2JMGA

Solution structure of v7r mutant of hiv-1 myristoylated matrix protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
131
structure length
131
Chain Sequence
GARASRLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Point mutations in the HIV-1 matrix protein turn off the myristyl switch.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Gag polyprotein
total genus 33
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2006-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2jmgA01
2GOLA 2JMGA 2LYAA 2H3IA 2NV3A 2H3ZA 1ECWA 4ICAA 2H3FA 1HEKA 2K4IA 1L6NA 1TAMA 2HMXA 4JMUA 2H3VA 2K4EA 2LYBA 2H3QA 2N1RA 1A6SA 2K4HA 1HIWA 4IC9A 1ED1A 1UPHA
chains in the Genus database with same CATH superfamily
3CYMA 7ICVA 3EUB2 5ALKA 2KN7A 4M47A 1YZ7A 2OWOA 2XC9A 3SZ2A 4JV1A 4UB6U 2W43A 2NRXA 3NVZA 5CA7A 3ZDBA 5L1LA 1LB2B 9ICUA 5AI8A 4KMUA 4XQ8A 3D2NA 1A6SA 2PFQA 2KKVA 4Q44A 2HHVA 2ZIVA 3VC8A 3C29A 1KN5A 1WG8A 3AU6A 5KFLA 4IQWA 5D49A 1EXNA 4MEXA 3HP6A 4M9JA 5HHHA 5DLFA 4O5EA 8ICCA 3UMGA 1L7OA 1NI3A 4K4HA 3EWAA 1VDVA 3TAQA 1KFSA 5KT6A 3SAFA 2PI5A 3QUCA 2XY5A 2ASLA 4ECYA 4DLGA 2KNJA 4MEYA 3TACB 3BS7A 2R8IA 2Y1JA 1BPDA 4KX5A 2BZFA 4KN7A 2YN4A 8ICPA 4BWJA 3ZD8A 1RDFA 4OCZA 3NUQA 2P6UA 4KLDA 4YMOA 3WK8A 3V72A 4GFJA 5DDYA 1ZQZA 1N61A 2HI0A 5J2KA 5J0UA 4KLEA 3GV8B 2KZZA 3IHQB 2YQEA 3K4GA 4F71A 5TZVA 5EWFA 4RUCA 5L1KA 5KT7A 2PMZC 1IIPA 2JRZA 3F2CA 2EDUA 1BPXA 8ICXA 5AKIA 3L3FX 4O3QA 2KG5A 2KFZA 4J9QA 5DLGA 4EBEA 2PMZF 2IOFA 4AYBF 4CE6A 1CEZA 2Q4TA 3GV7B 4O0IA 4RQ8A 2EAMA 3TFSA 3HX0A 4ED8A 4UB1A 1K5OA 2KZMA 5AK6A 4MFCA 1ED1A 2QARB 4FS1A 4JWMA 4FZLA 3JPPA 5EE1A 3NRWA 5CR0A 3RAQA 3RJFA 3KTQA 1RYRA 3RTVA 1ZQTA 4I2GA 3PX0A 4GXIA 2ASDA 5KAFU 2EANA 2B0CA 2JZBB 4KLSA 4FFDA 1TVAA 4NWIA 4YD1A 4DL2A 1RQNA 2RDJA 3V6KA 3GIIA 4C8KA 2OYYA 3PW5A 5JUMA 1JX4A 1QCKA 4HAIA 4ECWA 1ZQRA 2YB1A 2PFOA 9ICOA 5EWGA 2BDUA 1TE2A 3RH4A 4I2HA 4RZRA 1N60A 4Q8FA 2BR0A 4UB8U 1XSNA 4O3OA 1HUOA 3UXPA 4DF4A 1XS9D 4EZ6A 4C8LA 2WF9A 3RR7A 4BXOB 1RXVA 5IIOA 4PHAA 5KTQA 4PL2A 5DGBA 2WF7A 3IG5A 1DRGA 1FEZA 3I76A 3KHRA 1L5UA 1CRXA 2K4PA 3OJUA 3NVWA 1NK8A 2V9WA 1SV0C 3QZ8A 2NRZA 2KIVA 4YG2A 4DL4A 4PZNA 1IG6A 9ICJA 2FPKA 3M9OB 1ZRMA 4PHPA 2BCSA 2WAQC 3FM9A 2Z7JA 3ISCA 4Z6CA 1X2IA 1WUDA 3KZIU 4QZBA 2KD1A 4USAA 4IS7A 1URJA 5IIKA 4F5QA 1VLBA 1ZQSA 1ZQKA 5A0LA 8ICIA 2VA3A 2ZIVB 3D6JA 2WB1F 7ICUA 8ICRA 5J0RA 1B4FA 3H4DA 3PX6A 2MSNA 7ICRA 3HRDD 5KFSA 2JH1A 1ZD2P 2E8OA 3BS5A 3IV6A 5AKJA 3Q8SB 5DBCA 3BQ7A 4ECZA 2KJ5A 1ZOLA 4K4IA 3C2LA 4F4KA 8ICVA 3OGUA 4ZOHC 2YX8A 2E3TA 3MFHA 9ICTA 4DQQA 2CRXA 3KZXA 2M0NA 5EE0A 3C2KA 5ALYA 4RQ1A 2W7OA 2ZUBA 4TUQA 3RB0A 5ALZA 2B6GA 3PSTA 4RQ3A 4BUGA 5DKWA 3PVXA 2XCPA 4UQGA 3SV4A 3TANA 4O3MA 1RYSA 5AIBA 5J2CA 2PXIA 4ED7A 2F8LA 4DQPA 2DGZA 1YZ6A 2CPRA 1T94A 3DDHA 3AL0B 4QIWC 5B5EU 5KFQA 3OPXA 4AP9A 4LJXA 2ZIUB 4I27A 3WK4A 3N7PD 2K4IA 5KG6A 1P7DA 5ALOA 4QW9A 3BZCA 2UVVA 5AM4A 3K1ZA 4NJ8A 3AN1A 1YT3A 1BPZA 7ICLA 4GIBA 3KHLA 3UXOA 4ECTA 1DGSA 3MC1A 1K1SA 5KFYA 2FLPA 3SYZA 3SAGA 3PW7A 5JRTA 2ES6A 2KVSA 3AM9A 4DSFA 4NM2A 2VANA 5KFOA 4RU9A 2W03A 5JU5A 4F50A 1Z4OA 4I29A 5KT4A 3AU2A 4I2CA 2BKEA 4M2YA 2MA1A 4C7ZA 4FBUA 5J0PA 3QE9Y 9ICAA 4F5RA 