2JMGA

Solution structure of v7r mutant of hiv-1 myristoylated matrix protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
131
structure length
131
Chain Sequence
GARASRLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Point mutations in the HIV-1 matrix protein turn off the myristyl switch.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Gag polyprotein
total genus 33
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2006-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2jmgA01
2H3ZA 2JMGA 2NV3A 4IC9A 2N1RA 2H3IA 2GOLA 1TAMA 2K4EA 1UPHA 1A6SA 1ED1A 2H3FA 1L6NA 2LYBA 2H3VA 1ECWA 2LYAA 4JMUA 2K4IA 2K4HA 1HEKA 4ICAA 2H3QA 1HIWA 2HMXA
chains in the Genus database with same CATH superfamily
2LBOA 3T5JA 4B9UA 4NWIA 2LMRA 4NLBA 5IIIA 5DLGA 1ZXIA 3RJJA 4KLIA 3JPTA 1ZQDA 2BGWA 4C0ZA 2ZUBA 4F91B 3WK9A 2WF8A 2DKZA 4EEKA 3Q8RB 2IA6A 1FFVA 2HHUA 3CP8A 5CJ7A 4YMMA 1B0XA 2R8JA 3K75D 4DL7A 7ICMA 1S10A 5CRXA 4RT2A 1SGGA 3TFRA 2XICA 1L3TA 4UB3A 2DGZA 5J0UA 1Z00B 4NLCA 2ALZA 1X40A 4F4YA 3IN5A 4B9TA 1XSNA 4R64A 1ZQKA 3PY8A 4UAWA 2AGOA 4DFKA 5E79U 8ICWA 1X6IA 1FO4A 4UB2A 4ICAA 1K1QA 4O5EA 3OJUA 3T5LA 4M9HA 4DQSA 4QJFB 4DQQA 3F5AA 4WJ3B 2K89A 4US8A 5AM2A 4ED0A 4EX7A 1NK8A 3H8JA 2G5IB 1NZBA 4PHEA 4F71A 2HBLA 2VA8A 2D8CA 3MDCA 4RPYA 4LZDA 1S0OA 4DSLA 4E0DA 2E8PA 2CXYA 4F4XA 4UAZA 5ALSA 3H4DA 4ECYA 4DS5A 1ZRMA 3IRUA 5T14A 1NK9A 2BCUA 3HP6A 3TADA 3NVZA 4DOCA 8ICLA 4DQIA 4TQRA 3AU6A 2C2DA 5DG8A 1YZ6A 1L7OA 5DQHA 4P4MA 1ZQXA 4RQNA 1NZPA 4QWCA 4I2JA 1ZYQA 4RQ6A 1ZJNA 4F5NA 4UAUA 1KKXA 3N7SC 5KTQA 2VA3A 4Y2QA 4J9LA 9ICBA 9ICOA 4PGQA 4QZHA 5AKGA 2LYAA 5AM1A 1ZQYA 3I28A 1HEKA 3NASA 3RB6A 2ZJ5A 1ZD3A 2AQ4A 4QWAA 4NLNA 2ZXIA 5EE0A 2DFLA 5ALEA 1XSPA 1L7MA 3AQFA 1SV0C 1XC9A 2HOFA 2E1EA 4Y2UA 4NL9C 9ICGA 3LK9A 3IG8A 3GV5B 1SKWA 2DPJA 2PMZC 4FZNA 1RPLA 5AKZA 2NRZA 2UVVA 2PKEA 2L5YA 5DG7A 4F93B 1NK0A 3A0HU 2UVWA 2DUYA 8ICPA 4J9OA 4NLZA 8ICEA 5L1MA 2FLPA 1FFUA 4KN4A 3MR5A 3E2EA 1KFTA 5DG9A 2FI1A 4EBDA 1QQ7A 3HKZF 4UB6U 2KHQA 2GO7A 3D6JA 1Z19A 5KFCA 8ICZA 3BS7A 5AKJA 4ECVA 2AGPA 4F92B 3BJYA 2ASLA 4LZGA 4QZIA 5KFBA 2HI0A 2XCPA 3F53A 4DLEA 5KG3A 3WKAA 1KN5A 5BOMA 4USAA 1BPBA 2HSZA 1KBUA 1PK1A 4YCXA 1N61A 2J6UA 3BQ7A 1GO3F 3ETLA 2PFPA 5J0WA 5IIOA 2D3DA 4QW8A 4CDGA 9ICRA 2EANA 1HJPA 1U9LA 4PHDA 4ECTA 5AM0A 2EAPA 2FE9A 1X2IA 2J6TA 2CPRA 2QLTA 1V97A 4O9MA 3BS5A 3FDSA 2W3RA 2OH2A 1MC8A 2HHXA 5AI8A 2GWSA 5A0LA 2KMDA 2P35A 3QU9A 3BQ0A 1V85A 3Q8PB 2F76X 4UB8U 1U48A 2NO5A 4DLGA 4QZ8A 4C8LA 3AU2A 2KVSA 4RQ2A 3BQ2A 1ZQIA 3QUBA 3QE9Y 2ZUCA 2Y1IA 2LYHA 2EAMA 5CEHA 5AI5A 5DQIA 2XIDA 3QZ8A 1QTMA 1NJWA 2E8OA 1ZQTA 3KZIU 9ICJA 5KT4A 4R66A 3F2CA 4EYHB 4CGZA 4C4RA 4QZFA 2A1JA 1KFSA 2QARA 3BS5B 1ZQGA 1BPDA 4PZOA 3M7DA 1ZQEA 2M9NA 3GQCA 4DQPA 4M2YA 4RQ0A 4KITB 1RQLA 4NY8A 3NRWA 3I1YA 5J2KA 3ORYA 1UA0A 2ODGA 4IRCA 3NUQA 2HHWA 2G06A 2LM1A 2C2RA 5KT5A 3FAHA 2ZIVA 3UXNA 3KZXA 3IP4B 5AM5A 5HR6A 4YQWA 4RQ8A 2WF6A 1ZRNA 5JUMA 3IV6A 5G5HA 4I29A 5J0XA 4RT3A 5DB6A 2XVTA 4O3SA 3SD7A 3PVXA 9ICQA 3FYHA 1ZD5A 1N56A 3HW8A 3KHGA 1B43A 4MF2A 3VC8A 1IXRA 2KHVA 5ALQA 1PVPA 3SYZA 3GILA 3JPSA 4G9BA 3RTVA 4DQRA 8ICIA 3KKAA 1XSLA 2HW3A 2KD1A 3AMZA 2WAQC 4MEXA 3SMVA 1X9WA 2RLTA 4RQ3A 4M9LA 1JMSA 2IOHA 3IHQB 5KNIA 4MHVA 5ALHA 2JEGA 2H3FA 5J8YA 2MA1A 1WYGA 5KFRA 4BUGA 2FLNA 4DL6A 4KN7A 3C28A 5F3XB 3T5KA 4ZH4A 5C5JA 4MFCA 4I2IA 5DDMA 1RYSA 1PK1B 3WKEA 2W9MA 7ICTA 2OWOA 5J8YC 4ELTA 1OW5A 3I76A 3GV8B 4KLTA 4KLDA 1CI4A 2W9BB 4JV0A 3HX0A 4C8KA 1XO0A 1WCLA 2I9GA 1X42A 3RJGA 3H8SA 2NRTA 3D2NA 9ICMA 4QZAA 2WB1F 1D9DA 1PZNA 3UPQA 4KMOB 3RFAA 5AI9A 5DLFA 4CNQA 2KVCA 4NLGA 2JEIA 1F5SA 3MGIA 2FLLA 9ICVA 3K1RB 5ALLA 2BPGA 4FE3A 1IV8A 3PX6A 2RDJA 2YTUA 1LKYB 1NKBA 5KFWA 3RBDA 5CP2A 4IQTA 2LHTA 2WF5A 2WB1C 1K1SA 2YQEA 9ICNA 9ICAA 4AYBF 3SV4A 4ED1A 3BZKA 9ICXA 3BDPA 1CEZA 5CB1A 2JEJA 3TANA 5IIMA 3SAHA 2I6XA 4ECUA 3EPIA 5GTIU 2HOQA 5KFMA 8ICVA 5AICA 1SIJA 1RZTA 1IM4A 5L9XA 4MFFA 4QNLA 5ALPA 2E5SA 4NJ8A 5EE3A 5AI0A 4DSJA 1X9SA 2BDUA 1RXVA 9ICPA 3C2KA 2ZXHA 5AKEA 4QZDA 2R18A 3TAPA 2RRDA 1S76D 4CF5A 2LPEA 5ALVA 1L5UA 1Z4OA 2MAXA 3MFHA 3RBEA 4PPXA 5KT2A 2JH7A 1KFDA 4XA5A 5ALNA 3LWLA 1JIHA 4JMUA 5AIAA 3TQ1A 5KFAA 3SR6A 2Z7JA 8ICAA 8ICHA 1WWUA 