA 4E6RA 1J3TA 1UGVA 1QWEA 2FG0A 2P4RA 2NUZA 2JM8A 2K2MA 3TSZA 4RTZA 4KRTA 1AWOA 2AZSA 2KT8A 2IIMA 2L0AA 2RF0A 2DMOA 2V1RA 2AKKA 3H0FA 2EYZA 2GNCA 2EVRA 2PZ1A 1UJYA 1W6XA 2L3QA 4DEXA 2CDTA 2RQVA 1G2BA 1A0NB 4ORZA 1SRLA 3U23A 3VS2A 4J9DA 3QWXX 4M4ZA 4RTYA 2KGTA 4CC4B 1UECA 2O9SA 1OEBA 1YN8A 4ZNXA 1H92A 1ABOA 2W0ZA 2CH4W 2ABLA 2LCSA 1UFFA 1M3BA 5HCKA 2DE0X 1MUZA 2DL5A 1BBZA 2YT6A 1QKWA 2C0TA 1JEGA 1WXTA 4RTXA 1OPKA 1U3OA 1OOTA 1Y0MA 2A37A 2DX1A 5FWBA 1K1ZA 4J9GA 1YP5A 1JO8A 2HDAA 2O9VA 4D8KA 1T3LA 2M0YA 1GFCA 4GBQA 1XOVA 2DL8A 3PVLA 2L2PA 1M8MA 3H41A 1UE9A 2KR3A 4OMMA 1WXUA 2KXDA 2KRMA 2JMCA 1BK2A 2OAWA 2L3PA 3THKA 4AG2C 3VS0A 2CT3A 1AZEA 1PNJA 2EYWA 3UA6A 1YWOA 3EGUA 2DL4A 2FRWA 2J05A 1VA7A 2RMOA 2KBTA 1FMKA 2EGAA 2JS2A 1SEMA 2KEAA 1WYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBW A;  2MIO A;  4LNP A;  1G83 A;  4GLM A;  5GJV B;  1ZX6 A;  2MOX A;  4AFZ C;  4J9E A;  2VKN A;  2KXC A;  1SSH A;  1PHT A;  1VYU A;  1X69 A;  4F17 A;  3PVQ A;  4AFS C;  5IHK A;  2FPE A;  4RTV A;  1AWW A;  1AD5 A;  1QKX A;  1WXB A;  2MCN A;  3M0T A;  2ROT A;  2YUQ A;  1PKT A;  1VYV A;  2RQU A;  4JPB W;  2DF6 A;  4A63 B;  1W70 A;  2I0N A;  1N5Z A;  1VYT A;  1GBQ A;  1U5S A;  3H0I A;  2FPD A;  1PWT A;  3A98 A;  2L3S A;  3REB B;  3H0H A;  1ZUY A;  2BZX A;  4Z8A A;  2GTJ A;  5IHN A;  2KNB B;  3EG3 A;  1MV0 B;  2A08 A;  2DL3 A;  4IIM A;  3VS7 A;  1JXM A;  2BTT A;  3EG0 A;  5IHI A;  1Y57 A;  1Z9Z A;  2W10 A;  1GCQ C;  4FSS A;  1HJD A;  1HSQ A;  4HVW A;  2RQT A;  2DVJ A;  1GL5 A;  3I5R A;  1I0C A;  1T3S A;  2FPF A;  4HVU A;  5EC7 A;  2GQI A;  2DRM A;  4OMO A;  1PKS A;  2CSI A;  4Y92 A;  2EGC A;  2JTE A;  3NGP A;  2DJQ A;  3VRY A;  1NG2 A;  3NHN A;  2D1X A;  2DL7 A;  2LJ0 A;  2RQR A;  2FRY A;  5I22 A;  5ECA A;  1GCQ A;  5L23 A;  4D8D A;  1NLP C;  2CRE A;  1JQQ A;  4J9H A;  2EQI A;  1I07 A;  2ED0 A;  2KYB A;  2RPN A;  2VWF A;  1I1J A;  2ED1 A;  2LJ3 A;  1V1C A;  2JW4 A;  3R6N A;  2DBK A;  4F14 A;  4LUD A;  4AG1 C;  4JZ3 A;  1E6H A;  1K9A A;  5FW9 A;  1W1F A;  2O88 A;  2FEI A;  2G6F X;  2LQW A;  1B07 A;  2JT4 A;  3NPF A;  2CUB A;  2VVK A;  4CC2 A;  2YSQ A;  2PNI A;  3VS1 A;  1M27 C;  1GRI A;  1YCS B;  3I9Q A;  4IIO A;  3I5S A;  2YUP A;  3NMZ C;  3UAT A;  1M30 A;  1PRL C;  1UG1 A;  1AOJ A;  2K3B A;  1T0H A;  1IO6 A;  2BZY A;  2SEM A;  2O31 A;  2C0O A;  3M0S A;  3SEM A;  1U06 A;  1X27 A;  1SHG A;  2J6F A;  2ROL A;  1GFD A;  4RTU A;  4AFU C;  2M51 A;  3VS4 A;  2YUO A;  1X6G A;  1KIK A;  2PTK A;  1ZSG A;  2NWM A;  1LCK A;  1ARK A;  3TVT A;  2AKL A;  1X43 A;  1AVZ C;  2RN8 A;  2DM1 A;  2KT1 A;  2GGR A;  1BU1 A;  4JZ4 A;  3EG2 A;  1JXO A;  3EHR A;  2LZ6 B;  2LP5 A;  1MV3 A;  2LJ1 A;  2DBM A;  2HCK A;  3EG1 A;  2KRS A;  4AFQ C;  1Z9Q A;  3VS6 A;  1ZUK A;  3EHQ A;  2E5K A;  2OJ2 A;  3LH5 A;  1CKB A;  2K9G A;  3C0C A;  1T0J A;  1KJW A;  4RUG A;  1QLY A;  2D8H A;  2FO0 A;  4OMQ A;  1BB9 A;  2YDL A;  2EW3 A;  3O5Z A;  1OPL A;  2F2W A;  2J7I A;  4HCK A;  1GCP A;  1SRM A;  2K6D A;  2RNA A;  1H8K A;  1WFW A;  1K76 A;  1SPK A;  3VRZ A;  2GTO A;  3M0P A;  3PE0 A;  2D8J A;  1E6G A;  1TUC A;  1YWP A;  2KRO A;  1TG0 A;  2HSP A;  4DEY A;  3REA B;  1B3Q A;  1KSW A;  2J06 A;  2LMJ A;  1UHC A;  2SRC A;  1SHF A;  1X6B A;  3QWY A;  2D0N A;  3SHW A;  3ULR B;  3RNJ A;  2EKH A;  4CC7 A;  3IQL A;  1K0S A;  1K4U S;  1K0X A;  2QDL A;  1AWJ A;  2DIL A;  2EPD A;  1RUW A;  4ESR A;  1CSK A;  2DLP A;  1NYG A;  4JJC A;  4RTT A;  3M0U A;  1UDL A;  1RI9 A;  2RQW A;  3CQT A;  4J9B A;  2A36 A;  2F2X A;  1WLP B;  1E7O A;  1KFZ A;  2ENM A;  2J6O A;  2JMA A;  2CH4 A;  3JV3 A;  1WDX A;  2JM9 A;  1AEY A;  1UHF A;  2BZ8 A;  5GJW B;  4QT7 A;  2C0I A;  2DA9 