5ALJA 3GFKB 5J0XA 3M6ZA 3M9NB 1D8YA 1PVQA 2E8PA 1Y88A 2KKPA 1N56A 2HHTA 3JPNA 2KICA 1T7PA 5J0YA 2DL0A 4QJFB 1SL1A 1TK0A 2JZBA 2ESEA 1ZQBA 3PY8A 5KNIA 2IOFK 5J29A 5KFFA 3N97B 3N4MB 5CHGA 1ZQ1C 2H3FA 5E79U 1TAMA 3H8JA 3RBDA 3TADC 3O0FA 2OXOA 3F5AA 2K4EA 3MGHA 3AUOA 1ZQEA 3Q8QB 4KLLA 2MUTA 2V4QA 2KE7A 4EEKA 1JUDA 1QSSA 3WKDA 4Q45A 8ICLA 1QQ5A 5AKXA 1S97A 4TQSA 4RQ7A 2A3VA 4BXOA 1NZBA 5H2FU 2I5HA 3QU7A 5KFAA 1LV5A 3PZPA 4X5VA 8ICFA 1SZPA 3V6JA 3MABA 2JEIA 1IV8A 3ONNA 4EX6A 5KT2A 2JEGA 1L7MA 5ALFA 4RQ0A 3NTUA 4I2IA 5AKKA 5KFIA 3QEBZ 1MC8A 2NRTA 3MR3A 1Q3UA 4DQIA 2DWQA 5IILA 1DGJA 2YMQA 2HOQA 1PVRA 4J9OA 9ICVA 3RH6A 2RRDA 4DL3A 1PK1A 1COOA 2R8KA 1FFVA 3GZFA 2C2DA 1PK1B 2QLTA 5K4LA 4UBCA 3PW4A 4I2EA 4NLNA 2WF5A 2W3RA 2C2EA 1S0NA 4QZHA 1X40A 5KFMA 3ETRA 1OW5A 1Z19A 1N2XA 3GIMA 4KTQA 2XVTA 5DG8A 4RPYA 5KFTA 4QZIA 2KHVA 3N7RC 4C8NA 1ZQAA 1MA7A 2F8KA 3LYSA 3WKEA 4NLZA 1NKCA 4ZH4A 2NYVA 3GU3A 3IRUA 4IRDA 4ECXA 3HT3A 4CNQA 4YVZA 4QZFA 1QLNA 2O6KA 4DS4A 1Z00A 4ED0A 2ZXHA 3B0XA 2HHXA 3NRZA 2R8HA 3C23A 3UMBA 3H40A 3PV8A 5KFZA 1V38A 1JRPA 2K4HA 3UXNA 3V6HA 9ICBA 1JALA 3EW9A 4UAWA 3L4PA 1NJWA 4JUZA 3RJEA 5DB8A 3BDPA 3MR2A 1S5LU 4KLFA 4QWCA 5KG5A 3KKAA 4TUPA 4ICAA 2F1JA 1U45A 1JIHA 4I28A 2HMXA 3E0FA 2BCQA 4J9LA 1UCVA 1L3SA 4DL5A 5KFUA 2AQ4A 2HVHA 5L1IA 4B6JA 1ECWA 2DKXA 5ALQA 2J6UA 4EBCA 1COKA 2H3IA 3K1RB 4BGDA 5KFBA 4RQ6A 4U7CA 4FE3A 4CRXA 1T3NA 2HOFA 4F91B 2PI4A 2KJ8A 4C4SA 3E2EA 2HBMA 3H0MB 3BZKA 4JV0A 4M6WA 2DPJA 3FDSA 1OUQA 2GLEA 1ZD5A 5AM0A 2DPIA 2NRWA 4P2HA 3GDXA 4F4WA 1O08A 3C1ZA 5JTIA 1SXDA 2BCUA 4DWIA 2ZIXB 2ZXIA 3WK7A 1PUZA 2W9CB 1L8LA 5CB1A 4IRCA 3GIKA 3ED5A 2M9NA 2V4RA 4DFDA 3BQ2A 2FDRA 3JPQA 3M7DA 4A8EA 2FPMA 1KLNA 3KKAC 3C21A 2G08A 5J0TA 3OSNA 1T4GA 5AM2A 2QB1A 2XY6A 4FS2A 1N5WA 3C28A 1AROP 2GH1A 1F44A 3QX7A 3AQEA 3H8MA 4FZMA 4U6PA 2JEFA 4GC7A 4QZGA 2W11A 3H0LB 3SR6A 5KFPA 3UM9A 2Q0ZX 8ICSA 3QU2A 2A1AA 5KFVA 2A19A 4P0QA 2AGPA 2FI1A 4Y2TA 2K60A 2HHWA 2YMPA 5AM3A 1BNOA 3BQ0A 3D2SA 2VIXA 4O5CA 7ICGA 1ZXIA 2JXJA 4KLGA 5DB7A 2W04A 5AM1A 2LPEA 2KOBA 2LYAA 1S77D 1C7YA 3T5HA 1A77A 5J2BA 2PFPA 4TURA 2WFAA 1OXJA 2Y9TA 9ICSA 2XIDA 4UB4A 1TK8A 4GXJA 9ICXA 5AIAA 5ALIA 4O3SA 5J2FA 3M9MB 4G3IA 2KV2A 1Z1VA 5ALPA 1S0OA 3NVYA 1RPLA 8ICBA 4RNNA 2F77X 5TISU 2KHQA 2HCFA 1X42A 3KD3A 5KL1B 3NGDA 8ICKA 1K1QA 4FBTA 3T5JA 1RG6A 1ZJNA 4F92B 5J2AA 5HHIA 1QSLA 5L1MA 1MSWD 1D8LA 1ZQYA 2QB0A 5J2HA 2UVUA 2LBOA 2DFLA 1ZD4A 2GOLA 1QH9A 3GIJA 4QIWF 5J2DA 3THVA 4DL7A 1L7NA 1RYUA 1WYGA 2EAPA 3BS5B 4O3PA 2ZTCA 4ELVA 4IL6U 4B9SA 5GTIU 3MFIA 2R8GA 3K75D 2AXTU 3EPIA 2JV3A 4QWAA 4PZOA 4RUAA 4EYIB 3TAPA 3DV9A 3KHGA 1JXLA 4ECSA 3LWLA 4P0PA 1XSPA 3B9JA 2EQYA 2HHQA 3PX4A 1BPBA 2W9CA 1KKXA 2JMGA 4QZCA 4PJ0U 3CNHA 3HILA 2BHNA 4UASA 3TARA 5KFJA 4LVSA 2IMWP 3QUTA 4YQWA 5F9NA 4QZ9A 1H38A 1L3UA 3M8RA 1L7PA 2KSOB 2J6TA 5ALEA 2OCEA 4KN4A 3MBYA 5KFNA 4YR0A 3LVVA 3AQFA 3L5KA 2KVCA 1S10A 2QKQA 3OHBA 1NZPA 5AM5A 1NJXA 2Y1IA 4YMNA 2CXYA 4NL9C 3BJYA 9ICPA 3CW2C 4DSLA 1UHUA 5EE9A 1Q46A 3UPQA 1N63A 2KEYA 3MR6A 1FIQA 4DEZA 2G07A 3F5EA 2F2AB 5BOLA 4ECQA 2IBKA 3TFRA 5FP0A 5ALLA 5KG1A 3SAHA 1B22A 3JPRA 3N7SC 5CWRA 2Y0SF 3ZDCA 4O3NA 1KQQA 4IQUA 3BQTA 2ZTEA 4NY8A 2I6XA 