9ICHA 1X9MA 3B0YA 4P4PA 3KKAC 2JHDA 8ICBA 5B66U 2XGPA 5AM3A 1P7DA 2P6RA 7ICQA 5IINA 2GOLA 5HR7A 1BPXA 3DV9A 5DB9A 2ZIVB 1LVHA 5KFPA 1L8LA 2KEYA 5EWEA 4EBCA 8ICNA 4DL3A 1TKDA 1ZQZA 4DSKA 1U47A 4KX5A 4K4IA 8ICRA 2PMZF 4US9A 3QX7A 5ALOA 1NKEA 1NJYA 2A1JB 5H2FU 4J9QA 2ATLA 1B22A 1TVAA 2HHVA 2EZYA 4R63A 4C8NA 4ELUA 4NM2A 1ZQRA 1HUOA 2ESEA 1QH9A 5L1IA 2Y9TA 4K4HA 3MBYA 2ZIUA 4UB4A 4KLJA 3M9MB 4MF8A 2KIVA 4Y2PA 1OUQA 4KLHA 4KX3A 3RF9A 4JWMA 1BPYA 5J0TA 2KFZA 1L7NA 1ZQPA 7ICJA 3T3FA 3TAQA 2R8HA 5L1LA 3CW2C 4GC7A 1SL0A 1JUDA 5TZVA 1DGSA 3V7JA 2H3VA 2UVUA 2ZIXB 7ICEA 1C7YA 3DDHA 2ES6A 3KHLA 2R8IA 1PVQA 3LDAA 5AKYA 5EWFA 1ZQMA 1RQNA 2GH1A 3RJFA 1Q46A 5J2CA 1UA1A 3PNCA 3UQ2A 4M47A 3RB3A 2K4EA 2BCQA 1L7PA 2MUTB 3QU5A 3PR4A 5J2FA 3KTQA 5HMLA 8ICTA 5KFDA 2AU0A 2PFQA 1V9PA 4PL1A 3QXGA 3QU2A 4EYIB 2WTFA 7ICGA 3F2BA 2ZJAA 5ALMA 5KG6A 2RP5A 5AKLA 4DFMA 3QEAZ 3PW5A 2W43A 3QUCA 4JV1A 9ICUA 2KICA 3PSTA 4OJOA 2GLEA 2W8KA 4I2GA 3WKBA 3EYZA 2K8CB 4QZGA 4ECXA 2K4IA 3GU3A 2KJ9A 2B0CA 5J2HA 3MGVA 9ICCA 5KT3A 7ICVA 2EAOA 3H0RB 4IC9A 2N1RA 3U26A 4O5CA 5KL1B 3PV8A 1JXEA 3OSPA 1T94A 2EH9A 3HRDD 2RDIA 3TADC 1AQ6A 2P66A 3GIMA 2YB1A 5KG1A 1L3SA 1TK0A 5KAIU 2G08A 2OYYA 3C29A 3DEEA 3FM9A 1Z3EB 2JXJA 4RU9A 4YD2A 4FS2A 1NKCA 5HP4A 4TUSA 4ZOHC 1V38A 4ECWA 4UBBA 5KT6A 1IIPA 3M8RA 4ECRA 3T79A 3RJKA 3ZD9A 3C5GA 2IHMA 4F4KA 2K8AA 4IQWA 4Z6EA 3PZPA 4UB1A 8ICMA 4DOAA 3ZI4A 2BPCA 5KFJA 4YG2A 4O3QA 5EOZA 1U4BA 5AK5A 2HMXA 3VCBA 4KLUA 2LI6A 4DSEA 1SB3C 5KFTA 4LVSA 2CN1A 5KFOA 2FDRA 2DBYA 2WHEA 4NL9A 4OO1J 1Z1BA 3PSIA 5KG5A 1YT3A 2W9AA 1B4FA 3KHHA 3LWMA 3N4MB 3SEIA 3H8MA 4BXOB 3C21A 1XWLA 4DOBA 5KG7A 3PR5B 5CA7A 7ICRA 3AEVA 2Y9UA 4KMUA 2LYBA 4Q8FA 9ICTA 5AK4A 1H38A 2YN4A 1UCVA 1KL9A 5IIJA 4GFJA 3TARA 4FS1A 4DSFA 3H4BA 1N2XA 2ZIUB 5AHXA 4M0AA 3IDWA 2OCEA 5DQGA 1U49A 5DBAA 3JPOA 2KZ3A 5DGAA 4J9KA 3EWAA 2KZMA 2F1HA 3RH5A 1S0MA 2HOIA 1TFRA 3L5KA 2FPLA 2FPMA 3RB0A 3RJIA 1QSLA 2XGQA 5AIBA 5J2DA 1J2NA 1QQ6A 2A19A 1UT5A 4BWJA 1JALA 1WG8A 2I5HA 1WWVA 4XQ8A 7ICIA 5KFQA 2YB4A 4O3RA 4GC6A 4ED6A 4NXZA 7ICOA 4FZMA 4PHAA 2OHFA 3F5EA 4CF3A 2V4QA 1PK3A 4M9NA 2HHQA 1HIWA 2G07A 1OXJA 5AKIA 5KFNA 2F3NA 4EENA 1Z1VA 4C4TA 3QUQA 1J2MA 4QWBA 4I2CA 4DL2A 4P2HA 5JRTA 2KZZA 4IRDA 4F4WA 1K5OA 3B0XA 5DGBA 4Y2TA 3ZD8A 4R8UA 2H3IA 2KOBA 3V7LA 5J0SA 1S97A 3UMGA 1KSPA 4YXJA 5L1JA 5BOLA 3HILA 4F2RA 5DB8A 2JR5A 4C4SA 4DFJA 5IILA 3Q8MA 3BQTA 1X66A 5J2EA 2W04A 1F44A 1ZQLA 4M6WB 2B6GA 2AQ0A 4UAVA 5DBCA 1QCKA 1N5XA 1BNPA 2KKPA 2KJ5A 3RR8A 1S0VA 3CYMA 2NO4A 3N7PD 4I2HA 4OD0A 4Z6CA 4UBCA 2O6KA 3V6HA 2F1JA 1XO1A 3C5FA 3H8WA 1DXSA 2IHNA 2NYVA 4KLMA 2DQNB 1KQQA 5AM4A 4DL5A 1NJZA 2FPKA 4UAYA 4Y2SA 2HBMA 3ISDA 4YR0A 4CRXA 2W03A 2W7PA 4RNMA 2HDOA 4J9SA 2G0AA 1UPHA 1YZ7A 1O08A 1ZQCA 3GIJA 2BKEA 9ICIA 1XNSA 2YMLA 3N28A 2W55A 2AXTU 2KE7A 1L8OA 3NVWA 4P4OA 1Z4NA 2KIWA 2PXIA 4ED8A 4DO9A 2W7OA 2ZIWB 1KW4A 4BX9C 2Y1JA 4A8EA 4C8MA 2JEFA 2E8MA 4OJ5A 4PHPA 5JTIA 3PSFA 2JH1A 1TV9A 2MRLA 1ZQBA 3M8SA 3ISCA 4M6WA 4ECQA 2VJ4A 1J97A 1DK3A 5KL8B 2VA2A 4I28A 5F9LA 4B9VA 3OPXA 8ICJA 2JMGA 4KLQA 5HMMA 5D46A 4IRKA 2JGAA 1M6YA 4RNNA 8ICQA 4PGXA 4IR9A 5L1KA 4O5KA 8ICUA 4DL4A 1T3QA 2W54A 3TKAA 3WK5A 3SV3A 2BQ3A 4B9LA 3ZDEA 1ZQAA 4ACOA 3WU2U 4KLGA 5KG4A 2ZTDA 3UMCA 3QZ7A 7ICKA 1Z00A 2BCRA 3RJEA 5EE9A 1IG6A 3V6JA 5KFXA 2UVRA 3MGHA 5J0PA 1EXNA 5HHHA 4Q44A 3HKZC 3MC1A 2BQRA 4F5PA 3MR6A 4ED7A 4O3PA 4P0QA 2HHSA 4B9SA 2BDPA 2XY6A 2JV3A 3RH6A 4DEZA 2AHOB 5KFLA 1BGXT 4DCCA 3SAGA 2RQ5A 3H40A 9ICEA 4F72A 3TACB 3HT3A 1NJXA 4QIWC 4GLXA 9ICFA 3K1ZA 4DF4A 5ALUA 5KFSA 5KG2A 2BPFA 2IOFK 4F3OA 3G6XA 3SAFA 4EX6A 4O0IA 3KOOA 3E58A 4YD1A 1S8OA 4UATA 1SXEA 4CE6A 2PI5A 4I27A 3L4PA 4GIBA 4AYBC 4Y2RA 4PZNA 3M9NB 4BGDA 2HVIA 1FEZA 4JV2A 1ECWA 5BPCA 5DBBA 4UASA 3FC4A 7ICSA 2KSOB 1DK2A 5ALFA 5J2BA 3OGUA 5DDYA 2MU2A 3IG5A 5KFIA 3GIKA 3GZFA 5AI4A 3SZ2A 4LJXA 3WK4A 2Q4TA 4RPXA 9ICSA 3ALRA 1D8YA 5KFEA 1WUDA 4MEYA 3NS1A 1ZQFA 2ASDA 4ECZA 4ECSA 4UB5A 1Y88A 3C1YA 4K4GA 4QWEA 3V6KA 2HVHA 5C0YA 2P6UA 4M9JA 2WF7A 2DWQA 7ICUA 1X9XA 3GIIA 3N7RC 1SZHA 5J0QA 2DF4B 4RQ4A 4JK1A 4R65A 4G3IA 2BHNA 3G6YA 1SKRA 4Q45A 4EZ9A 2KN7A 4X5VA 5J0RA 2I1QA 1ZQHA 3UMBA 5JU5A 1DRGA 2MSNA 7ICLA 1JN3A 3KBBA 9ICLA 2K4PA 2LKYA 1RDFA 4QZBA 