A;  2X3W D;  2K7A A;  1RLP C;  4RTW A;  1UJ0 A;  1AWX A;  5IXB A;  2JS0 A;  4LE9 A;  3VS5 A;  3M0R A;  2EYY A;  2KYM A;  3VS3 A;  5IXF A;  4J9I A;  2LX7 A;  4R0K A;  1WX6 A;  2DYB A;  1S1N A;  2KE9 A;  2H8H A;  2X3X D;  2O2O A;  1X2Q A;  1TUD A;  2CUD A;  1NM7 A;  1RLQ C;  1PRM C;  1OV3 A;  1WIE A;  1ZLM A;  3FJ5 A;  2KRN A;  5IH2 A;  1AZG B;  1QCF A;  2HEQ A;  4J9C A;  2AK5 A;  4JJD A;  2EYX A;  3GBQ A;  3ZL7 C;  2EBP A;  4K11 A;  4HVV A;  4JJB A;  4HXJ A;  4Z88 A;  4OML A;  4WCI A;  1NEG A;  1NYF A;  1UTI A;  2V1Q A;  3I35 A;  2A28 A;  4J9F A;  2XMF A;  4Z89 A;  1UUE A;  1WA7 A;  2DNU A;  1M3C A;  2CSQ A;  3UA7 A;  2ECZ A;  1ABQ A;  3M0Q A;  1YNZ A;  1WI7 A;  1NEB A;  2J6K A;  3UF4 A;  3TSW A;  2CT4 A;  2JXB A;  3KFV A;  2F2V A;  4CC3 A;  1GBR A;  1X2K A;  2ESW A;  2DRK A;  1JU5 C;  2LNH B;  4LUE A;  4X1V A;  2YUN A;  2OI3 A;  1M3A A;  1H3H A;  2GBQ A;  4F16 A;  4OMN A;  1CKA A;  1FYN A;  2B86 A;  4EIK A;  2LQN A;  1NLO C;  1ZUU A;  5I11 A;  4LN2 A;  4OMP A;  3RBB B;  5FWC A;  2K79 A;  2EGE A;  1EFN A;  1HD3 A;  1QWF A;  1ZBJ A;  2AZV A;  4E6R A;  1J3T A;  1UGV A;  1QWE A;  2FG0 A;  2P4R A;  2NUZ A;  2JM8 A;  2K2M A;  3TSZ A;  4RTZ A;  4KRT A;  1AWO A;  2AZS A;  2KT8 A;  2IIM A;  2L0A A;  2RF0 A;  2DMO A;  2V1R A;  2AKK A;  3H0F A;  2EYZ A;  2GNC A;  2EVR A;  2PZ1 A;  1UJY A;  1W6X A;  2L3Q A;  4DEX A;  2CDT A;  2RQV A;  1G2B A;  1A0N B;  4ORZ A;  1SRL A;  3U23 A;  3VS2 A;  4J9D A;  3QWX X;  4M4Z A;  4RTY A;  2KGT A;  4CC4 B;  1UEC A;  2O9S A;  1OEB A;  1YN8 A;  4ZNX A;  1H92 A;  1ABO A;  2W0Z A;  2CH4 W;  2ABL A;  2LCS A;  1UFF A;  1M3B A;  5HCK A;  2DE0 X;  1MUZ A;  2DL5 A;  1BBZ A;  2YT6 A;  1QKW A;  2C0T A;  1JEG A;  1WXT A;  4RTX A;  1OPK A;  1U3O A;  1OOT A;  1Y0M A;  2A37 A;  2DX1 A;  5FWB A;  1K1Z A;  4J9G A;  1YP5 A;  1JO8 A;  2HDA A;  2O9V A;  4D8K A;  1T3L A;  2M0Y A;  1GFC A;  4GBQ A;  1XOV A;  2DL8 A;  3PVL A;  2L2P A;  1M8M A;  3H41 A;  1UE9 A;  2KR3 A;  4OMM A;  1WXU A;  2KXD A;  2KRM A;  2JMC A;  1BK2 A;  2OAW A;  2L3P A;  3THK A;  4AG2 C;  3VS0 A;  2CT3 A;  1AZE A;  1PNJ A;  2EYW A;  3UA6 A;  1YWO A;  3EGU A;  2DL4 A;  2FRW A;  2J05 A;  1VA7 A;  2RMO A;  2KBT A;  1FMK A;  2EGA A;  2JS2 A;  1SEM A;  2KEA A;  1WYX A; 
#chains in the Genus database with same CATH topology
 3L42 A;  1U8R A;  2DPP B;  4C92 G;  3HFO A;  5GJV B;  1ZX6 A;  2MOX A;  1VQ8 T;  1KC8 U;  1ZA2 B;  3JCM d;  1YJW A;  1VQ5 Q;  3GF5 A;  3A1P A;  3OSS C;  3CPW A;  3A5Z B;  3CC7 Q;  3E2U A;  3PVQ A;  1Q82 C;  1D09 B;  1Y71 A;  4PJO D;  2FPE A;  1AD5 A;  1WXB A;  4YTL A;  2ROT A;  2CZ6 B;  2LTO A;  1WJR A;  2DF6 A;  4RG2 A;  4A63 B;  5GMK j;  3OBW A;  9ATC B;  1S72 Q;  1VQ7 T;  5M9O A;  1U5S A;  2FPD A;  1PWT A;  2FZC B;  2OTJ A;  2LT1 A;  1M2V B;  4OP0 A;  2BZX A;  3PIO A;  1YJW T;  2GTJ A;  3OYG A;  4M77 D;  1RAE B;  2KNB B;  2XU8 A;  1WHK A;  2LT4 A;  4HCB A;  3LH0 A;  4ZN1 A;  1Z9Z A;  5CK9 A;  5KYU B;  5KE3 A;  3OS1 A;  1OUL A;  5LJ3 d;  2P0Q A;  3CME A;  4WTO B;  5EC7 A;  2ZPG B;  4L59 A;  3QUI A;  1QVG S;  3RR6 A;  1R77 A;  3J7A F;  4V2S A;  1M1K U;  3OYK A;  1WQ7 A;  3NHN A;  4J6Y A;  2LJ0 A;  3ZFJ A;  1VQL A;  3X24 B;  3C94 A;  5I22 A;  4Q5W A;  4D8D A;  3CPF A;  3JB9 I;  1QP3 A;  3SDZ A;  3P8D A;  3HRS A;  4J9H A;  3LGF A;  5GAM f;  4C5I A;  2E1H A;  5GAO q;  1OZ3 A;  1I1J A;  2BKD N;  2LJ3 A;  4C8Q C;  2JW4 A;  1VQ9 T;  3R6N A;  4XTU A;  2DBK A;  1BI3 A;  4AG1 C;  1K9A A;  4JLI A;  5IAY A;  4FYW B;  2XHC A;  2HMA A;  4M75 E;  3JCM f;  1VQL T;  3UDC A;  4RG8 A;  2HQE A;  4LXC A;  3NPF A;  2CUB A;  5D7U A;  1IGQ A;  3CCM A;  2VVK A;  4CC2 A;  3GIB A;  3VS1 A;  1M27 C;  1YCS B;  4PJN A;  3S3N