3WK6A 2G06A 1UA0A 2XO7A 4B9NA 4MHVA 5AKEA 2HSZA 1X6JA 4US9A 5ALTA 4M9HA 1ZQFA 4ED3A 1WCNA 9ICIA 4C7YA 7ICMA 3SEIA 4ELUA 3I28A 3QUBA 1ZQHA 1IXRA 2W3SA 3QEAZ 4Y2QA 4QZAA 3T79A 2VJ4A 3CRXA 2H3QA 3Q8PB 2UVWA 1D9FA 3PMLA 3F2BA 3RBEA 3Q8RB 1X9SA 1QQ7A 5DQHA 5ALRA 5ALSA 5C0YA 5KFRA 4DL6A 1BVSA 3J81j 4RQMA 3HW8A 3TI0A 4C4RA 2KIWA 5AKGA 3RJKA 9ICKA 5IIJA 4EENA 1SGGA 2AJQA 1Q8KA 2KMDA 3TQ1A 4E0DA 2GO7A 3KBBA 4LZDA 2YY6A 4DFPA 4GC6A 1NK5A 9ICRA 3LDAA 3RFAA 5KG2A 1SZHA 1SV0A 2KP7A 4B9MA 1NK4A 4IQTA 3FC4A 4OJOA 5IIMA 3QXGA 3KFUF 2DUYA 1RQLA 4UAZA 3AEVA 1C20A 3Q8MA 2G5IB 4NLGA 2G0AA 5KFEA 4KLTA 3PSFA 5AI9A 3RB3A 2KTQA 3SMVA 1LKYB 1KSPA 4B9TA 2W54A 4RNOA 4UAVA 1TK5A 2AH5A 2H5XA 4Q43A 1LKYA 3FAHA 5L9XA 8ICGA 2IHNA 1O03A 1UQVA 1U49A 1ZQMA 4KLMA 4R64A 4F5PA 1ZQGA 2QB0B 3MDCA 1V85A 1NNLA 3IP4B 9ICQA 4F4YA 9ICFA 5AI5A 2BPGA 2ASJA 4RT3A 1X9MA 3SV3A 1LVHA 3PR5B 1IM4A 1Z00B 5DBBA 1T3QA 4PPXA 3AMZA 8ICUA 4OJPA 3RB4A 3JPOA 2RHFA 3A0BU 1S8OA 4RPZA 2JHDA 1ZQUA 3LVWA 4UARA 2W9BA 2WTFA 4MF2A 4ED2A 1TKDA 1S76D 1TAQA 5ALVA 1JROA 3MR5A 4RQ5A 2F3NA 5J0OA 3ZI4A 1SB3C 4BDPA 3RJHA 1MQ2A 4QW8A 1XO0A 1PK3A 4Y2PA 5B66U 3Q8KA 3F53A 5KAIU 4DLEA 4M9GA 2RDIA 4IR1A 5EOZA 4J9PA 2LYHA 4NL9A 7ICPA 2KK0A 3WKAA 4YR3A 1L3TA 4UBBA 1SWWA 3CP8A 1J2NA 2LM4A 4DOAA 4O5KA 2MUTB 3T3FA 2L5YA 4J9KA 2E1EA 2PKEA 2CN1A 8ICAA 3S6JA 1ZD3A 1ZQJA 1UPHA 2RLTA 2LI6A 2XICA 4C4TA 1XNSA 1S0VA 4YCXA 8ICEA 3UQ2A 4OD0A 2BQ3A 4XUSA 9ICGA 2K8AA 2HDOA 4QZ8A 5DG7A 2RQ5A 3VCBA 4YP3A 4RNMA 4NLKA 4DQRA 2EH9A 4PL1A 4C8OA 4F3OA 4YMMA 1NKBA 5DB9A 1KEJA 1U47A 2UVRA 7ICHA 5G5HA 5HMLA 4ECVA 3RAXA 2HBLA 1FO4A 4R8UA 4PGXA 2G5HB 4B9VA 8ICMA 2BQUA 2WF8A 4JWNA 4KITB 3ISBA 4NLCA 5KFWA 4UAUA 1SV4A 4EX7A 3LWMA 5AI0A 4YR2A 9ICHA 4CGZA 1A0PA 1ZQQA 4ED1A 4GLXA 1B0XA 2AGQA 3Q8LA 4NXZA 3RRHA 4R65A 2ALZA 1SKSA 4JMUA 4I2DA 5D4BA 4CDGA 4NV0A 3PR4A 2I9GA 5HR6A 1MN8A 1T8EA 9ICMA 4DQSA 2VJ5A 2W9BB 4KLHA 2F1IA 2FMSA 1RZTA 5J2IA 7ICOA 2A1JA 4I2FA 4P0QB 5DBAA 5KFDA 5ALGA 2OM6A 4JK1A 2MAXA 7ICIA 2AHOB 3G6VA 5KG7A 2K89A 5AKHA 5AK3A 1SKWA 4Y2VA 4KX3A 4J9NA 4DOBA 4QZEA 1X9XA 3N28A 4EBDA 1NK7A 1SIJA 4OO1J 4QWEA 4Z6DA 4YFKA 3QU5A 2JEJA 2E8MA 1A76A 1XSLA 5T14A 4DFJA 2R18A 5KFCA 3MDAA 3NVVA 2F1HA 4AYBC 4PHDA 3QYPA 4M6WB 7ICEA 5ALHA 5KG3A 1B43A 3EZ5A 1UA1A 2FJ6A 3RB6A 3H0RB 4DFKA 1UT5A 5ALDA 2B21A 4B9UA 3H7IA 2IOHA 2BCRA 7ICKA 2GWSA 5KT3A 1ZQLA 1M6YA 1TAUA 3ALRA 3E58A 1Z4NA 2RP5A 2YMLA 3I1YA 4Y2JA 3LK9A 4Y2XA 2ATLA 2FMQA 4IC9A 4DFMA 4DSKA 1ZQDA 4YD2A 2Y0SC 4P0PB 3SI8A 5J0QA 2W8LA 3ZDAA 4J03A 4OJ6A 9ICCA 4BJQA 4F2RA 2NV3A 3H8SA 5EWEA 2HBKA 2ZIWA 7ICSA 8ICOA 4I2JA 5DG9A 4PH5A 2YMMA 5AKYA 4C0ZA 3GV5B 3ZD9A 5KG4A 4Y2SA 1BGXT 2HHSA 2ZUDA 3HWTA 2KZ3A 2ZG6A 2WF6A 2FLNA 2XCAA 4QWDA 7ICQA 5BPCA 9ICLA 1U9LA 4P4OA 2DF4B 3M1YA 2C28A 1J97A 5HMMA 4PHEA 5DGAA 4M0AA 5HR7A 4I2BA 5EE3A 4BX9C 5KL8B 4NLBA 2ZUCA 3M6KA 3QU9A 2JH7A 1KFDA 2NRVA 1JXEA 3F2DA 5J0SA 4F2SA 4Q8EA 5CP2A 5J0WA 1XU4A 7ICTA 3WKCA 2BCVA 4F8RA 4C80A 3C1YA 1X9WA 4KLUA 2AQ0A 4UB3A 1QQ6A 2K8BB 1KFTA 4QWBA 4RQNA 4J9MA 1WWUA 2WHEA 5GTHU 2WB1C 4ED6A 1ZYQA 4RT2A 4F4ZA 2ZJ5A 1N62A 5KT5A 4M04A 3PW0A 4DSEA 2HVIA 4XA5A 1ZQNA 8ICNA 1KL9A 2C22A 1JN3A 4UB5A 1QTMA 4UATA 5AHXA 3TKAA 2HHUA 