4RNOA 4Z6DA 4NLKA 1S5LU 3ICXA 3RAQA 5J2GA 3NRZA 4TQSA 5ALXA 1U45A 4ELVA 2PFOA 1SV4A 4RUCA 4GXJA 2W3SA 5AKKA 2R8GA 1DOQA 4DF8A 5KFVA 5J2JA 8ICKA 4U6PA 2WAQF 3PO4A 2H3QA 5AKXA 4DFDA 1COKA 2IOFA 2NRXA 1F0MA 4XRHA 5ALYA 1KDHA 5ALJA 5HNKA 1ZD2P 3MR2A 4FO6A 3SENA 3C2MA 5KFYA 8ICYA 5ALIA 1JXLA 2ZIXA 4RZRA 4KLLA 1TE2A 3MR3A 1TK5A 2YMQA 3EPGA 1QSSA 3TFSA 2FMQA 4KLFA 3RAXA 2W11A 4YMOA 3PX4A 2XY5A 3ONNA 8ICCA 2YY6A 5TISU 5AK6A 2HBJA 3PMNA 3UXPA 1L6NA 2XC9A 3MDAA 3WKDA 1KEJA 2C28A 1LV5A 3LVWA 2W9BA 2BCSA 3OHBA 3NTUA 2AJQA 3ED5A 1UQVA 2E8NA 4FFDA 2JZBB 1SXDA 2KKVA 1BPEA 2K60A 2EZZA 4GXIA 5GTHU 3AM9A 2F77X 3V7KA 1T3NA 1JROA 4O3NA 8ICFA 2HBKA 2YX8A 5HHIA 1PVRA 4QZ9A 2QB0B 3ETRA 3EW9A 3LVVA 3RJHA 1MSWD 4RUAA 4PGYA 1UT8A 1N48A 5KFZA 4B6JA 2QKQA 3GDXA 4RPZA 3OSNA 1ED1A 3THVA 1A6SA 1VJ5A 1AROP 2E3TA 2ZUDA 3NVVA 3RB4A 5AKHA 4YMNA 1L3UA 4JWNA 3IM1A 4Q43A 4KLSA 2VANA 3RH4A 1N62A 1D8BA 3QNMA 2XCAA 1HUZA 1ZQUA 1QLNA 3CNHA 3C23A 2EQYA 1ZETA 2PI4A 4YP3A 1PUZA 5F9NA 4F2SA 1KTQA 1RG6A 4XUSA 2KG5A 2KV2A 4C7ZA 4YVZA 4QW9A 2V4RA 4EBEA 5AK3A 3BZCA 4NV0A 4EEYA 3V72A 2IMWP 1A77A 5EE1A 1N60A 3ZDDA 1FIQA 9ICKA 4DFPA 1T8EA 1X6JA 2WF9A 2E1FA 4YN4A 1BNOA 1JI7A 4OCZA 2W9CA 2VKQA 1VDVA 2RHFA 5ALTA 1D8LA 4OJPA 3PW4A 1URJA 3HJEA 2F8KA 1D9FA 3C1ZA 4I2AA 3Q8KA 5CR0A 4J9NA 2KNJA 2ZIWA 4DSIA 1S0NA 4OJLA 1NK4A 3M6KA 2FMPA 2ZJ8A 4EELA 4TUPA 2W9CB 2ISOA 4Y2YA 4O3MA 3R9KA 4YFKA 3M9OB 2BZFA 1Q8KA 1KLNA 2HCFA 4YR3A 1SWVA 1VLBA 2EZXA 2H5XA 3PSPA 1TAQA 4I2FA 2A1AA 3HPOA 5KFHA 2HHTA 4EZ6A 2Y0SC 4CCHA 1NK7A 2OEHA 2QB1A 7ICNA 4BDPA 1ZOLA 5ALRA 1ZD4A 1T4GA 3Q8QB 5AI6A 3G6VA 4F4ZA 1MA7A 3MFIA 5DKWA 2C22A 2ZG6A 5B5EU 7ICPA 2VIXA 4QZEA 2C2EA 9ICWA 3PX0A 3KFUF 5KAFU 3JPPA 1MQ2A 3UM9A 1A76A 3E0FA 3D2QA 3QU7A 4O3OA 3O0FA 4BWMA 3EZ5A 1RYUA 2EDUA 4F5RA 4HYKA 3K4GA 1TAUA 5ALDA 4C80A 2NRVA 3QUTA 1WCNA 1DGJA 2QB0A 3MABA 4B9NA 1ZQNA 4YR2A 1SV0A 3UXOA 2XI9A 4J9PA 4UARA 5ALKA 5ALGA 3HWTA 4KLEA 2AGQA 1LKYA 2KSOA 4F50A 4RQMA 3AL0B 1MN8A 1UHUA 2BCVA 2MUTA 3B9JA 3PW2A 1O03A 2R8KA 8ICGA 5FP0A 1ZJMA 1COOA 2F44A 4TURA 4ED3A 4U7CA 3PMLA 3OHAA 4Y2VA 4M9GA 3S6JA 3H0LB 4PH5A 3CRXA 1JRPA 4I2EA 5KFUA 2BR0A 1ZQOA 2W8LA 1NNLA 5J2AA 1C20A 1RM6C 4YXMA 3H0MB 1QSYA 3SQIA 2JRZA 4Y2JA 4IR1A 5J2IA 1SZPA 4BJQA 1N5WA 2YMPA 3SI8A 4PJ0U 2XY7A 4KTQA 3GFKB 2G09A 4DS4A 2M0NA 4P0QB 4AP9A 2J6SA 5CWRA 4UQGA 2V9WA 3AN1A 2ZTEA 4TUQA 3LYSA 3QU4A 4PL2A 8ICSA 3Q8LA 4I2BA 2OXOA 2KTQA 2D6FC 4IS7A 4Q8EA 1N63A 8ICXA 2NV3A 3F2DA 5CHGA 1TAMA 2DKXA 4QWDA 2KP7A 5IIKA 2ASJA 3PW0A 3JPRA 1Q3VA 3ZDBA 1T7PA 1ZQWA 1A0PA 1BVSA 3BQ1A 2Q0ZX 4IL6U 5D49A 3ZDCA 3TI0A 5KT7A 1ZQSA 1ZQQA 3KHRA 4RQ5A 1SL1A 3WK6A 1RXWA 3Q8SB 4J03A 5J0YA 1KRPA 1NOMA 7ICFA 3M1YA 3AQEA 3PO5A 3ISBA 3AUOA 1ZQJA 1NI3A 4J9MA 1CUKA 1NK6A 4FBTA 4OJ6A 2KFNA 1ZQ1C 1SWWA 4C7YA 1S77D 4UW9A 1JX4A 2Y0SF 3N97B 2F1IA 5ALWA 5KFKA 2A3VA 4R8UB 4C8OA 4DWIA 3OTQA 4JB3A 4M04A 1SKSA 2DL0A 4RQ1A 4B9MA 1SL2A 3NGDA 1TK8A 4ED2A 3M6ZA 4GXKA 2JZBA 4HAIA 2BQUA 4F8RA 3J81j 4FBUA 3QEBZ 2LM4A 5EWGA 2OM6A 4NM1A 7ICHA 3NVYA 3WKCA 2DPIA 1NK5A 1QQ5A 2K4HA 5ALZA 5KG0A 3RRHA 4F5QA 2K8BB 2QARB 2H3ZA 4P0PB 5G5GA 4JUZA 4KLOA 4Y2XA 4QZCA 3UQ0A 8ICOA 2XO7A 2FMSA 1L3VA 4IQVA 2F8LA 3JPNA 2YMMA 2KK0A 4FZLA 3ZDAA 3RR7A 1XU4A 4IQUA 4RQ7A 3QYPA 3H7IA 3PW7A 2F2AB 1S9FA 2FJ6A 1MQ3A 2CRXA 3WK7A 2NRWA 1LB2B 2B21A 3A0BU 3KD3A 5KFGA 1ZQVA 5K4LA 4MFAA 3L3FX 3OJSA 3T5HA 2PFNA 3C2LA 2KJ8A 5J0OA 1XS9D 4F5OA 4QIWF 2ISPA 2ZTCA 3EUB2 1Q3UA 3RRGA 4CF4A 4J9RA 1RYRA 3WK8A 2WFAA 1CRXA 4Z6FA 2VJ5A 2IBKA 4BXOA 3GV7B 1BPZA 5J29A 4P0PA 5DB7A 2AH5A 2G5HB 4I2DA 3JPQA 5D4BA 3D2SA 5KFFA
chains in the Genus database with same CATH topology