A;  3LW5 E;  2HNI A;  3CXC P;  2RK1 A;  3OS5 A;  1M30 A;  3CD6 Q;  1YHQ A;  1IO6 A;  3SD4 A;  4ZGD B;  4Z02 A;  2PUK B;  1KC8 C;  1SHG A;  2JTM A;  1GFD A;  4M7A A;  2M51 A;  3VS4 A;  1QVG A;  1G3S A;  1IRX A;  2PTK A;  3L2V A;  3M9Q A;  4M7A G;  1I8F A;  1EZZ B;  5LJ3 f;  4A4F A;  3OYL A;  1WJS A;  3P8B B;  1WHG A;  4PKC C;  1BU1 A;  1YI2 T;  3X20 B;  4M75 A;  4ZTF A;  1YFN A;  4XTZ A;  3TEE A;  2LJ1 A;  4B6M A;  2HCK A;  3EG1 A;  4AFQ C;  3UT1 A;  4M75 G;  1Q7Y R;  2QA4 A;  3V8L A;  1Y07 A;  3CCE Q;  4PJJ A;  5J26 A;  2PVG B;  3TRE A;  3VS6 A;  1ZSZ C;  3JSC A;  5I2M A;  4NL3 A;  3LH5 A;  1CKB A;  2R5A A;  3LGL A;  2EQK A;  4C5E A;  1T0J A;  2MAM A;  1QLY A;  3QKJ A;  3WXM B;  2YRV A;  3I56 Q;  3O5Z A;  4PJO E;  1OPL A;  2F2W A;  2J7I A;  5DLQ E;  3JCM c;  1GCP A;  2K6D A;  3JCM P;  1Q81 R;  1IHW A;  1H8K A;  1WFW A;  1K76 A;  1ZHI A;  3H8Z A;  3HL8 A;  3M0P A;  3PE0 A;  2M9U A;  1VQO A;  2DXT A;  2KRO A;  2V8I A;  2HSP A;  1VQ5 A;  4DEY A;  3L2Z A;  3REA B;  1B3Q A;  3CC7 A;  4XTW A;  2LMJ A;  5LJ5 e;  1YBY A;  2QA4 T;  1AT1 B;  1BKB A;  2D0N A;  3SHW A;  3ULR B;  1PD1 A;  1M1K C;  3CMA Q;  3CC4 T;  2QDL A;  2FHD A;  3JAM E;  4M77 E;  4OB2 B;  4F7U A;  1N8R U;  1S72 A;  4F7U G;  1TH7 A;  2DIG A;  2LC4 A;  4LDV A;  3J81 E;  3CQT A;  1UEB A;  2KMT A;  2QDY B;  1WLP B;  5KYX A;  4XK8 E;  4P5N A;  4DA4 A;  2RI3 A;  2ENM A;  2J6O A;  2JMA A;  4PJO F;  3CC7 T;  3EG9 A;  1Y96 B;  2QQR A;  3VYG A;  2VYT A;  1M90 R;  1PSE A;  2X3W D;  2K7A A;  4RTW A;  3CCQ T;  1UJ0 A;  3DKM A;  1RAA B;  2XD0 A;  2EYY A;  4C92 B;  4ME7 A;  2LX7 A;  4R0K A;  1WX6 A;  1C1A A;  4C92 C;  2H8H A;  4KUI A;  2O2O A;  1X2Q A;  1TUD A;  4M77 F;  1NM7 A;  1WIE A;  2YLB A;  2NUP A;  2KQW A;  2CGH A;  5LJ3 h;  1ZLM A;  4FT2 A;  2KRN A;  5IH2 A;  1AZG B;  1BCO A;  2AK5 A;  1RAF B;  4JJD A;  1TU0 B;  2EYX A;  3ZL7 C;  4K11 A;  2EJ9 A;  4HVV A;  3EH1 A;  5LL6 S;  1F1B B;  2RA2 A;  2V1Q A;  3C4S A;  4J9F A;  2XMF A;  4Z89 A;  2JJ9 A;  4UC4 A;  2HD0 A;  3RIR A;  1WHJ A;  2CSQ A;  3JCM V;  3M0Q A;  2R57 A;  5GAM j;  4RKU E;  1ZQ1 A;  3VUZ A;  2J6K A;  3CCU T;  4BAC A;  2HQX A;  2CT4 A;  5GAN j;  2KI7 A;  1X2K A;  2ESW A;  5GAN 7;  2DRK A;  1G8X A;  3OYH A;  4LUE A;  3OA6 A;  2GBQ A;  4OMN A;  4KUD K;  3QJ6 A;  3PMI A;  1R0C B;  3MEW A;  2I2L A;  2DO3 A;  1G5V A;  3F70 A;  3OSV A;  3RBB B;  4C92 D;  5CAI A;  4MZP A;  1JJ2 P;  1ZBJ A;  2HSE B;  3QHS A;  4GLK A;  2X51 A;  1J3T A;  2GFU A;  3CD6 A;  1UGV A;  2FG0 A;  2K2V A;  3BY7 A;  2K2M A;  5AYF A;  4E7K A;  5HK3 A;  1AWO A;  2CP0 A;  1RAG B;  1FMV A;  2KT8 A;  2DMO A;  2V1R A;  2R58 A;  4IUU A;  1RAI B;  1NJI R;  2EYZ A;  3DB3 A;  1V29 B;  2EVR A;  2MWO A;  4MZM A;  2PQW A;  4X9C A;  3ER0 A;  4B9X A;  4E2F B;  2RHZ A;  4ELY C;  1N8R C;  3VS2 A;  1RI0 A;  3QWX X;  3CCE A;  2QQB A;  2LCL A;  3MPU B;  1Q81 U;  2O9S A;  1N9S A;  2EJG A;  2DVE A;  4XTV A;  5CKE A;  2AT1 B;  1JEG A;  2E5Q A;  3I56 A;  2IPO B;  4RTX A;  3VKI A;  2CS7 A;  4FU6 A;  3BDL A;  1U3O A;  3HRT A;  3MKD A;  4J9G A;  1K8A R;  4DQ2 A;  3L2U A;  2K5F A;  1YJN T;  5A2Q E;  1YJ9 Q;  5FRO A;  4BB7 A;  1TS9 A;  5KYY B;  1M8M A;  1UE9 A;  1OX9 A;  4OMM A;  1WXU A;  3CCE T;  1WHH A;  3MP1 A;  2E6Z A;  1QVP A;  3HPW A;  1KQS A;  4IUT A;  2H3E B;  2A3L A;  3CMA A;  3M4G A;  2EYW A;  3UA6 A;  2DZC A;  1AHJ B;  5CQX A;  2J05 A;  1VA7 A;  1FMK A;  3WVE B;  1EIF A;  4XU1 A;  2Y4X A;  2XK0 A;  5LJ5 g;  1M90 U;  2MIO A;  4LNP A;  2K3X A;  1G83 A;  1IZ6 A;  2X35 A;  4M75 B;  3MEV A;  4CRI A;  1D3B A;  4QVZ A;  2BIV A;  3G71 T;  4AFS C;  1Q86 R;  4QQD A;  5CQY A;  2FVU A;  1WPY A;  3EGX B;  2DET A;  5IN1 A;  3M0T A;  2QEX