3EYZA 1CUKA 3JPSA 2H3ZA 4F93B 1L6NA 2EZYA 4B9LA 3H8WA 5KFHA 4CF4A 5CRXA 2OH2A 1SKRA 4MFAA 3DEEA 3WU2U 1RM6C 5CEHA 5J2EA 4ECUA 1KRPA 2IA6A 3PSIA 4JV2A 4RPXA 3V7KA 3RJGA 2C2RA 5BOMA 1KTQA 1BNPA 2EAOA 5ALXA 2D8CA 3RRGA 1JMSA 1XWLA 4BWMA 5IIIA 2E5SA 4I2AA 1ZQXA 1ZRNA 3HJEA 5AK4A 3ORYA 3UQ0A 1NJYA 2HOIA 4O9MA 3D2QA 5DB6A 2ZJAA 2XGPA 1NOMA 3PMNA 4TQRA 3IG8A 2LM1A 3M8SA 1QSYA 5DDMA 3PSPA 2WAQF 2LHTA 2PFNA 5J2GA 4PGQA 4DOCA 1DXSA 3HPOA 1NKEA 4R66A 1V9PA 8ICQA 5F3XB 2IHMA 2OEHA 5IINA 2D6FC 2P6RA 4GXKA 2FLLA 4P4PA 2XY7A 1DK3A 4HYKA 1MQ3A 2VKQA 1N48A 1D9DA 3T5KA 2EZZA 3PNCA 4ECRA 1NK0A 7ICJA 3C5FA 3PO4A 4NM1A 5KG0A 4KLJA 2D3DA 1BPYA 1JI7A 1UT8A 1VJ5A 4Z6FA 2YB4A 3SD7A 1ZJMA 2ZIUA 7ICFA 1ZQIA 4QZDA 3RR8A 3A0HU 2I1QA 4MF8A 2Y9UA 4F5NA 5C5JA 3EPGA 2E1FA 4PGYA 1SWVA 2P66A 3T5LA 2XI9A 4XRHA 1WCLA 4Y2YA 4DS5A 3PW2A 4CF3A 1KDHA 3MGVA 4M9LA 2ZIXA 3IDWA 2HW3A 4EEYA 1SXEA 4Z6EA 3C2MA 1NK6A 3ICXA 3KOOA 3WK5A 4R8UB 2HBJA 1ZQVA 2QARA 4ACOA 5CJ7A 2MU2A 3OJSA 7ICNA 5G5GA 4J9RA 4EELA 4DCCA 4LZGA 3C5GA 2W55A 1L8OA 1X66A 2BPCA 2EZXA 2LMRA 4EZ9A 1DOQA 2W8KA 8ICWA 3BQ1A 4YXMA 2ODGA 5HP4A 1U48A 4CCHA 1Z3EB 4OJLA 5DQGA 2F44A 4IRKA 2K8CB 5J2JA 4JB3A 2NO4A 3ZDEA 4KMOB 2A1JB 4CF5A 1V97A 2VA2A 2KSOA 4G9BA 4R63A 1FFUA 5ALUA 5AKZA 4RQ4A 4P4MA 2AU0A 4UW9A 5DQIA 3JPTA 3QZ7A 3OTQA 3GILA 4MFFA 5ALMA 4KLIA 4M9NA 5KFXA 1HUZA 3G6YA 5AI6A 1XO1A 1ZETA 2J6SA 2LKYA 1F5SA 2MRLA 2KFNA 3QUQA 3PO5A 4F4XA 1J2MA 2FPLA 5L1JA 4IR9A 2KJ9A 2G09A 4UAYA 5AK5A 5AKLA 3G6XA 1HEKA 3ETLA 4Y2UA 2JGAA 8ICHA 3V7JA 4UB2A 3SQIA 1GO3F 2P35A 1S0MA 3ISDA 9ICWA 5ALNA 2W7PA 4OJ5A 5F9LA 3RH5A 1KBUA 2DQNB 1S9FA 1ZQOA 1L3VA 2FE9A 1SL0A 2H3VA 3MGIA 1HIWA 4Y2RA 1NK9A 3H4BA 4FO6A 1TV9A 3OSPA 3OHAA 4DSIA 1CI4A 3WK9A 2DBYA 2F76X 3R9KA 4DF8A 3NASA 1WWVA 2OHFA 3NS1A 5J8YC 3B0YA 3GQCA 1RXWA 2LYBA 1PZNA 4KLOA 3RJJA 3IM1A 2YTUA 4J9SA 2XGQA 1F0MA 3IN5A 4YXJA 4DO9A 2DKZA 2W9AA 5KFKA 8ICYA 1SL2A 1TFRA 2BQRA 4O3RA 4YN4A 9ICNA 8ICJA 5AI4A 2ZIWB 1ZQWA 2ZJ8A 1Q3VA 2VA8A 2NO5A 2BGWA 2ZTDA 1XC9A 2N1RA 2ISPA 8ICZA 5J8YA 3ZDDA 1PVPA 3FYHA 1HJPA 4FZNA 5AICA 3HKZF 4QNLA 4F5OA 4US8A 5HNKA 3WKBA 1ZQCA 3UMCA 4RQ2A 2R8JA 3TADA 4DSJA 8ICTA 1Z1BA 1NJZA 3HKZC 1KW4A 2AGOA 1AQ6A 2FMPA 2BDPA 4EYHB 1BPEA 4F72A 3RJIA 5KFGA 1U4BA 3RF9A 2BPFA 2W9MA 5D46A 4IQVA 3KHHA 2JR5A 4TUSA 4WJ3B 4C8MA 1ZQPA 1D8BA 3QU4A 3V7LA 4K4GA 1N5XA 9ICEA 3QNMA 1X6IA 4KLQA 2E8NA 2ISOA 4ELTA 1DK2A 3SENA 3U26A 5ALWA
chains in the Genus database with same CATH topology
3IG8A 3M6KA 3CYMA 3H0LB 2JH7A 2CPRA 1T94A 3F2DA 3L3FX 2G5HB 4AYBC 3AL0B 4QIWC 3PSPA 2WAQF 2A3VA 2F76X 1NZBA 2PMZF 3OPXA 2LHTA 2WAQC 2Z7JA 2ZIUB 4AYBF 4ICAA 4P0QA 4P0PA 3N7PD 4OJPA 4OJLA 3PZPA 2K4IA 1WUDA 2Q4TA 1P7DA 2HMXA 2RHFA 2K8CB 3E0FA 3SQIA 3T79A 2VJ4A 3CRXA 2KD1A 2H3QA 2LYBA 3H0RB 2JHDA 3ONNA 3D2SA 2VIXA 1URJA 4KMOB 3K1ZA 1YT3A 2K8BB 3F2BA 2D6FC 3LVWA 4NLCA 1ED1A 1ECWA 3D2NA 3IN5A 4FZLA 2KKVA 1A6SA 2JMGA 2CRXA 2W04A 5C0YA 2ZIVA 2KOBA 3NRWA 3VC8A 3C29A 2VKQA 4CGZA 1A0PA 2H3IA 2LYAA 2WB1C 1Q3UA 5A0LA 4NLBA 3SAGA 4U7CA 2ZIVB 3ALRA 4FE3A 4CRXA 2KIWA 2WB1F 2HOQA 1PVRA 2HOFA 2XIDA 2ZIWB 1XO0A 2KJ8A 2RP5A 2RRDA 2W03A 1Q3VA 4JMUA 2HBMA 3F53A 3H0MB 4NWIA 3LVVA 2N1RA 3AQFA 3GZFA 