2JHDA 3ICXA 4BX9C 3VCBA 2G07A 2LBOA 2WB1F 4NWIA 1P7DA 4KMOB 4AYBC 2GOLA 4A8EA 4NLBA 3RFAA 5HR7A 1MA7A 3N7SC 1KBUA 2K4EA 2OM6A 4OJ5A 2ZIVB 2KVCA 2G09A 3NRWA 1ED1A 1A6SA 2ZG6A 2CN1A 2VIXA 2M0NA 3PSFA 4P0QB 3NUQA 3KFUF 1GO3F 4C0ZA 2JH1A 4OO1J 2KEYA 1Z1BA 2G06A 4FE3A 1ECWA 2LYAA 2MRLA 3E0FA 3D2QA 3LYSA 1YT3A 3PSIA 1D8BA 3O0FA 4PL2A 4U6PA 2K4HA 3CP8A 1HEKA 2WAQF 2VJ4A 2ZIVA 2OXOA 4CDGA 5KL8B 3KZXA 2H3QA 2D6FC 3IP4B 3OPXA 2ZXIA 5HR6A 2K8BB 4KX5A 4PL1A 2H3ZA 4P0PB 2JMGA 2NV3A 3F2DA 5CRXA 3AQFA 2H3IA 3F2BA 2LHTA 2KOBA 2XICA 2HOFA 2XVTA 2DGZA 2RP5A 2WB1C 2JGAA 2PMZF 1TAMA 2E1EA 4NLCA 3IG5A 4AYBF 2CPRA 2KV2A 3VC8A 3IN5A 2KHVA 2XI9A 2KICA 2F8LA 3IG8A 2LYBA 3GZFA 3PSTA 4OJOA 1PVPA 1Q3VA 3SAHA 2PMZC 4FZNA 2K8CB 4NV0A 1A0PA 4FZLA 2K4IA 2OH2A 3GU3A 2ZIXA 4GFJA 2HOQA 2Q4TA 2KJ9A 4ACOA 4ICAA 2KD1A 2ZIUB 3AL0B 3ALRA 3MGVA 2WAQC 2W04A 3SMVA 1F44A 1WUDA 5A0LA 4QJFB 3H0RB 2F2AB 3F5AA 4IC9A 2N1RA 3ONNA 3M7DA 4WJ3B 4QNLA 5KL1B 2E5SA 2E1FA 2K89A 5C0YA 2HBJA 1T94A 2CRXA 2ZIUA 2KKPA 2KJ5A 2VKQA 2F76X 2H3FA 2RHFA 3CYMA 2HOIA 1L6NA 2G5IB 2BDUA 2MA1A 3N7RC 3AQEA 1SZHA 3HKZC 3N7PD 4OJPA 1NZBA 1URJA 2HBLA 4U7CA 2DF4B 2ZXHA 4BUGA 2YB1A 3L3FX 2R18A 2KNJA 4P0QA 2ZIWA 2RRDA 2DQNB 2G08A 3C28A 1OUQA 4OJLA 2OYYA 3M6KA 3C29A 3DEEA 3LVWA 3H0LB 3HKZF 2KJ8A 4O3MA 2HBMA 4KX3A 4QIWF 3RF9A 3CRXA 2KHQA 4CRXA 2W03A 3SAGA 5T14A 4OJ6A 2W7PA 1Q3UA 2KKVA 1Z19A 2XIDA 2YB4A 1ZQ1C 2G0AA 1UPHA 3PSPA 1CRXA 1IIPA 4QIWC 4FZMA 3T79A 2Y0SF 2JH7A 3F5EA 3K1ZA 3F2CA 2VJ5A 2F77X 1XNSA 1DRGA 2A3VA 1XO0A 4CGZA 2H3VA 2K8AA 2ZIXB 3H0MB 3SAFA 3SQIA 4P0PA 3PZPA 4JMUA 2G5HB 2LKYA 2HBKA 2YX8A 2KIWA 4BJQA 2Y0SC 1PVQA 2Z7JA 1PVRA 3D2NA 3LVVA 3F53A 1HIWA 2W7OA 2ZIWB 3D2SA 3M6ZA 2HMXA 2GH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3Z A;  2JMG A;  2NV3 A;  4IC9 A;  2N1R A;  2H3I A;  2GOL A;  1TAM A;  2K4E A;  1UPH A;  1A6S A;  1ED1 A;  2H3F A;  1L6N A;  2LYB A;  2H3V A;  1ECW A;  2LYA A;  4JMU A;  2K4I A;  2K4H A;  1HEK A;  4ICA A;  2H3Q A;  1HIW A;  2HMX A; 
#chains in the Genus database with same CATH topology
 2LBO A;  3T5J A;  4B9U A;  4NWI A;  2LMR A;  4NLB A;  5III A;  5DLG A;  1ZXI A;  3RJJ A;  4KLI A;  3JPT A;  1ZQD A;  2BGW A;  4C0Z A;  2ZUB A;  4F91 B;  3WK9 A;  2WF8 A;  2DKZ A;  4EEK A;  3Q8R B;  2IA6 A;  1FFV A;  2HHU A;  3CP8 A;  5CJ7 A;  4YMM A;  1B0X A;  2R8J A;  3K75 D;  4DL7 A;  7ICM A;  1S10 A;  5CRX A;  4RT2 A;  1SGG A;  3TFR A;  2XIC A;  1L3T A;  4UB3 A;  2DGZ A;  5J0U A;  1Z00 B;  4NLC A;  2ALZ A;  1X40 A;  4F4Y A;  3IN5 A;  4B9T A;  1XSN A;  4R64 A;  1ZQK A;  3PY8 A;  4UAW A;  2AGO A;  4DFK A;  5E79 U;  8ICW A;  1X6I A;  1FO4 A;  4UB2 A;  4ICA A;  1K1Q A;  4O5E A;  3OJU A;  3T5L A;  4M9H A;  4DQS A;  4QJF B;  4DQQ A;  3F5A A;  4WJ3 B;  2K89 A;  4US8 A;  5AM2 A;  4ED0 A;  4EX7 A;  1NK8 A;  3H8J A;  2G5I B;  1NZB A;  4PHE A;  4F71 A;  2HBL A;  2VA8 A;  2D8C A;  3MDC A;  4RPY A;  4LZD A;  1S0O A;  4DSL A;  4E0D A;  2E8P A;  2CXY A;  4F4X A;  4UAZ A;  5ALS A;  3H4D A;  4ECY A;  4DS5 A;  1ZRM A;  3IRU A;  5T14 A;  1NK9 A;  2BCU A;  3HP6 A;  3TAD A;  3NVZ A;  4DOC A;  8ICL A;  4DQI A;  4TQR A;  3AU6 A;  2C2D A;  5DG8 A;  1YZ6 A;  1L7O A;  5DQH A;  4P4M A;  1ZQX A;  4RQN A;  1NZP A;  4QWC A;  4I2J A;  1ZYQ A;  4RQ6 A;  1ZJN A;  4F5N A;  4UAU A;  1KKX A;  3N7S C;  5KTQ A;  2VA3 A;  4Y2Q A;  4J9L A;  9ICB A;  9ICO A;  4PGQ A;  4QZH A;  5AKG A;  2LYA A;  5AM1 A;  1ZQY A;  3I28 A;  1HEK A;  3NAS A;  3RB6 A;  2ZJ5 A;  1ZD3 A;  2AQ4 A;  4QWA A;  4NLN A;  2ZXI A;  5EE0 A;  2DFL A;  5ALE A;  1XSP A;  1L7M A;  3AQF A;  1SV0 C;  1XC9 A;  2HOF A;  2E1E A;  4Y2U A;  4NL9 C;  9ICG A;  3LK9 A;  3IG8 A;  3GV5 B;  1SKW A;  2DPJ A;  2PMZ C;  4FZN A;  1RPL A;  5AKZ A;  2NRZ A;  2UVV A;  2PKE A;  2L5Y A;  5DG7 A;  4F93 B;  1NK0 A;  3A0H U;  2UVW A;  2DUY A;  8ICP A;  4J9O A;  4NLZ A;  8ICE A;  5L1M A;  2FLP A;  1FFU A;  4KN4 A;  3MR5 A;  3E2E A;  1KFT A;  5DG9 A;  2FI1 A;  4EBD A;  1QQ7 A;  3HKZ F;  4UB6 U;  2KHQ A;  2GO7 A;  3D6J A;  1Z19 A;  5KFC A;  8ICZ A;  3BS7 A;  5AKJ A;  4ECV A;  2AGP A;  4F92 B;  3BJY A;  2ASL A;  4LZG A;  4QZI A;  5KFB A;  2HI0 A;  2XCP A;  3F53 A;  4DLE A;  5KG3 A;  3WKA A;  1KN5 A;  5BOM A;  4USA A;  1BPB A;  2HSZ A;  1KBU A;  1PK1 A;  4YCX A;  1N61 A;  2J6U A;  3BQ7 A;  1GO3 F;  3ETL A;  2PFP A;  5J0W A;  5IIO A;  2D3D A;  4QW8 A;  4CDG A;  9ICR A;  2EAN A;  1HJP A;  1U9L A;  4PHD A;  4ECT A;  5AM0 A;  2EAP A;  2FE9 A;  1X2I A;  2J6T A;  2CPR A;  2QLT A;  1V97 A;  4O9M A;  3BS5 A;  3FDS A;  2W3R A;  2OH2 A;  1MC8 A;  2HHX A;  5AI8 A;  2GWS A;  5A0L A;  2KMD A;  2P35 A;  3QU9 A;  3BQ0 A;  1V85 A;  3Q8P B;  2F76 X;  4UB8 U;  1U48 A;  2NO5 A;  4DLG A;  4QZ8 A;  4C8L A;  3AU2 A;  2KVS A;  4RQ2 A;  3BQ2 A;  1ZQI A;  3QUB A;  3QE9 Y;  2ZUC A;  