T;  2MYS A;  2YUQ A;  2GFA A;  1PKT A;  3G4S T;  1VUB A;  2LDM A;  4MDW A;  4EMG A;  3QII A;  3H0I A;  4OGE A;  1QMC A;  2CYZ B;  3CBP A;  3M4Y A;  5D6X A;  2VXF A;  3ZBD A;  3EG3 A;  1MV0 B;  2A08 A;  2DL3 A;  3I55 Q;  4IIM A;  4M7A D;  2DJZ A;  2W10 A;  3M56 A;  1GCQ C;  1HSQ A;  4HVW A;  2RQT A;  2DVJ A;  2DTH A;  3I5R A;  4A4H A;  2FPF A;  2DD5 A;  2HQH A;  4HVU A;  3OYJ A;  5GAN 8;  4ANJ A;  3A8M B;  4M75 D;  2VV5 A;  5GMK h;  4Y92 A;  2EGC A;  5KYX B;  1WZO A;  1PD0 A;  4HKE A;  3OYC A;  3CCL T;  2DJQ A;  3BDU A;  1NG2 A;  3VRY A;  5I2S A;  1IXD A;  4X9D A;  2RQR A;  2OTL T;  4Y28 E;  1D0Y A;  5L23 A;  4PJL A;  1NLP C;  3OW2 S;  4PJO B;  1JQQ A;  1KQ2 A;  3QO3 A;  3EFO A;  3QJY A;  5CKF A;  1I07 A;  2JN0 A;  1Q81 C;  4PJO C;  2RPN A;  1TWB A;  2E3I A;  1M8V A;  2RHI A;  3CCV T;  5J3B A;  1B34 A;  5GAO l;  1IRE B;  3VUB A;  1NJI U;  2OX7 A;  2NUP B;  4DBQ A;  1E6H A;  2DAQ A;  5FW9 A;  3OYA A;  1W1F A;  2O88 A;  1R0B G;  5GMK m;  4R55 A;  3EAE A;  4N0A A;  2CP3 A;  2HAX A;  4M77 C;  1KQ1 A;  3EFS A;  1JB0 E;  4FL6 A;  1SKU B;  1W4S A;  5GAN d;  2CP5 A;  1K73 U;  2E70 A;  3OMG A;  3I9Q A;  4IIO A;  2XI9 A;  3I5S A;  3QG1 A;  4BDY A;  2C06 A;  1M4Z A;  3NMZ C;  3VJP A;  4M7D E;  3DB4 A;  1AOJ A;  3S3M A;  1M90 C;  2BZY A;  2SEM A;  1VQO Q;  1RL2 A;  4HT9 A;  2ZPH B;  3SEM A;  1U06 A;  1X27 A;  2J6F A;  2ROL A;  4AFU C;  3H6Z A;  5L8R E;  2YUO A;  1X6G A;  4LDU A;  2COY A;  2NWM A;  1ARK A;  2AKL A;  1X43 A;  4R56 A;  1YJ9 A;  1KD1 U;  2DM1 A;  5HKC A;  3MP6 A;  2ZCF B;  4PLL A;  1FXX A;  3FJP A;  1QCO A;  2EFI A;  1JXO A;  3EHR A;  2LZ6 B;  3OW2 A;  3RER A;  1FWZ A;  1YIJ Q;  2YRC A;  1H3Z A;  2WSC E;  1ZUK A;  2V8J A;  2XG8 D;  2K9G A;  5GAO p;  3C0C A;  3R6O A;  2L5Q A;  4RUG A;  3C95 A;  2D8H A;  4OMQ A;  4M7D F;  1R8O B;  4QVC A;  1ZA1 B;  2EQM A;  2YDL A;  1LOJ A;  4F04 B;  4HCK A;  1Q86 U;  1VQN Q;  1M9S A;  1BIB A;  1SRM A;  1SPK A;  4M7D A;  2GTO A;  1TUC A;  7AT1 B;  1SSF A;  4M7D G;  1KSW A;  4LDW A;  5GMK i;  5C6S A;  4N4G A;  2J06 A;  4CI0 C;  2OTJ T;  2K5L A;  1SHF A;  2SRC A;  4KBM B;  3URG A;  4J5Y A;  3OB9 A;  1PG5 B;  3A8H B;  1MMA A;  1AWJ A;  4PK4 A;  3S6W A;  2RB6 A;  4XTX A;  2QQA A;  5GAN 6;  4M7A E;  4RTT A;  5GAN f;  3L2R A;  5CCA A;  3CME T;  3O8V A;  4XTY A;  2RQW A;  2P4T A;  4XAX B;  4J9B A;  2A36 A;  1QQJ A;  2CZ7 B;  3HFN A;  5CKH A;  3I55 A;  2JM9 A;  1AEY A;  4EMK B;  3OQ5 A;  1FX7 A;  2BE7 D;  1NJI C;  4EMK C;  2D6F A;  2DA9 A;  1AWX A;  5IXB A;  2JS0 A;  3QYG B;  5KH6 A;  3VS3 A;  4EDU A;  4J9I A;  3X26 B;  5FRN A;  2VXE A;  2DYB A;  4KT0 E;  1S1N A;  4DOW A;  2DZ9 A;  1D3B B;  1RLQ C;  1K73 C;  2LCC A;  2K57 A;  2YXY A;  2RK2 A;  4M7A F;  3FJ5 A;  3QPH A;  1YCY A;  3FIF A;  2HEQ A;  2F69 A;  2DK3 A;  2GF7 A;  4JJB A;  2WSF E;  2MI6 A;  4OML A;  1NEG A;  1NYF A;  1UTI A;  3I35 A;  3LLR A;  1UUE A;  3PIP A;  3CCM T;  5DM7 R;  2DNU A;  1M3C A;  4NL2 A;  3UA7 A;  3RKW A;  4M75 F;  2LRQ A;  4F7U E;  3SWN A;  3TSW A;  3KFV A;  1GBR A;  4BUG A;  5HK0 A;  3EGD A;  8AT1 B;  1KD1 C;  4X1V A;  4HA8 A;  3NFC A;  2EIF A;  2YUN A;  5AT1 B;  1H3H A;  1WNL A;  3AHU A;  2DXB A;  1YHQ T;  1RAB B;  5GAN 5;  2RHY A;  2B86 A;  4EIK A;  1NLO C;  4E7Z A;  1ZUU A;  6AT1 B;  5I11 A;  4LN2 A;  3JB9 G;  2K79 A;  1VQK Q;  3CXC S;  4ZGE B;  4E6R A;  3H9N A;  5GAM h;  1Q86 C;  1IB8 A;  2D0Q B;  1NPR A;  2JM8 A;  5J39 A;  5GAN h;  3TSZ A;  2O4X A;  4FCY A;  2JUF A;  2AZS A;  4F7U F;  2IIM A;  2NLU A;  1QVF P;  5GAN 3;  1RAC B;  2PVD B;  8ATC B;  2RJD A;  3H0F A;  4ZN3 A;  2DD4 A;  5D6W A;  2PZ1 A;  3JCM h;  2L3Q A;  3CC2 Q;  1D1A A;  2G3R A;  2CDT A;  2OAU A;  2RQV A;  1M1F