2YB4A 2KVCA 2KV2A 4NV0A 4CDGA 5HR6A 4IC9A 2ZIUA 1PVPA 4FZNA 2LKYA 1OUQA 2MRLA 3HKZF 2Y0SC 2VJ5A 2F77X 2MA1A 4QNLA 4P0PB 4OJ6A 3RFAA 2KHQA 3CP8A 3SAFA 1SZHA 2OYYA 4BJQA 2KJ9A 2E1FA 2G09A 2KNJA 1Z19A 2NV3A 3M6ZA 5KL1B 2JH1A 2H3ZA 2XVTA 1PVQA 4OJOA 1Z1BA 2ZIXB 2ZXIA 2HBKA 2ZIWA 1HEKA 2YB1A 2KKPA 1L6NA 3HKZC 2KEYA 4P0QB 2KHVA 2XI9A 2BDUA 3N7RC 3KFUF 4KX5A 5CRXA 1MA7A 2OH2A 4C0ZA 2E1EA 2G07A 2KJ5A 2F2AB 3DEEA 2OM6A 2CN1A 3F5EA 2JGAA 3LYSA 3MGVA 2G5IB 2ZIXA 2KICA 2YX8A 3NUQA 2G0AA 2ZG6A 2K89A 3ICXA 3KZXA 3RF9A 3PSIA 2LBOA 1GO3F 1UPHA 3GU3A 3PSFA 2GOLA 4QJFB 3M7DA 4A8EA 3SAHA 4QIWF 2HBJA 3N7SC 3SMVA 4ACOA 2M0NA 2G08A 2XICA 1XNSA 2Y0SF 4GFJA 2W7PA 4OJ5A 4WJ3B 4KX3A 2W7OA 2K8AA 1D8BA 1KBUA 2DQNB 2ZXHA 2DF4B 1ZQ1C 2G06A 2H3FA 3PSTA 4PL2A 3VCBA 4OO1J 2E5SA 4BUGA 3C28A 1TAMA 3IG5A 2GH1A 1F44A 4PL1A 1DRGA 3O0FA 2OXOA 3F5AA 2H3VA 2K4EA 2HOIA 4O3MA 2PMZC 3D2QA 1IIPA 3F2CA 5HR7A 2K4HA 3AQEA 4BX9C 5T14A 1HIWA 2R18A 5KL8B 1CRXA 4FZMA 2F8LA 3IP4B 2DGZA 2HBLA 4U6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GOL A;  2JMG A;  2LYA A;  2H3I A;  2NV3 A;  2H3Z A;  1ECW A;  4ICA A;  2H3F A;  1HEK A;  2K4I A;  1L6N A;  1TAM A;  2HMX A;  4JMU A;  2H3V A;  2K4E A;  2LYB A;  2H3Q A;  2N1R A;  1A6S A;  2K4H A;  1HIW A;  4IC9 A;  1ED1 A;  1UPH A; 
#chains in the Genus database with same CATH topology
 3CYM A;  7ICV A;  3EUB 2;  5ALK A;  2KN7 A;  4M47 A;  1YZ7 A;  2OWO A;  2XC9 A;  3SZ2 A;  4JV1 A;  4UB6 U;  2W43 A;  2NRX A;  3NVZ A;  5CA7 A;  3ZDB A;  5L1L A;  1LB2 B;  9ICU A;  5AI8 A;  4KMU A;  4XQ8 A;  3D2N A;  1A6S A;  2PFQ A;  2KKV A;  4Q44 A;  2HHV A;  2ZIV A;  3VC8 A;  3C29 A;  1KN5 A;  1WG8 A;  3AU6 A;  5KFL A;  4IQW A;  5D49 A;  1EXN A;  4MEX A;  3HP6 A;  4M9J A;  5HHH A;  5DLF A;  4O5E A;  8ICC A;  3UMG A;  1L7O A;  1NI3 A;  4K4H A;  3EWA A;  1VDV A;  3TAQ A;  1KFS A;  5KT6 A;  3SAF A;  2PI5 A;  3QUC A;  2XY5 A;  2ASL A;  4ECY A;  4DLG A;  2KNJ A;  4MEY A;  3TAC B;  3BS7 A;  2R8I A;  2Y1J A;  1BPD A;  4KX5 A;  2BZF A;  4KN7 A;  2YN4 A;  8ICP A;  4BWJ A;  3ZD8 A;  1RDF A;  4OCZ A;  3NUQ A;  2P6U A;  4KLD A;  4YMO A;  3WK8 A;  3V72 A;  4GFJ A;  5DDY A;  1ZQZ A;  1N61 A;  2HI0 A;  5J2K A;  5J0U A;  4KLE A;  3GV8 B;  2KZZ A;  3IHQ B;  2YQE A;  3K4G A;  4F71 A;  5TZV A;  5EWF A;  4RUC A;  5L1K A;  5KT7 A;  2PMZ C;  1IIP A;  2JRZ A;  3F2C A;  2EDU A;  1BPX A;  8ICX A;  5AKI A;  3L3F X;  4O3Q A;  2KG5 A;  2KFZ A;  4J9Q A;  5DLG A;  4EBE A;  2PMZ F;  2IOF A;  4AYB F;  4CE6 A;  1CEZ A;  2Q4T A;  3GV7 B;  4O0I A;  4RQ8 A;  2EAM A;  3TFS A;  3HX0 A;  4ED8 A;  4UB1 A;  1K5O A;  2KZM A;  5AK6 A;  4MFC A;  1ED1 A;  2QAR B;  4FS1 A;  4JWM A;  4FZL A;  3JPP A;  5EE1 A;  3NRW A;  5CR0 A;  3RAQ A;  3RJF A;  3KTQ A;  1RYR A;  3RTV A;  1ZQT A;  4I2G A;  3PX0 A;  4GXI A;  2ASD A;  5KAF U;  2EAN A;  2B0C A;  2JZB B;  4KLS A;  4FFD A;  1TVA A;  4NWI A;  4YD1 A;  4DL2 A;  1RQN A;  2RDJ A;  3V6K A;  3GII A;  4C8K A;  2OYY A;  3PW5 A;  5JUM A;  1JX4 A;  1QCK A;  4HAI A;  4ECW A;  1ZQR A;  2YB1 A;  2PFO A;  9ICO A;  5EWG A;  2BDU A;  1TE2 A;  3RH4 A;  4I2H A;  4RZR A;  1N60 A;  4Q8F A;  2BR0 A;  4UB8 U;  1XSN A;  4O3O A;  1HUO A;  3UXP A;  4DF4 