2Y1I A;  2LYH A;  2EAM A;  5CEH A;  5AI5 A;  5DQI A;  2XID A;  3QZ8 A;  1QTM A;  1NJW A;  2E8O A;  1ZQT A;  3KZI U;  9ICJ A;  5KT4 A;  4R66 A;  3F2C A;  4EYH B;  4CGZ A;  4C4R A;  4QZF A;  2A1J A;  1KFS A;  2QAR A;  3BS5 B;  1ZQG A;  1BPD A;  4PZO A;  3M7D A;  1ZQE A;  2M9N A;  3GQC A;  4DQP A;  4M2Y A;  4RQ0 A;  4KIT B;  1RQL A;  4NY8 A;  3NRW A;  3I1Y A;  5J2K A;  3ORY A;  1UA0 A;  2ODG A;  4IRC A;  3NUQ A;  2HHW A;  2G06 A;  2LM1 A;  2C2R A;  5KT5 A;  3FAH A;  2ZIV A;  3UXN A;  3KZX A;  3IP4 B;  5AM5 A;  5HR6 A;  4YQW A;  4RQ8 A;  2WF6 A;  1ZRN A;  5JUM A;  3IV6 A;  5G5H A;  4I29 A;  5J0X A;  4RT3 A;  5DB6 A;  2XVT A;  4O3S A;  3SD7 A;  3PVX A;  9ICQ A;  3FYH A;  1ZD5 A;  1N56 A;  3HW8 A;  3KHG A;  1B43 A;  4MF2 A;  3VC8 A;  1IXR A;  2KHV A;  5ALQ A;  1PVP A;  3SYZ A;  3GIL A;  3JPS A;  4G9B A;  3RTV A;  4DQR A;  8ICI A;  3KKA A;  1XSL A;  2HW3 A;  2KD1 A;  3AMZ A;  2WAQ C;  4MEX A;  3SMV A;  1X9W A;  2RLT A;  4RQ3 A;  4M9L A;  1JMS A;  2IOH A;  3IHQ B;  5KNI A;  4MHV A;  5ALH A;  2JEG A;  2H3F A;  5J8Y A;  2MA1 A;  1WYG A;  5KFR A;  4BUG A;  2FLN A;  4DL6 A;  4KN7 A;  3C28 A;  5F3X B;  3T5K A;  4ZH4 A;  5C5J A;  4MFC A;  4I2I A;  5DDM A;  1RYS A;  1PK1 B;  3WKE A;  2W9M A;  7ICT A;  2OWO A;  5J8Y C;  4ELT A;  1OW5 A;  3I76 A;  3GV8 B;  4KLT A;  4KLD A;  1CI4 A;  2W9B B;  4JV0 A;  3HX0 A;  4C8K A;  1XO0 A;  1WCL A;  2I9G A;  1X42 A;  3RJG A;  3H8S A;  2NRT A;  3D2N A;  9ICM A;  4QZA A;  2WB1 F;  1D9D A;  1PZN A;  3UPQ A;  4KMO B;  3RFA A;  5AI9 A;  5DLF A;  4CNQ A;  2KVC A;  4NLG A;  2JEI A;  1F5S A;  3MGI A;  2FLL A;  9ICV A;  3K1R B;  5ALL A;  2BPG A;  4FE3 A;  1IV8 A;  3PX6 A;  2RDJ A;  2YTU A;  1LKY B;  1NKB A;  5KFW A;  3RBD A;  5CP2 A;  4IQT A;  2LHT A;  2WF5 A;  2WB1 C;  1K1S A;  2YQE A;  9ICN A;  9ICA A;  4AYB F;  3SV4 A;  4ED1 A;  3BZK A;  9ICX A;  3BDP A;  1CEZ A;  5CB1 A;  2JEJ A;  3TAN A;  5IIM A;  3SAH A;  2I6X A;  4ECU A;  3EPI A;  5GTI U;  2HOQ A;  5KFM A;  8ICV A;  5AIC A;  1SIJ A;  1RZT A;  1IM4 A;  5L9X A;  4MFF A;  4QNL A;  5ALP A;  2E5S A;  4NJ8 A;  5EE3 A;  5AI0 A;  4DSJ A;  1X9S A;  2BDU A;  1RXV A;  9ICP A;  3C2K A;  2ZXH A;  5AKE A;  4QZD A;  2R18 A;  3TAP A;  2RRD A;  1S76 D;  4CF5 A;  2LPE A;  5ALV A;  1L5U A;  1Z4O A;  2MAX A;  3MFH A;  3RBE A;  4PPX A;  5KT2 A;  2JH7 A;  1KFD A;  4XA5 A;  5ALN A;  3LWL A;  1JIH A;  4JMU A;  5AIA A;  3TQ1 A;  5KFA A;  3SR6 A;  2Z7J A;  8ICA A;  8ICH A;  1WWU A;  9ICH A;  1X9M A;  3B0Y A;  4P4P A;  3KKA C;  2JHD A;  8ICB A;  5B66 U;  2XGP A;  5AM3 A;  1P7D A;  2P6R A;  7ICQ A;  5IIN A;  2GOL A;  5HR7 A;  1BPX A;  3DV9 A;  5DB9 A;  2ZIV B;  1LVH A;  5KFP A;  1L8L A;  2KEY A;  5EWE A;  4EBC A;  8ICN A;  4DL3 A;  1TKD A;  1ZQZ A;  4DSK A;  1U47 A;  4KX5 A;  4K4I A;  8ICR A;  2PMZ F;  4US9 A;  3QX7 A;  5ALO A;  1NKE A;  1NJY A;  2A1J B;  5H2F U;  4J9Q A;  2ATL A;  1B22 A;  1TVA A;  2HHV A;  2EZY A;  4R63 A;  4C8N A;  4ELU A;  4NM2 A;  1ZQR A;  1HUO A;  2ESE A;  1QH9 A;  5L1I A;  2Y9T A;  4K4H A;  3MBY A;  2ZIU A;  4UB4 A;  4KLJ A;  3M9M B;  4MF8 A;  2KIV A;  4Y2P A;  1OUQ A;  4KLH A;  4KX3 A;  3RF9 A;  4JWM A;  1BPY A;  5J0T A;  2KFZ A;  1L7N A;  1ZQP A;  7ICJ A;  3T3F A;  3TAQ A;  2R8H A;  5L1L A;  3CW2 C;  4GC7 A;  1SL0 A;  1JUD A;  5TZV A;  1DGS A;  3V7J A;  2H3V A;  2UVU A;  2ZIX B;  7ICE A;  1C7Y A;  3DDH A;  2ES6 A;  3KHL A;  2R8I A;  1PVQ A;  3LDA A;  5AKY A;  5EWF A;  1ZQM A;  1RQN A;  2GH1 A;  3RJF A;  1Q46 A;  5J2C A;  1UA1 A;  3PNC A;  3UQ2 A;  4M47 A;  3RB3 A;  2K4E A;  2BCQ A;  1L7P A;  2MUT B;  3QU5 A;  3PR4 A;  5J2F A;  3KTQ A;  5HML A;  8ICT A;  5KFD A;  2AU0 A;  2PFQ A;  1V9P A;  4PL1 A;  3QXG A;  3QU2 A;  4EYI B;  2WTF A;  7ICG A;  3F2B A;  2ZJA A;  5ALM A;  5KG6 A;  2RP5 A;  5AKL A;  4DFM A;  3QEA Z;  3PW5 A;  2W43 A;  3QUC A;  4JV1 A;  9ICU A;  2KIC A;  3PST A;  4OJO A;  2GLE A;  2W8K A;  4I2G A;  3WKB A;  3EYZ A;  2K8C B;  4QZG A;  4ECX A;  2K4I A;  3GU3 A;  2KJ9 A;  2B0C A;  5J2H A;  3MGV A;  9ICC A;  5KT3 A;  7ICV A;  2EAO A;  3H0R B;  4IC9 A;  2N1R A;  3U26 A;  4O5C A;  5KL1 B;  3PV8 A;  1JXE A;  3OSP A;  1T94 A;  2EH9 A;  3HRD D;  2RDI A;  3TAD C;  1AQ6 A;  2P66 A;  3GIM A;  