A;  3HTR A;  4C0F A;  3VU3 C;  2P0K A;  4BI4 A;  1G2B A;  4WF2 A;  2EJF A;  4J8O A;  3FB9 A;  2LQ8 A;  4OVA A;  1YIJ A;  3U23 A;  1VQO T;  1VQ5 T;  3E19 A;  4RTY A;  3E1S A;  1C6V X;  1UEC A;  2NYS A;  1YN8 A;  1H92 A;  5EG2 A;  2COZ A;  2JZ2 A;  2WAC A;  1UFF A;  3M55 A;  2LX9 A;  5HCK A;  2DL5 A;  5LJ5 j;  1OU9 A;  1M1G A;  4PJM A;  2A37 A;  1VQN A;  3M58 A;  4M78 A;  1C0M A;  1YP5 A;  3NTI A;  4A4K A;  1S72 T;  4EPC A;  1GFC A;  4M78 G;  1XOV A;  3PVL A;  2L2P A;  3MEU A;  3LWH A;  2KR3 A;  2KRM A;  4E7L A;  1KG1 A;  2KAF A;  2L3P A;  3QDF A;  4AG2 C;  2X4J A;  4BDZ A;  1Q82 R;  2FZK B;  2RM4 A;  3CXC A;  1RAH B;  2EQJ A;  2DL4 A;  1KQS P;  1VIE A;  5A0L A;  1VQN T;  3VYH B;  2KEA A;  3FEO A;  3M54 A;  3JB9 H;  4TVR A;  4GLM A;  4X34 A;  4AFZ C;  3JCM e;  5FRM A;  3M57 A;  1SSH A;  4HT8 A;  1PHT A;  3N5B B;  4RTV A;  1AWW A;  2DKG A;  2MCN A;  1MMN A;  4A53 A;  1UGS B;  4L5G A;  1VQ4 Q;  4E7J A;  1VYV A;  2E6N A;  2RQU A;  3LX7 A;  4JPB W;  4BY6 B;  2XKO C;  1XTD A;  2I0N A;  3UWN A;  5GAO m;  4JRQ A;  1N5Z A;  4MZT A;  5KYW A;  1VQP Q;  1VYT A;  4BY6 C;  1UB4 A;  3GNG A;  4OGC A;  4M7D B;  2KDS A;  3A98 A;  2L3S A;  4XU3 A;  3REB B;  1WJQ A;  3G6E Q;  4M7D C;  4FSX A;  2EYQ A;  4Z8A A;  4ZGJ B;  3T9N A;  1D1C A;  2CP2 A;  2X4X A;  3VS7 A;  2BTT A;  3EG0 A;  5IHI A;  2CP7 A;  1WQW A;  3INZ A;  4AT1 B;  4FSS A;  1HJD A;  5LJ3 e;  1Q7Y U;  1GL5 A;  1T3S A;  1I5L A;  2LVM A;  1W2B P;  2RJE A;  1D0X A;  1NPP A;  2XID A;  3QSU A;  1PKS A;  2KK4 A;  1VQ8 Q;  2HKN A;  1BI1 A;  2JTE A;  3NGP A;  4KH0 B;  3CD6 T;  3OBY A;  3X28 B;  1SG5 A;  3EH2 A;  3MEA A;  4IKF A;  5ECA A;  4LDY A;  2DEU A;  3V8J A;  4PNO A;  2IVW A;  1BCM A;  1I4K 1;  2ED0 A;  2KYB A;  1VQK A;  2ED1 A;  1GXI E;  4GY5 A;  3MHX A;  4M7D D;  2E64 A;  2R5M A;  4LUD A;  3FRN A;  4JZ3 A;  4ELZ C;  4BD3 A;  2DXU A;  2G6F X;  1B07 A;  3QBY A;  2JT4 A;  3BE3 A;  1D0Z A;  4M7A B;  4C8Q A;  2K4Y A;  4QQ6 A;  3OS0 A;  3RUX A;  3CC2 A;  5DLO A;  4M7A C;  3I56 T;  3HHT B;  4C8Q G;  1GRI A;  4FW2 A;  5KCH A;  2YUP A;  3C12 A;  3EGD B;  3E9G A;  3JRZ A;  1PRL C;  1T0H A;  1UGR B;  4M75 C;  2BUD A;  4DBF A;  3P8H A;  4RTU A;  3CMA T;  3CCJ Q;  2VGN A;  2XDB A;  1NZ9 A;  1KIK A;  3OYN A;  3CPW P;  3TVT A;  5CIU A;  1NBE B;  1VQ9 Q;  3E9F A;  3MJX A;  2GGR A;  4JZ4 A;  3EG2 A;  1B7T A;  3M5A A;  1MV3 A;  2DBM A;  3TQ7 P;  1O9S A;  1VQ6 Q;  1EX4 A;  3OY9 A;  5A0G A;  5FLX E;  1WGS A;  2OJ2 A;  4BE1 A;  1M1K R;  1MND A;  2F5T X;  4DOV A;  2HZY A;  1H64 1;  5CVI A;  4F7U B;  3BW1 A;  2QQS A;  5GAM g;  1LVK A;  4HCZ A;  4XU2 A;  1TUG B;  2YHT A;  3G7Z A;  3OYF A;  1Q7Y C;  1NE8 A;  5GAN g;  1OQK A;  1ZSZ A;  1UHC A;  2CKK A;  3EG9 B;  4PFZ A;  5LJ5 d;  4ATO A;  3QWY A;  3M53 A;  3PMT A;  1QW1 A;  4CC7 A;  2COW A;  2QI2 A;  3GLX A;  3JB9 D;  1VQ4 A;  1K4U S;  4FM4 B;  2NUT A;  2A7Y A;  4M78 B;  2DIL A;  3JCM g;  2EPD A;  1VQP A;  3OYD A;  1KK7 A;  3G6E A;  1UDL A;  1YI2 Q;  2L8D A;  3MET A;  4KGV B;  2QG9 B;  1E7O A;  2X4Y A;  1KFZ A;  4C0D B;  2CH4 A;  3CCS Q;  2MF2 A;  4C0D C;  2B8A A;  1UHF A;  5GJW B;  4QT7 A;  1WHL A;  1K9M R;  3HRU A;  2ZGW A;  2XIC A;  1VQ4 T;  4LDX A;  2F5K A;  4LE9 A;  4EMH A;  3VS5 A;  1X75 C;  3M0R A;  3UPU A;  3ME9 A;  2KYM A;  2WSE E;  1Y7X A;  3ZEH A;  3L2Q A;  2E10 A;  4E7I A;  1VQ8 A;  2IG0 A;  1X6O A;  1SF9 A;  2CUD A;  3KBG A;  4JS4 A;  2O01 E;  3TU4 K;  1PRM C;  1OV3 A;  4A4G A;  3FLG A;  5LJ3 g;  3EFR A;  1K8A U;  4KUL A;  1G3T A;  3GBQ A;  3SB2 A;  5GMK e;  3CC4 Q;  4Z88 A;  3OMC A;  2A28 A;  4M78 D;  4ZTJ A;  2VC8 A;  1WA7 A;  2ZPI B;  4C92 A;  1OZ2 A;  5KYW B;  3GNF B;  1YNZ A;  3WVD B;  3OS2 A;  1NEB