A;  1XS9 D;  4EZ6 A;  4C8L A;  2WF9 A;  3RR7 A;  4BXO B;  1RXV A;  5IIO A;  4PHA A;  5KTQ A;  4PL2 A;  5DGB A;  2WF7 A;  3IG5 A;  1DRG A;  1FEZ A;  3I76 A;  3KHR A;  1L5U A;  1CRX A;  2K4P A;  3OJU A;  3NVW A;  1NK8 A;  2V9W A;  1SV0 C;  3QZ8 A;  2NRZ A;  2KIV A;  4YG2 A;  4DL4 A;  4PZN A;  1IG6 A;  9ICJ A;  2FPK A;  3M9O B;  1ZRM A;  4PHP A;  2BCS A;  2WAQ C;  3FM9 A;  2Z7J A;  3ISC A;  4Z6C A;  1X2I A;  1WUD A;  3KZI U;  4QZB A;  2KD1 A;  4USA A;  4IS7 A;  1URJ A;  5IIK A;  4F5Q A;  1VLB A;  1ZQS A;  1ZQK A;  5A0L A;  8ICI A;  2VA3 A;  2ZIV B;  3D6J A;  2WB1 F;  7ICU A;  8ICR A;  5J0R A;  1B4F A;  3H4D A;  3PX6 A;  2MSN A;  7ICR A;  3HRD D;  5KFS A;  2JH1 A;  1ZD2 P;  2E8O A;  3BS5 A;  3IV6 A;  5AKJ A;  3Q8S B;  5DBC A;  3BQ7 A;  4ECZ A;  2KJ5 A;  1ZOL A;  4K4I A;  3C2L A;  4F4K A;  8ICV A;  3OGU A;  4ZOH C;  2YX8 A;  2E3T A;  3MFH A;  9ICT A;  4DQQ A;  2CRX A;  3KZX A;  2M0N A;  5EE0 A;  3C2K A;  5ALY A;  4RQ1 A;  2W7O A;  2ZUB A;  4TUQ A;  3RB0 A;  5ALZ A;  2B6G A;  3PST A;  4RQ3 A;  4BUG A;  5DKW A;  3PVX A;  2XCP A;  4UQG A;  3SV4 A;  3TAN A;  4O3M A;  1RYS A;  5AIB A;  5J2C A;  2PXI A;  4ED7 A;  2F8L A;  4DQP A;  2DGZ A;  1YZ6 A;  2CPR A;  1T94 A;  3DDH A;  3AL0 B;  4QIW C;  5B5E U;  5KFQ A;  3OPX A;  4AP9 A;  4LJX A;  2ZIU B;  4I27 A;  3WK4 A;  3N7P D;  2K4I A;  5KG6 A;  1P7D A;  5ALO A;  4QW9 A;  3BZC A;  2UVV A;  5AM4 A;  3K1Z A;  4NJ8 A;  3AN1 A;  1YT3 A;  1BPZ A;  7ICL A;  4GIB A;  3KHL A;  3UXO A;  4ECT A;  1DGS A;  3MC1 A;  1K1S A;  5KFY A;  2FLP A;  3SYZ A;  3SAG A;  3PW7 A;  5JRT A;  2ES6 A;  2KVS A;  3AM9 A;  4DSF A;  4NM2 A;  2VAN A;  5KFO A;  4RU9 A;  2W03 A;  5JU5 A;  4F50 A;  1Z4O A;  4I29 A;  5KT4 A;  3AU2 A;  4I2C A;  2BKE A;  4M2Y A;  2MA1 A;  4C7Z A;  4FBU A;  5J0P A;  3QE9 Y;  9ICA A;  4F5R A;  5ALJ A;  3GFK B;  5J0X A;  3M6Z A;  3M9N B;  1D8Y A;  1PVQ A;  2E8P A;  1Y88 A;  2KKP A;  1N56 A;  2HHT A;  3JPN A;  2KIC A;  1T7P A;  5J0Y A;  2DL0 A;  4QJF B;  1SL1 A;  1TK0 A;  2JZB A;  2ESE A;  1ZQB A;  3PY8 A;  5KNI A;  2IOF K;  5J29 A;  5KFF A;  3N97 B;  3N4M B;  5CHG A;  1ZQ1 C;  2H3F A;  5E79 U;  1TAM A;  3H8J A;  3RBD A;  3TAD C;  3O0F A;  2OXO A;  3F5A A;  2K4E A;  3MGH A;  3AUO A;  1ZQE A;  3Q8Q B;  4KLL A;  2MUT A;  2V4Q A;  2KE7 A;  4EEK A;  1JUD A;  1QSS A;  3WKD A;  4Q45 A;  8ICL A;  1QQ5 A;  5AKX A;  1S97 A;  4TQS A;  4RQ7 A;  2A3V A;  4BXO A;  1NZB A;  5H2F U;  2I5H A;  3QU7 A;  5KFA A;  1LV5 A;  3PZP A;  4X5V A;  8ICF A;  1SZP A;  3V6J A;  3MAB A;  2JEI A;  1IV8 A;  3ONN A;  4EX6 A;  5KT2 A;  2JEG A;  1L7M A;  5ALF A;  4RQ0 A;  3NTU A;  4I2I A;  5AKK A;  5KFI A;  3QEB Z;  1MC8 A;  2NRT A;  3MR3 A;  1Q3U A;  4DQI A;  2DWQ A;  5IIL A;  1DGJ A;  2YMQ A;  2HOQ A;  1PVR A;  4J9O A;  9ICV A;  3RH6 A;  2RRD A;  4DL3 A;  1PK1 A;  1COO A;  2R8K A;  1FFV A;  3GZF A;  2C2D A;  1PK1 B;  2QLT A;  5K4L A;  4UBC A;  3PW4 A;  4I2E A;  4NLN A;  2WF5 A;  2W3R A;  2C2E A;  1S0N A;  4QZH A;  1X40 A;  5KFM A;  3ETR A;  1OW5 A;  1Z19 A;  1N2X A;  3GIM A;  4KTQ A;  2XVT A;  5DG8 A;  4RPY A;  5KFT A;  4QZI A;  2KHV A;  3N7R C;  4C8N A;  1ZQA A;  1MA7 A;  2F8K A;  3LYS A;  3WKE A;  4NLZ A;  