2YB1 A;  5KG1 A;  1L3S A;  1TK0 A;  5KAI U;  2G08 A;  2OYY A;  3C29 A;  3DEE A;  3FM9 A;  1Z3E B;  2JXJ A;  4RU9 A;  4YD2 A;  4FS2 A;  1NKC A;  5HP4 A;  4TUS A;  4ZOH C;  1V38 A;  4ECW A;  4UBB A;  5KT6 A;  1IIP A;  3M8R A;  4ECR A;  3T79 A;  3RJK A;  3ZD9 A;  3C5G A;  2IHM A;  4F4K A;  2K8A A;  4IQW A;  4Z6E A;  3PZP A;  4UB1 A;  8ICM A;  4DOA A;  3ZI4 A;  2BPC A;  5KFJ A;  4YG2 A;  4O3Q A;  5EOZ A;  1U4B A;  5AK5 A;  2HMX A;  3VCB A;  4KLU A;  2LI6 A;  4DSE A;  1SB3 C;  5KFT A;  4LVS A;  2CN1 A;  5KFO A;  2FDR A;  2DBY A;  2WHE A;  4NL9 A;  4OO1 J;  1Z1B A;  3PSI A;  5KG5 A;  1YT3 A;  2W9A A;  1B4F A;  3KHH A;  3LWM A;  3N4M B;  3SEI A;  3H8M A;  4BXO B;  3C21 A;  1XWL A;  4DOB A;  5KG7 A;  3PR5 B;  5CA7 A;  7ICR A;  3AEV A;  2Y9U A;  4KMU A;  2LYB A;  4Q8F A;  9ICT A;  5AK4 A;  1H38 A;  2YN4 A;  1UCV A;  1KL9 A;  5IIJ A;  4GFJ A;  3TAR A;  4FS1 A;  4DSF A;  3H4B A;  1N2X A;  2ZIU B;  5AHX A;  4M0A A;  3IDW A;  2OCE A;  5DQG A;  1U49 A;  5DBA A;  3JPO A;  2KZ3 A;  5DGA A;  4J9K A;  3EWA A;  2KZM A;  2F1H A;  3RH5 A;  1S0M A;  2HOI A;  1TFR A;  3L5K A;  2FPL A;  2FPM A;  3RB0 A;  3RJI A;  1QSL A;  2XGQ A;  5AIB A;  5J2D A;  1J2N A;  1QQ6 A;  2A19 A;  1UT5 A;  4BWJ A;  1JAL A;  1WG8 A;  2I5H A;  1WWV A;  4XQ8 A;  7ICI A;  5KFQ A;  2YB4 A;  4O3R A;  4GC6 A;  4ED6 A;  4NXZ A;  7ICO A;  4FZM A;  4PHA A;  2OHF A;  3F5E A;  4CF3 A;  2V4Q A;  1PK3 A;  4M9N A;  2HHQ A;  1HIW A;  2G07 A;  1OXJ A;  5AKI A;  5KFN A;  2F3N A;  4EEN A;  1Z1V A;  4C4T A;  3QUQ A;  1J2M A;  4QWB A;  4I2C A;  4DL2 A;  4P2H A;  5JRT A;  2KZZ A;  4IRD A;  4F4W A;  1K5O A;  3B0X A;  5DGB A;  4Y2T A;  3ZD8 A;  4R8U A;  2H3I A;  2KOB A;  3V7L A;  5J0S A;  1S97 A;  3UMG A;  1KSP A;  4YXJ A;  5L1J A;  5BOL A;  3HIL A;  4F2R A;  5DB8 A;  2JR5 A;  4C4S A;  4DFJ A;  5IIL A;  3Q8M A;  3BQT A;  1X66 A;  5J2E A;  2W04 A;  1F44 A;  1ZQL A;  4M6W B;  2B6G A;  2AQ0 A;  4UAV A;  5DBC A;  1QCK A;  1N5X A;  1BNP A;  2KKP A;  2KJ5 A;  3RR8 A;  1S0V A;  3CYM A;  2NO4 A;  3N7P D;  4I2H A;  4OD0 A;  4Z6C A;  4UBC A;  2O6K A;  3V6H A;  2F1J A;  1XO1 A;  3C5F A;  3H8W A;  1DXS A;  2IHN A;  2NYV A;  4KLM A;  2DQN B;  1KQQ A;  5AM4 A;  4DL5 A;  1NJZ A;  2FPK A;  4UAY A;  4Y2S A;  2HBM A;  3ISD A;  4YR0 A;  4CRX A;  2W03 A;  2W7P A;  4RNM A;  2HDO A;  4J9S A;  2G0A A;  1UPH A;  1YZ7 A;  1O08 A;  1ZQC A;  3GIJ A;  2BKE A;  9ICI A;  1XNS A;  2YML A;  3N28 A;  2W55 A;  2AXT U;  2KE7 A;  1L8O A;  3NVW A;  4P4O A;  1Z4N A;  2KIW A;  2PXI A;  4ED8 A;  4DO9 A;  2W7O A;  2ZIW B;  1KW4 A;  4BX9 C;  2Y1J A;  4A8E A;  4C8M A;  2JEF A;  2E8M A;  4OJ5 A;  4PHP A;  5JTI A;  3PSF A;  2JH1 A;  1TV9 A;  2MRL A;  1ZQB A;  3M8S A;  3ISC A;  4M6W A;  4ECQ A;  2VJ4 A;  1J97 A;  1DK3 A;  5KL8 B;  2VA2 A;  4I28 A;  5F9L A;  4B9V A;  3OPX A;  8ICJ A;  2JMG A;  4KLQ A;  5HMM A;  5D46 A;  4IRK A;  2JGA A;  1M6Y A;  4RNN A;  8ICQ A;  4PGX A;  4IR9 A;  5L1K A;  4O5K A;  8ICU A;  4DL4 A;  1T3Q A;  2W54 A;  3TKA A;  3WK5 A;  3SV3 A;  2BQ3 A;  4B9L A;  3ZDE A;  1ZQA A;  4ACO A;  3WU2 U;  4KLG A;  5KG4 A;  2ZTD A;  3UMC A;  3QZ7 A;  7ICK A;  1Z00 A;  2BCR A;  3RJE A;  5EE9 A;  1IG6 A;  3V6J A;  5KFX A;  2UVR A;  3MGH A;  5J0P A;  1EXN A;  5HHH A;  4Q44 A;  3HKZ C;  3MC1 A;  2BQR A;  4F5P A;  3MR6 A;  4ED7 A;  4O3P A;  4P0Q A;  2HHS A;  4B9S A;  2BDP A;  2XY6 A;  2JV3 A;  3RH6 A;  4DEZ A;  2AHO B;  5KFL A;  1BGX T;  4DCC A;  3SAG A;  2RQ5 A;  3H40 A;  9ICE A;  4F72 A;  3TAC B;  3HT3 A;  1NJX A;  4QIW C;  4GLX A;  9ICF A;  3K1Z A;  4DF4 A;  5ALU A;  5KFS A;  5KG2 A;  2BPF A;  2IOF K;  4F3O A;  3G6X A;  3SAF A;  4EX6 A;  4O0I A;  3KOO A;  3E58 A;  4YD1 A;  1S8O A;  4UAT A;  1SXE A;  4CE6 A;  2PI5 A;  4I27 A;  3L4P A;  4GIB A;  4AYB C;  4Y2R A;  4PZN A;  3M9N B;  4BGD A;  2HVI A;  1FEZ A;  4JV2 A;  1ECW A;  5BPC A;  5DBB A;  4UAS A;  3FC4 A;  7ICS A;  2KSO B;  1DK2 A;  5ALF A;  5J2B A;  3OGU A;  5DDY A;  2MU2 A;  3IG5 A;  5KFI A;  3GIK A;  3GZF A;  5AI4 A;  3SZ2 A;  4LJX A;  3WK4 A;  2Q4T A;  4RPX A;  9ICS A;  3ALR A;  1D8Y A;  5KFE A;  1WUD A;  4MEY A;  3NS1 A;  1ZQF A;  2ASD A;  4ECZ A;  4ECS A;  4UB5 A;  1Y88 A;  3C1Y A;  4K4G A;  4QWE A;  3V6K A;  