A;  1VOM A;  3V7S A;  1QVG P;  4RCC A;  2F2V A;  4CC3 A;  4FT4 A;  1RAD B;  1JU5 C;  2LNH B;  2QGG A;  2OI3 A;  1M3A A;  1HXD A;  3RMS A;  3JB9 J;  1KHC A;  2RHX A;  5LJ5 f;  1FYN A;  4JDS A;  3Q1J A;  3CCQ Q;  4PL6 A;  1PM3 A;  2ZPE B;  1LNX A;  2RI2 A;  2MMP A;  3V8K A;  2EGE A;  4QVD A;  1HD3 A;  1WHM A;  1QWF A;  1YJ9 T;  2AZV A;  2EQU A;  3QZ9 B;  3HKS A;  1TOV A;  1QWE A;  2P4R A;  1N8R R;  2YRD A;  2RI5 A;  3S3O A;  1MGQ A;  3PTA A;  4JS5 A;  2L0A A;  2RF0 A;  3CCJ A;  2E4H A;  3DLL A;  4JRP A;  2AKK A;  4FYX B;  2MWP A;  5CKB A;  2RJC A;  4A54 A;  1ACM B;  1UJY A;  1VQ9 A;  2FL7 A;  3CCU Q;  1A0N B;  4ORZ A;  1SRL A;  4FW1 A;  1P92 A;  4PFP A;  1VQ6 A;  1PC0 A;  4J9D A;  4M4Z A;  3TCJ A;  2KGT A;  1OEB A;  1MHN A;  2W0Z A;  2LCS A;  4KH1 B;  1M3B A;  2QTX A;  3CCJ T;  2JVV A;  4KGZ B;  2DE0 X;  1BBZ A;  4C8Q B;  2C0T A;  1K1Z A;  1XQH A;  3DLM A;  1MMG A;  1VQM Q;  2HDA A;  2O9V A;  4D8K A;  1T3L A;  3G1J A;  5C0M A;  4GBQ A;  3RES A;  1KHI A;  4NOY A;  2ATC B;  5KYN A;  2BE9 B;  5GAO n;  3PT9 A;  3A8O B;  4FYY B;  3H41 A;  1VQ6 T;  2MK5 A;  1BK2 A;  2E12 A;  2CZ1 B;  1Q95 G;  1TTH B;  3I55 T;  1PNJ A;  2KVQ G;  1YWO A;  2AHJ B;  4BE2 A;  3EGU A;  2XDP A;  4O6J A;  4PLI A;  5CO7 A;  1K8A C;  2RMO A;  2KBT A;  3JCM Q;  4OB3 B;  2EGA A;  1K9M U;  5LJ5 h;  4JUV A;  1YI2 A;  1OX8 A;  1FMW A;  1G3Y A;  2HBW A;  1QCN A;  3GOX A;  5KYY A;  2X4W A;  3LWI A;  4J9E A;  3CCS A;  2VKN A;  2KXC A;  3A8L B;  2X9H A;  4FYV B;  1VYU A;  2RHU A;  1X69 A;  4F17 A;  3JB9 F;  2VAS A;  4KGX B;  5IHK A;  1TSF A;  1QKX A;  2QYZ A;  4C8Q D;  4N4I A;  2CP6 A;  1W70 A;  1JBM A;  1YJN Q;  1GBQ A;  4M78 E;  4JJN K;  3MP8 A;  3H0H A;  1ZUY A;  5GAO r;  1U1T A;  3CCS T;  3FC3 A;  1ZSZ B;  3JCM J;  5IHN A;  3CBO A;  5GMK l;  1YIT Q;  3CC4 A;  3EGX A;  1Y57 A;  2JNG A;  5GAN 4;  4NS5 A;  2NUT B;  4J6W A;  3OYE A;  2KY9 A;  3EFO B;  4RCB A;  4JRK A;  3V7R A;  1I0C A;  5CR2 A;  3OYB A;  3LYI A;  2GQI A;  2DRM A;  4OMO A;  4QQG A;  1B34 B;  2HBP A;  2CSI A;  4RMO A;  4J83 A;  3RKX A;  4XU0 A;  2YWW A;  2QGF B;  3KUF A;  3OYY A;  2D1X A;  2DL7 A;  4FIB A;  2Z0W A;  3G71 Q;  3QDR B;  2FRY A;  1OU8 A;  3CCQ A;  1GCQ A;  5HY6 A;  4M78 F;  4IUP A;  2ZZD A;  2CRE A;  4N0A C;  2QEX Q;  4E7H A;  2EQI A;  1PSF A;  2DTI A;  3G4S Q;  2VWF A;  1V1C A;  2K3Y A;  2ZPB B;  3OYI A;  2LQK A;  4F14 A;  1BI0 A;  5KCO A;  3CCR Q;  1BI2 A;  3CEY A;  1YIJ T;  2FEI A;  2LQW A;  1QVF S;  4J7I A;  4E7S A;  4PJO A;  2E41 A;  3X25 B;  5GAM e;  1QP2 A;  3FDR A;  4IUV A;  4PJO G;  2YSQ A;  5GAN e;  2PNI A;  3AT1 B;  4II1 A;  3CCU A;  1IGU A;  1G3W A;  4Y91 A;  2Y4Y A;  2DEQ A;  1XNI A;  2HL5 C;  3UAT A;  3CCL Q;  1UG1 A;  3MO8 A;  2EKO A;  2K3B A;  1K9M C;  3NTH A;  2O31 A;  2C0O A;  4M77 A;  3M0S A;  2OTL Q;  1VIF A;  4C0Z A;  3VV0 A;  2PUO B;  4M77 G;  4O5V A;  2CZ0 B;  1TXQ A;  2GQV A;  1VQM A;  1ZSG A;  1LCK A;  1AVZ C;  2RN8 A;  2VUB A;  2A0F B;  3CCV Q;  3L1A A;  2KT1 A;  3GPL A;  4C5H A;  2LP5 A;  2KRS A;  2L3R A;  1LPL A;  4BE0 A;  1Z9Q A;  3A8G B;  3EHQ A;  2E5K A;  1KJW A;  4PFO A;  2FO0 A;  5FU7 B;  1KQS S;  1BB9 A;  3M59 A;  3JCM W;  1VQM T;  2EW3 A;  5FU7 C;  2PVO B;  3SFM A;  4C8Q E;  1PCX A;  2RNA A;  4L6V 5;  1QVF A;  3VRZ A;  2QK0 A;  4B9W A;  2D8J A;  1E6G A;  1YWP A;  1TG0 A;  4E47 A;  4QW2 A;  4QKU A;  1M2V A;  2M02 A;  3L2W A;  1X6B A;  5I21 A;  3RNJ A;  2QTV A;  2EKH A;  1ZBX A;  3IQL A;  1D1B A;  1K0S A;  1K0X A;  5KYU A;  1BIA A;  5DY9 A;  2M16 A;  2Y90 A;  1RUW A;  4ESR A;  1YJN A;  1CSK A;  2DLP A;  2ZAE A;  1NYG A;  4VUB A;  4JJC A;  5FU6 B;  3M0U A;  3ASK A;  1M5Q 1;  5FU6 C;  2AIR B;  1JJ2 S;  5LJ3 j;  1VQ7 Q;  1RI9 A;  4IUR A;  2F2X A;  4LD9 K;  1YIT A;  3JV3 A;  3OYM A;  1K73 R;  1WDX A;  1O75 A;  1YJW Q;  1V76 A;  4C8Q F;  2BZ8 A;  1JRI A;  2C0I A;  1RLP C;  3MCA B;  2RD1 A;  3KXT A;  5IXF A;  1KC8 R;  4AMC A;  1W2B S;  3BFM A;  3QZ5 B;  1VQK T;  1N6A A;  2HL3 A;  2KE9 A;  2DYI A;  2X3X D;  1OYX A;  4MMK A;  3SWN B;  2DER A;  3PNW C;  3SWN C;  4BI3 A;  4OB0 B;  3G71 A;  1YIT T;  4EMK A;  2OTJ Q;  1KD1 R;  2QXF A;  1QCF A;  4J9C A;  2HKQ B;  4DBH A;  2EBP A;  3QYH B;  2RO0 A;  3JCM X;  2QEX A;  4XQ3 A;  4HXJ A;  3NTK A;  4WCI A;  3G4S A;  4D6W A;  2GCX A;  2PU9 B;  2E3H A;  2ECZ A;  3CC2 T;  1ABQ A;  1WI7 A;  3PFS A;  3UF4 A;  3CME Q;  1M2O A;  1Q82 U;  2JXB A;  3CCR A;  2LNV A;  3J80 E;  2V8K A;  4JRI A;  4J7F A;  2FB7 A;  4DBR A;  1I5O B;  4LD6 A;  2O4X B;  4F16 A;  5CKD A;  1VQL Q;  5GAN 2;  4OB1 B;  2M1H A;  1CKA A;  3GP8 A;  2H3J A;  2LQN A;  3OW2 P;  1JJ2 A;  4HCC A;  3CBM A;  4OMP A;  3HP9 A;  1X01 A;  2ZPF B;  5FWC A;  1EFN A;  3JCM b;  1MMD A;  4MDX A;  1BYM A;  1XJW B;  3CCL A;  3CCR T;  2P84 A;  5A0D A;  2JTF A;  2NUZ A;  2OTL A;  4RTZ A;  4KRT A;  2L89 A;  4OMF B;  4J6X A;  2DIQ A;  1W2B A;  1N27 A;  2V26 A;  3RMQ A;  2FYK A;  2K5I A;  5IT9 E;  3CPW S;  2GNC A;  3CCM Q;  2YLC A;  1N9R A;  3CCV A;  3RDV A;  1W6X A;  4JLG A;  4DEX A;  4N4H A;  4M78 C;  2DTO A;  3V7C A;  2VB6 A;  1LJO A;  4C92 E;  4IUQ A;  4C5G A;  2QAS A;  2D9T A;  4OF1 A;  3D7S B;  2F1L A;  2M0O A;  5D6Y A;  4CC4 B;  3PGG A;  3HSB A;  4ZNX A;  2QQ9 A;  1YHQ Q;  1ABO A;  2EAY A;  2CH4 W;  2ABL A;  1MUZ A;  2YT6 A;  2MPX C;  1QKW A;  1WXT A;  1OPK A;  1Y0M A;  1OOT A;  4MML A;  2DX1 A;  5FWB A;  5KE2 A;  4A4E A;  1JO8 A;  1OI1 A;  2M0Y A;  1VQP T;  1IHV A;  1UGQ B;  2VGM A;  3QXE B;  1MNE A;  2DL8 A;  2QAZ A;  3G6E T;  2RJF A;  1DJ7 B;  2KXD A;  2DFU A;  2JMC A;  1HYO A;  2OAW A;  4C0G A;  3THK A;  2RH2 A;  4M77 B;  1HK9 A;  3VS0 A;  2E65 A;  1Y96 A;  2CT3 A;  2JOY A;  2FZG B;  2QA4 Q;  1AZE A;  1U1S A;  3RKY A;  4C92 F;  5GAM d;  2DXC A;  2KSS A;  2FRW A;  4BI8 B;  2EWN A;  2XDD A;  2JS2 A;  1I81 A;  1SEM A;  2P0P A;  1VQ7 A;  1UGP B;  1JXM A;  1WYX A; 
#chains in the Genus database with same CATH homology
 2HBW A;  2MIO A;  4LNP A;  1G83 A;  4GLM A;  5GJV B;  1ZX6 A;  2MOX A;  4AFZ C;  4J9E A;  2VKN A;  2KXC A;  1SSH A;  1PHT A;  1VYU A;  1X69 A;  4F17 A;  3PVQ A;  4AFS C;  5IHK A;  2FPE A;  4RTV A;  1AWW A;  1AD5 A;  1QKX A;  1WXB A;  2MCN A;  3M0T A;  2ROT A;  2YUQ A;  1PKT A;  1VYV A;  2RQU A;  4JPB W;  2DF6 A;  4A63 B;  1W70 A;  2I0N A;  1N5Z A;  1VYT A;  1GBQ A;  1U5S A;  3H0I A;  2FPD A;  1PWT A;  3A98 A;  2L3S A;  3REB B;  3H0H A;  1ZUY A;  2BZX A;  4Z8A A;  2GTJ A;  5IHN A;  2KNB B;  3EG3 A;  1MV0 B;  2A08 A;  2DL3 A;  4IIM A;  3VS7 A;  1JXM A;  2BTT A;  3EG0 A;  5IHI A;  1Y57 A;  1Z9Z A;  2W10 A;  1GCQ C;  4FSS A;  1HJD A;  1HSQ A;  4HVW A;  2RQT A;  2DVJ A;  1GL5 A;  3I5R A;  1I0C A;  1T3S A;  2FPF A;  4HVU A;  5EC7 A;  2GQI A;  2DRM A;  4OMO A;  1PKS A;  2CSI A;  4Y92 A;  2EGC A;  2JTE A;  3NGP A;  2DJQ A;  3VRY A;  1NG2 A;  3NHN A;  2D1X A;  2DL7 A;  2LJ0 A;  2RQR A;  2FRY A;  5I22 A;  5ECA A;  1GCQ A;  5L23 A;  4D8D A;  1NLP C;  2CRE A;  1JQQ A;  4J9H A;  2EQI A;  1I07 A;  2ED0 A;  2KYB A;  2RPN A;  2VWF A;  1I1J A;  2ED1 A;  2LJ3 A;  1V1C A;  2JW4 A;  3R6N A;  2DBK A;  4F14 A;  4LUD A;  4AG1 C;  4JZ3 A;  1E6H A;  1K9A A;  5FW9 A;  1W1F A;  2O88 A;  2FEI A;  2G6F X;  2LQW A;  1B07 A;  2JT4 A;  3NPF A;  2CUB A;  2VVK A;  4CC2 A;  2YSQ A;  2PNI A;  3VS1 A;  1M27 C;  1GRI A;  1YCS B;  3I9Q A;  4IIO A;  3I5S A;  2YUP A;  3NMZ C;  3UAT A;  1M30 A;  1PRL C;  1UG1 A;  1AOJ A;  2K3B A;  1T0H A;  1IO6 