2HVH A;  5C0Y A;  2P6U A;  4M9J A;  2WF7 A;  2DWQ A;  7ICU A;  1X9X A;  3GII A;  3N7R C;  1SZH A;  5J0Q A;  2DF4 B;  4RQ4 A;  4JK1 A;  4R65 A;  4G3I A;  2BHN A;  3G6Y A;  1SKR A;  4Q45 A;  4EZ9 A;  2KN7 A;  4X5V A;  5J0R A;  2I1Q A;  1ZQH A;  3UMB A;  5JU5 A;  1DRG A;  2MSN A;  7ICL A;  1JN3 A;  3KBB A;  9ICL A;  2K4P A;  2LKY A;  1RDF A;  4QZB A;  4RNO A;  4Z6D A;  4NLK A;  1S5L U;  3ICX A;  3RAQ A;  5J2G A;  3NRZ A;  4TQS A;  5ALX A;  1U45 A;  4ELV A;  2PFO A;  1SV4 A;  4RUC A;  4GXJ A;  2W3S A;  5AKK A;  2R8G A;  1DOQ A;  4DF8 A;  5KFV A;  5J2J A;  8ICK A;  4U6P A;  2WAQ F;  3PO4 A;  2H3Q A;  5AKX A;  4DFD A;  1COK A;  2IOF A;  2NRX A;  1F0M A;  4XRH A;  5ALY A;  1KDH A;  5ALJ A;  5HNK A;  1ZD2 P;  3MR2 A;  4FO6 A;  3SEN A;  3C2M A;  5KFY A;  8ICY A;  5ALI A;  1JXL A;  2ZIX A;  4RZR A;  4KLL A;  1TE2 A;  3MR3 A;  1TK5 A;  2YMQ A;  3EPG A;  1QSS A;  3TFS A;  2FMQ A;  4KLF A;  3RAX A;  2W11 A;  4YMO A;  3PX4 A;  2XY5 A;  3ONN A;  8ICC A;  2YY6 A;  5TIS U;  5AK6 A;  2HBJ A;  3PMN A;  3UXP A;  1L6N A;  2XC9 A;  3MDA A;  3WKD A;  1KEJ A;  2C28 A;  1LV5 A;  3LVW A;  2W9B A;  2BCS A;  3OHB A;  3NTU A;  2AJQ A;  3ED5 A;  1UQV A;  2E8N A;  4FFD A;  2JZB B;  1SXD A;  2KKV A;  1BPE A;  2K60 A;  2EZZ A;  4GXI A;  5GTH U;  3AM9 A;  2F77 X;  3V7K A;  1T3N A;  1JRO A;  4O3N A;  8ICF A;  2HBK A;  2YX8 A;  5HHI A;  1PVR A;  4QZ9 A;  2QB0 B;  3ETR A;  3EW9 A;  3LVV A;  3RJH A;  1MSW D;  4RUA A;  4PGY A;  1UT8 A;  1N48 A;  5KFZ A;  4B6J A;  2QKQ A;  3GDX A;  4RPZ A;  3OSN A;  1ED1 A;  3THV A;  1A6S A;  1VJ5 A;  1ARO P;  2E3T A;  2ZUD A;  3NVV A;  3RB4 A;  5AKH A;  4YMN A;  1L3U A;  4JWN A;  3IM1 A;  4Q43 A;  4KLS A;  2VAN A;  3RH4 A;  1N62 A;  1D8B A;  3QNM A;  2XCA A;  1HUZ A;  1ZQU A;  1QLN A;  3CNH A;  3C23 A;  2EQY A;  1ZET A;  2PI4 A;  4YP3 A;  1PUZ A;  5F9N A;  4F2S A;  1KTQ A;  1RG6 A;  4XUS A;  2KG5 A;  2KV2 A;  4C7Z A;  4YVZ A;  4QW9 A;  2V4R A;  4EBE A;  5AK3 A;  3BZC A;  4NV0 A;  4EEY A;  3V72 A;  2IMW P;  1A77 A;  5EE1 A;  1N60 A;  3ZDD A;  1FIQ A;  9ICK A;  4DFP A;  1T8E A;  1X6J A;  2WF9 A;  2E1F A;  4YN4 A;  1BNO A;  1JI7 A;  4OCZ A;  2W9C A;  2VKQ A;  1VDV A;  2RHF A;  5ALT A;  1D8L A;  4OJP A;  3PW4 A;  1URJ A;  3HJE A;  2F8K A;  1D9F A;  3C1Z A;  4I2A A;  3Q8K A;  5CR0 A;  4J9N A;  2KNJ A;  2ZIW A;  4DSI A;  1S0N A;  4OJL A;  1NK4 A;  3M6K A;  2FMP A;  2ZJ8 A;  4EEL A;  4TUP A;  2W9C B;  2ISO A;  4Y2Y A;  4O3M A;  3R9K A;  4YFK A;  3M9O B;  2BZF A;  1Q8K A;  1KLN A;  2HCF A;  4YR3 A;  1SWV A;  1VLB A;  2EZX A;  2H5X A;  3PSP A;  1TAQ A;  4I2F A;  2A1A A;  3HPO A;  5KFH A;  2HHT A;  4EZ6 A;  2Y0S C;  4CCH A;  1NK7 A;  2OEH A;  2QB1 A;  7ICN A;  4BDP A;  1ZOL A;  5ALR A;  1ZD4 A;  1T4G A;  3Q8Q B;  5AI6 A;  3G6V A;  4F4Z A;  1MA7 A;  3MFI A;  5DKW A;  2C22 A;  2ZG6 A;  5B5E U;  7ICP A;  2VIX A;  4QZE A;  2C2E A;  9ICW A;  3PX0 A;  3KFU F;  5KAF U;  3JPP A;  1MQ2 A;  3UM9 A;  1A76 A;  3E0F A;  3D2Q A;  3QU7 A;  4O3O A;  3O0F A;  4BWM A;  3EZ5 A;  1RYU A;  2EDU A;  4F5R A;  4HYK A;  3K4G A;  1TAU A;  5ALD A;  4C80 A;  2NRV A;  3QUT A;  1WCN A;  1DGJ A;  2QB0 A;  3MAB A;  4B9N A;  1ZQN A;  4YR2 A;  1SV0 A;  3UXO A;  2XI9 A;  4J9P A;  4UAR A;  5ALK A;  5ALG A;  3HWT A;  4KLE A;  2AGQ A;  1LKY A;  2KSO A;  4F50 A;  4RQM A;  3AL0 B;  1MN8 A;  1UHU A;  2BCV A;  2MUT A;  3B9J A;  3PW2 A;  1O03 A;  2R8K A;  8ICG A;  5FP0 A;  1ZJM A;  1COO A;  2F44 A;  4TUR A;  4ED3 A;  4U7C A;  3PML A;  3OHA A;  4Y2V A;  4M9G A;  3S6J A;  3H0L B;  4PH5 A;  3CRX A;  1JRP A;  4I2E A;  5KFU A;  2BR0 A;  1ZQO A;  2W8L A;  1NNL A;  5J2A A;  1C20 A;  1RM6 C;  4YXM A;  3H0M B;  1QSY A;  3SQI A;  2JRZ A;  4Y2J A;  4IR1 A;  5J2I A;  1SZP A;  4BJQ A;  1N5W A;  2YMP A;  3SI8 A;  4PJ0 U;  2XY7 A;  4KTQ A;  3GFK B;  2G09 A;  4DS4 A;  2M0N A;  4P0Q B;  4AP9 A;  2J6S A;  5CWR A;  4UQG A;  2V9W A;  3AN1 A;  2ZTE A;  4TUQ A;  3LYS A;  3QU4 A;  4PL2 A;  8ICS A;  3Q8L A;  4I2B A;  2OXO A;  2KTQ A;  2D6F C;  4IS7 A;  4Q8E A;  1N63 A;  8ICX A;  2NV3 A;  3F2D A;  5CHG A;  1TAM A;  2DKX A;  4QWD A;  2KP7 A;  5IIK A;  2ASJ A;  3PW0 A;  3JPR A;  1Q3V A;  3ZDB A;  1T7P A;  1ZQW A;  1A0P A;  1BVS A;  3BQ1 A;  2Q0Z X;  4IL6 U;  5D49 A;  3ZDC A;  3TI0 A;  5KT7 A;  1ZQS A;  1ZQQ A;  3KHR A;  4RQ5 A;  1SL1 A;  3WK6 A;  1RXW A;  3Q8S B;  4J03 A;  5J0Y A;  1KRP A;  1NOM A;  7ICF A;  3M1Y A;  3AQE A;  3PO5 A;  3ISB A;  3AUO A;  1ZQJ A;  1NI3 A;  4J9M A;  1CUK A;  1NK6 A;  4FBT A;  4OJ6 A;  2KFN A;  1ZQ1 C;  1SWW A;  4C7Y A;  1S77 D;  4UW9 A;  1JX4 A;  2Y0S F;  3N97 B;  2F1I A;  5ALW A;  5KFK A;  2A3V A;  4R8U B;  4C8O A;  4DWI A;  3OTQ A;  4JB3 A;  4M04 A;  1SKS A;  2DL0 A;  4RQ1 A;  4B9M A;  1SL2 A;  3NGD A;  1TK8 A;  4ED2 A;  3M6Z A;  4GXK A;  2JZB A;  4HAI A;  2BQU A;  4F8R A;  3J81 j;  4FBU A;  3QEB Z;  2LM4 A;  5EWG A;  2OM6 A;  4NM1 A;  7ICH A;  3NVY A;  3WKC A;  2DPI A;  1NK5 A;  1QQ5 A;  2K4H A;  5ALZ A;  5KG0 A;  3RRH A;  4F5Q A;  2K8B B;  2QAR B;  2H3Z A;  4P0P B;  5G5G A;  4JUZ A;  4KLO A;  4Y2X A;  4QZC A;  3UQ0 A;  8ICO A;  2XO7 A;  2FMS A;  1L3V A;  4IQV A;  2F8L A;  3JPN A;  2YMM A;  2KK0 A;  4FZL A;  3ZDA A;  3RR7 A;  1XU4 A;  4IQU A;  4RQ7 A;  3QYP A;  3H7I A;  3PW7 A;  2F2A B;  1S9F A;  2FJ6 A;  1MQ3 A;  2CRX A;  3WK7 A;  2NRW A;  1LB2 B;  2B21 A;  3A0B U;  3KD3 A;  5KFG A;  1ZQV A;  5K4L A;  4MFA A;  3L3F X;  3OJS A;  3T5H A;  2PFN A;  3C2L A;  2KJ8 A;  5J0O A;  1XS9 D;  4F5O A;  4QIW F;  2ISP A;  2ZTC A;  3EUB 2;  1Q3U A;  3RRG A;  4CF4 A;  4J9R A;  1RYR A;  3WK8 A;  2WFA A;  1CRX A;  4Z6F A;  2VJ5 A;  2IBK A;  4BXO A;  3GV7 B;  1BPZ A;  5J29 A;  4P0P A;  5DB7 A;  2AH5 A;  2G5H B;  4I2D A;  3JPQ A;  5D4B A;  3D2S A;  5KFF A; 
#chains in the Genus database with same CATH homology
 2JHD A;  3ICX A;  4BX9 C;  3VCB A;  2G07 A;  2LBO A;  2WB1 F;  4NWI A;  1P7D A;  4KMO B;  4AYB C;  2GOL A;  4A8E A;  4NLB A;  3RFA A;  5HR7 A;  1MA7 A;  3N7S C;  1KBU A;  2K4E A;  2OM6 A;  4OJ5 A;  2ZIV B;  2KVC A;  2G09 A;  3NRW A;  1ED1 A;  1A6S A;  2ZG6 A;  2CN1 A;  2VIX A;  2M0N A;  3PSF A;  4P0Q B;  3NUQ A;  3KFU F;  1GO3 F;  4C0Z A;  2JH1 A;  4OO1 J;  2KEY A;  1Z1B A;  2G06 A;  4FE3 A;  1ECW A;  2LYA A;  2MRL A;  3E0F A;  3D2Q A;  3LYS A;  1YT3 A;  3PSI A;  1D8B A;  3O0F A;  4PL2 A;  4U6P A;  2K4H A;  3CP8 A;  1HEK A;  2WAQ F;  2VJ4 A;  2ZIV A;  2OXO A;  4CDG A;  5KL8 B;  3KZX A;  2H3Q A;  2D6F C;  3IP4 B;  3OPX A;  2ZXI A;  5HR6 A;  2K8B B;  4KX5 A;  4PL1 A;  2H3Z A;  4P0P B;  2JMG A;  2NV3 A;  3F2D A;  5CRX A;  3AQF A;  2H3I A;  3F2B A;  2LHT A;  2KOB A;  2XIC A;  2HOF A;  2XVT A;  2DGZ A;  2RP5 A;  2WB1 C;  2JGA A;  2PMZ F;  1TAM A;  2E1E A;  4NLC A;  3IG5 A;  4AYB F;  2CPR A;  2KV2 A;  3VC8 A;  3IN5 A;  2KHV A;  2XI9 A;  2KIC A;  2F8L A;  3IG8 A;  2LYB A;  3GZF A;  3PST A;  4OJO A;  1PVP A;  1Q3V A;  3SAH A;  2PMZ C;  4FZN A;  2K8C B;  4NV0 A;  1A0P A;  4FZL A;  2K4I A;  2OH2 A;  3GU3 A;  2ZIX A;  4GFJ A;  2HOQ A;  2Q4T A;  2KJ9 A;  4ACO A;  4ICA A;  2KD1 A;  2ZIU B;  3AL0 B;  3ALR A;  3MGV A;  2WAQ C;  2W04 A;  3SMV A;  1F44 A;  1WUD A;  5A0L A;  4QJF B;  3H0R B;  2F2A B;  3F5A A;  4IC9 A;  2N1R A;  3ONN A;  3M7D A;  4WJ3 B;  4QNL A;  5KL1 B;  2E5S A;  2E1F A;  2K89 A;  5C0Y A;  2HBJ A;  1T94 A;  2CRX A;  2ZIU A;  2KKP A;  2KJ5 A;  2VKQ A;  2F76 X;  2H3F A;  2RHF A;  3CYM A;  2HOI A;  1L6N A;  2G5I B;  2BDU A;  2MA1 A;  3N7R C;  3AQE A;  1SZH A;  3HKZ C;  3N7P D;  4OJP A;  1NZB A;  1URJ A;  2HBL A;  4U7C A;  2DF4 B;  2ZXH A;  4BUG A;  2YB1 A;  3L3F X;  2R18 A;  2KNJ A;  4P0Q A;  2ZIW A;  2RRD A;  2DQN B;  2G08 A;  3C28 A;  1OUQ A;  4OJL A;  2OYY A;  3M6K A;  3C29 A;  3DEE A;  3LVW A;  3H0L B;  3HKZ F;  2KJ8 A;  4O3M A;  2HBM A;  4KX3 A;  4QIW F;  3RF9 A;  3CRX A;  2KHQ A;  4CRX A;  2W03 A;  3SAG A;  5T14 A;  4OJ6 A;  2W7P A;  1Q3U A;  2KKV A;  1Z19 A;  2XID A;  2YB4 A;  1ZQ1 C;  2G0A A;  1UPH A;  3PSP A;  1CRX A;  1IIP A;  4QIW C;  4FZM A;  3T79 A;  2Y0S F;  2JH7 A;  3F5E A;  3K1Z A;  3F2C A;  2VJ5 A;  2F77 X;  1XNS A;  1DRG A;  2A3V A;  1XO0 A;  4CGZ A;  2H3V A;  2K8A A;  2ZIX B;  3H0M B;  3SAF A;  3SQI A;  4P0P A;  3PZP A;  4JMU A;  2G5H B;  2LKY A;  2HBK A;  2YX8 A;  2KIW A;  4BJQ A;  2Y0S C;  1PVQ A;  2Z7J A;  1PVR A;  3D2N A;  3LVV A;  3F53 A;  1HIW A;  2W7O A;  2ZIW B;  3D2S A;  3M6Z A;  2HMX A;  2GH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...