A;  2BZY A;  2SEM A;  2O31 A;  2C0O A;  3M0S A;  3SEM A;  1U06 A;  1X27 A;  1SHG A;  2J6F A;  2ROL A;  1GFD A;  4RTU A;  4AFU C;  2M51 A;  3VS4 A;  2YUO A;  1X6G A;  1KIK A;  2PTK A;  1ZSG A;  2NWM A;  1LCK A;  1ARK A;  3TVT A;  2AKL A;  1X43 A;  1AVZ C;  2RN8 A;  2DM1 A;  2KT1 A;  2GGR A;  1BU1 A;  4JZ4 A;  3EG2 A;  1JXO A;  3EHR A;  2LZ6 B;  2LP5 A;  1MV3 A;  2LJ1 A;  2DBM A;  2HCK A;  3EG1 A;  2KRS A;  4AFQ C;  1Z9Q A;  3VS6 A;  1ZUK A;  3EHQ A;  2E5K A;  2OJ2 A;  3LH5 A;  1CKB A;  2K9G A;  3C0C A;  1T0J A;  1KJW A;  4RUG A;  1QLY A;  2D8H A;  2FO0 A;  4OMQ A;  1BB9 A;  2YDL A;  2EW3 A;  3O5Z A;  1OPL A;  2F2W A;  2J7I A;  4HCK A;  1GCP A;  1SRM A;  2K6D A;  2RNA A;  1H8K A;  1WFW A;  1K76 A;  1SPK A;  3VRZ A;  2GTO A;  3M0P A;  3PE0 A;  2D8J A;  1E6G A;  1TUC A;  1YWP A;  2KRO A;  1TG0 A;  2HSP A;  4DEY A;  3REA B;  1B3Q A;  1KSW A;  2J06 A;  2LMJ A;  1UHC A;  2SRC A;  1SHF A;  1X6B A;  3QWY A;  2D0N A;  3SHW A;  3ULR B;  3RNJ A;  2EKH A;  4CC7 A;  3IQL A;  1K0S A;  1K4U S;  1K0X A;  2QDL A;  1AWJ A;  2DIL A;  2EPD A;  1RUW A;  4ESR A;  1CSK A;  2DLP A;  1NYG A;  4JJC A;  4RTT A;  3M0U A;  1UDL A;  1RI9 A;  2RQW A;  3CQT A;  4J9B A;  2A36 A;  2F2X A;  1WLP B;  1E7O A;  1KFZ A;  2ENM A;  2J6O A;  2JMA A;  2CH4 A;  3JV3 A;  1WDX A;  2JM9 A;  1AEY A;  1UHF A;  2BZ8 A;  5GJW B;  4QT7 A;  2C0I A;  2DA9 A;  2X3W D;  2K7A A;  1RLP C;  4RTW A;  1UJ0 A;  1AWX A;  5IXB A;  2JS0 A;  4LE9 A;  3VS5 A;  3M0R A;  2EYY A;  2KYM A;  3VS3 A;  5IXF A;  4J9I A;  2LX7 A;  4R0K A;  1WX6 A;  2DYB A;  1S1N A;  2KE9 A;  2H8H A;  2X3X D;  2O2O A;  1X2Q A;  1TUD A;  2CUD A;  1NM7 A;  1RLQ C;  1PRM C;  1OV3 A;  1WIE A;  1ZLM A;  3FJ5 A;  2KRN A;  5IH2 A;  1AZG B;  1QCF A;  2HEQ A;  4J9C A;  2AK5 A;  4JJD A;  2EYX A;  3GBQ A;  3ZL7 C;  2EBP A;  4K11 A;  4HVV A;  4JJB A;  4HXJ A;  4Z88 A;  4OML A;  4WCI A;  1NEG A;  1NYF A;  1UTI A;  2V1Q A;  3I35 A;  2A28 A;  4J9F A;  2XMF A;  4Z89 A;  1UUE A;  1WA7 A;  2DNU A;  1M3C A;  2CSQ A;  3UA7 A;  2ECZ A;  1ABQ A;  3M0Q A;  1YNZ A;  1WI7 A;  1NEB A;  2J6K A;  3UF4 A;  3TSW A;  2CT4 A;  2JXB A;  3KFV A;  2F2V A;  4CC3 A;  1GBR A;  1X2K A;  2ESW A;  2DRK A;  1JU5 C;  2LNH B;  4LUE A;  4X1V A;  2YUN A;  2OI3 A;  1M3A A;  1H3H A;  2GBQ A;  4F16 A;  4OMN A;  1CKA A;  1FYN A;  2B86 A;  4EIK A;  2LQN A;  1NLO C;  1ZUU A;  5I11 A;  4LN2 A;  4OMP A;  3RBB B;  5FWC A;  2K79 A;  2EGE A;  1EFN A;  1HD3 A;  1QWF A;  1ZBJ A;  2AZV A;  4E6R A;  1J3T A;  1UGV A;  1QWE A;  2FG0 A;  2P4R A;  2NUZ A;  2JM8 A;  2K2M A;  3TSZ A;  4RTZ A;  4KRT A;  1AWO A;  2AZS A;  2KT8 A;  2IIM A;  2L0A A;  2RF0 A;  2DMO A;  2V1R A;  2AKK A;  3H0F A;  2EYZ A;  2GNC A;  2EVR A;  2PZ1 A;  1UJY A;  1W6X A;  2L3Q A;  4DEX A;  2CDT A;  2RQV A;  1G2B A;  1A0N B;  4ORZ A;  1SRL A;  3U23 A;  3VS2 A;  4J9D A;  3QWX X;  4M4Z A;  4RTY A;  2KGT A;  4CC4 B;  1UEC A;  2O9S A;  1OEB A;  1YN8 A;  4ZNX A;  1H92 A;  1ABO A;  2W0Z A;  2CH4 W;  2ABL A;  2LCS A;  1UFF A;  1M3B A;  5HCK A;  2DE0 X;  1MUZ A;  2DL5 A;  1BBZ A;  2YT6 A;  1QKW A;  2C0T A;  1JEG A;  1WXT A;  4RTX A;  1OPK A;  1U3O A;  1OOT A;  1Y0M A;  2A37 A;  2DX1 A;  5FWB A;  1K1Z A;  4J9G A;  1YP5 A;  1JO8 A;  2HDA A;  2O9V A;  4D8K A;  1T3L A;  2M0Y A;  1GFC A;  4GBQ A;  1XOV A;  2DL8 A;  3PVL A;  2L2P A;  1M8M A;  3H41 A;  1UE9 A;  2KR3 A;  4OMM A;  1WXU A;  2KXD A;  2KRM A;  2JMC A;  1BK2 A;  2OAW A;  2L3P A;  3THK A;  4AG2 C;  3VS0 A;  2CT3 A;  1AZE A;  1PNJ A;  2EYW A;  3UA6 A;  1YWO A;  3EGU A;  2DL4 A;  2FRW A;  2J05 A;  1VA7 A;  2RMO A;  2KBT A;  1FMK A;  2EGA A;  2JS2 A;  1SEM A;  2KEA A;  1WYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...