1NKC A;  4ZH4 A;  2NYV A;  3GU3 A;  3IRU A;  4IRD A;  4ECX A;  3HT3 A;  4CNQ A;  4YVZ A;  4QZF A;  1QLN A;  2O6K A;  4DS4 A;  1Z00 A;  4ED0 A;  2ZXH A;  3B0X A;  2HHX A;  3NRZ A;  2R8H A;  3C23 A;  3UMB A;  3H40 A;  3PV8 A;  5KFZ A;  1V38 A;  1JRP A;  2K4H A;  3UXN A;  3V6H A;  9ICB A;  1JAL A;  3EW9 A;  4UAW A;  3L4P A;  1NJW A;  4JUZ A;  3RJE A;  5DB8 A;  3BDP A;  3MR2 A;  1S5L U;  4KLF A;  4QWC A;  5KG5 A;  3KKA A;  4TUP A;  4ICA A;  2F1J A;  1U45 A;  1JIH A;  4I28 A;  2HMX A;  3E0F A;  2BCQ A;  4J9L A;  1UCV A;  1L3S A;  4DL5 A;  5KFU A;  2AQ4 A;  2HVH A;  5L1I A;  4B6J A;  1ECW A;  2DKX A;  5ALQ A;  2J6U A;  4EBC A;  1COK A;  2H3I A;  3K1R B;  4BGD A;  5KFB A;  4RQ6 A;  4U7C A;  4FE3 A;  4CRX A;  1T3N A;  2HOF A;  4F91 B;  2PI4 A;  2KJ8 A;  4C4S A;  3E2E A;  2HBM A;  3H0M B;  3BZK A;  4JV0 A;  4M6W A;  2DPJ A;  3FDS A;  1OUQ A;  2GLE A;  1ZD5 A;  5AM0 A;  2DPI A;  2NRW A;  4P2H A;  3GDX A;  4F4W A;  1O08 A;  3C1Z A;  5JTI A;  1SXD A;  2BCU A;  4DWI A;  2ZIX B;  2ZXI A;  3WK7 A;  1PUZ A;  2W9C B;  1L8L A;  5CB1 A;  4IRC A;  3GIK A;  3ED5 A;  2M9N A;  2V4R A;  4DFD A;  3BQ2 A;  2FDR A;  3JPQ A;  3M7D A;  4A8E A;  2FPM A;  1KLN A;  3KKA C;  3C21 A;  2G08 A;  5J0T A;  3OSN A;  1T4G A;  5AM2 A;  2QB1 A;  2XY6 A;  4FS2 A;  1N5W A;  3C28 A;  1ARO P;  2GH1 A;  1F44 A;  3QX7 A;  3AQE A;  3H8M A;  4FZM A;  4U6P A;  2JEF A;  4GC7 A;  4QZG A;  2W11 A;  3H0L B;  3SR6 A;  5KFP A;  3UM9 A;  2Q0Z X;  8ICS A;  3QU2 A;  2A1A A;  5KFV A;  2A19 A;  4P0Q A;  2AGP A;  2FI1 A;  4Y2T A;  2K60 A;  2HHW A;  2YMP A;  5AM3 A;  1BNO A;  3BQ0 A;  3D2S A;  2VIX A;  4O5C A;  7ICG A;  1ZXI A;  2JXJ A;  4KLG A;  5DB7 A;  2W04 A;  5AM1 A;  2LPE A;  2KOB A;  2LYA A;  1S77 D;  1C7Y A;  3T5H A;  1A77 A;  5J2B A;  2PFP A;  4TUR A;  2WFA A;  1OXJ A;  2Y9T A;  9ICS A;  2XID A;  4UB4 A;  1TK8 A;  4GXJ A;  9ICX A;  5AIA A;  5ALI A;  4O3S A;  5J2F A;  3M9M B;  4G3I A;  2KV2 A;  1Z1V A;  5ALP A;  1S0O A;  3NVY A;  1RPL A;  8ICB A;  4RNN A;  2F77 X;  5TIS U;  2KHQ A;  2HCF A;  1X42 A;  3KD3 A;  5KL1 B;  3NGD A;  8ICK A;  1K1Q A;  4FBT A;  3T5J A;  1RG6 A;  1ZJN A;  4F92 B;  5J2A A;  5HHI A;  1QSL A;  5L1M A;  1MSW D;  1D8L A;  1ZQY A;  2QB0 A;  5J2H A;  2UVU A;  2LBO A;  2DFL A;  1ZD4 A;  2GOL A;  1QH9 A;  3GIJ A;  4QIW F;  5J2D A;  3THV A;  4DL7 A;  1L7N A;  1RYU A;  1WYG A;  2EAP A;  3BS5 B;  4O3P A;  2ZTC A;  4ELV A;  4IL6 U;  4B9S A;  5GTI U;  3MFI A;  2R8G A;  3K75 D;  2AXT U;  3EPI A;  2JV3 A;  4QWA A;  4PZO A;  4RUA A;  4EYI B;  3TAP A;  3DV9 A;  3KHG A;  1JXL A;  4ECS A;  3LWL A;  4P0P A;  1XSP A;  3B9J A;  2EQY A;  2HHQ A;  3PX4 A;  1BPB A;  2W9C A;  1KKX A;  2JMG A;  4QZC A;  4PJ0 U;  3CNH A;  3HIL A;  2BHN A;  4UAS A;  3TAR A;  5KFJ A;  4LVS A;  2IMW P;  3QUT A;  4YQW A;  5F9N A;  4QZ9 A;  1H38 A;  1L3U A;  3M8R A;  1L7P A;  2KSO B;  2J6T A;  5ALE A;  2OCE A;  4KN4 A;  3MBY A;  5KFN A;  4YR0 A;  3LVV A;  3AQF A;  3L5K A;  2KVC A;  1S10 A;  2QKQ A;  3OHB A;  1NZP A;  5AM5 A;  1NJX A;  2Y1I A;  4YMN A;  2CXY A;  4NL9 C;  3BJY A;  9ICP A;  3CW2 C;  4DSL A;  1UHU A;  5EE9 A;  1Q46 A;  3UPQ A;  1N63 A;  2KEY A;  3MR6 A;  1FIQ A;  4DEZ A;  2G07 A;  3F5E A;  2F2A B;  5BOL A;  4ECQ A;  2IBK A;  3TFR A;  5FP0 A;  5ALL A;  5KG1 A;  3SAH A;  1B22 A;  3JPR A;  3N7S C;  5CWR A;  2Y0S F;  3ZDC A;  4O3N A;  1KQQ A;  4IQU A;  3BQT A;  2ZTE A;  4NY8 A;  2I6X A;  3WK6 A;  2G06 A;  1UA0 A;  2XO7 A;  4B9N A;  4MHV A;  5AKE A;  2HSZ A;  1X6J A;  4US9 A;  5ALT A;  4M9H A;  1ZQF A;  4ED3 A;  1WCN A;  9ICI A;  4C7Y A;  7ICM A;  3SEI A;  4ELU A;  3I28 A;  3QUB A;  1ZQH A;  1IXR A;  2W3S A;  3QEA Z;  4Y2Q A;  4QZA A;  3T79 A;  2VJ4 A;  3CRX A;  2H3Q A;  3Q8P B;  2UVW A;  1D9F A;  3PML A;  3F2B A;  3RBE A;  3Q8R B;  1X9S A;  1QQ7 A;  5DQH A;  5ALR A;  5ALS A;  5C0Y A;  5KFR A;  4DL6 A;  1BVS A;  3J81 j;  4RQM A;  3HW8 A;  3TI0 A;  4C4R A;  2KIW A;  5AKG A;  3RJK A;  9ICK A;  5IIJ A;  4EEN A;  1SGG A;  2AJQ A;  1Q8K A;  2KMD A;  3TQ1 A;  4E0D A;  2GO7 A;  3KBB A;  4LZD A;  2YY6 A;  4DFP A;  4GC6 A;  1NK5 A;  9ICR A;  3LDA A;  3RFA A;  5KG2 A;  1SZH A;  1SV0 A;  2KP7 A;  4B9M A;  1NK4 A;  4IQT A;  3FC4 A;  4OJO A;  5IIM A;  3QXG A;  3KFU F;  2DUY A;  1RQL A;  4UAZ A;  3AEV A;  1C20 A;  3Q8M A;  2G5I B;  4NLG A;  2G0A A;  5KFE A;  4KLT A;  3PSF A;  5AI9 A;  3RB3 A;  2KTQ A;  3SMV A;  1LKY B;  1KSP A;  4B9T A;  2W54 A;  4RNO A;  4UAV A;  1TK5 A;  2AH5 A;  2H5X A;  4Q43 A;  1LKY A;  3FAH A;  5L9X A;  8ICG A;  2IHN A;  1O03 A;  1UQV A;  1U49 A;  1ZQM A;  4KLM A;  4R64 A;  4F5P A;  1ZQG A;  2QB0 B;  3MDC A;  1V85 A;  1NNL A;  3IP4 B;  9ICQ A;  4F4Y A;  9ICF A;  5AI5 A;  2BPG A;  2ASJ A;  4RT3 A;  1X9M A;  3SV3 A;  1LVH A;  3PR5 B;  1IM4 A;  1Z00 B;  5DBB A;  1T3Q A;  4PPX A;  3AMZ A;  8ICU A;  4OJP A;  3RB4 A;  3JPO A;  2RHF A;  3A0B U;  1S8O A;  4RPZ A;  2JHD A;  1ZQU A;  3LVW A;  4UAR A;  2W9B A;  2WTF A;  4MF2 A;  4ED2 A;  1TKD A;  1S76 D;  1TAQ A;  5ALV A;  1JRO A;  3MR5 A;  4RQ5 A;  2F3N A;  5J0O A;  3ZI4 A;  1SB3 C;  4BDP A;  3RJH A;  1MQ2 A;  4QW8 A;  1XO0 A;  1PK3 A;  4Y2P A;  5B66 U;  3Q8K A;  3F53 A;  5KAI U;  4DLE A;  4M9G A;  2RDI A;  4IR1 A;  5EOZ A;  4J9P A;  2LYH A;  4NL9 A;  7ICP A;  2KK0 A;  3WKA A;  4YR3 A;  1L3T A;  4UBB A;  1SWW A;  3CP8 A;  1J2N A;  2LM4 A;  4DOA A;  4O5K A;  2MUT B;  3T3F A;  2L5Y A;  4J9K A;  2E1E A;  2PKE A;  2CN1 A;  8ICA A;  3S6J A;  1ZD3 A;  1ZQJ A;  1UPH A;  2RLT A;  2LI6 A;  2XIC A;  4C4T A;  1XNS A;  1S0V A;  4YCX A;  8ICE A;  3UQ2 A;  4OD0 A;  2BQ3 A;  4XUS A;  9ICG A;  2K8A A;  2HDO A;  4QZ8 A;  5DG7 A;  2RQ5 A;  3VCB A;  4YP3 A;  4RNM A;  4NLK A;  4DQR A;  2EH9 A;  4PL1 A;  4C8O A;  4F3O A;  4YMM A;  1NKB A;  5DB9 A;  1KEJ A;  1U47 A;  2UVR A;  7ICH A;  5G5H A;  5HML A;  4ECV A;  3RAX A;  2HBL A;  1FO4 A;  4R8U A;  4PGX A;  2G5H B;  4B9V A;  8ICM A;  2BQU A;  2WF8 A;  4JWN A;  4KIT B;  3ISB A;  4NLC A;  5KFW A;  4UAU A;  1SV4 A;  4EX7 A;  3LWM A;  5AI0 A;  4YR2 A;  9ICH A;  4CGZ A;  1A0P A;  1ZQQ A;  4ED1 A;  4GLX A;  1B0X A;  2AGQ A;  3Q8L A;  4NXZ A;  3RRH A;  4R65 A;  2ALZ A;  1SKS A;  4JMU A;  4I2D A;  5D4B A;  4CDG A;  4NV0 A;  3PR4 A;  2I9G A;  5HR6 A;  1MN8 A;  1T8E A;  9ICM A;  4DQS A;  2VJ5 A;  2W9B B;  4KLH A;  2F1I A;  2FMS A;  1RZT A;  5J2I A;  7ICO A;  2A1J A;  4I2F A;  4P0Q B;  5DBA A;  5KFD A;  5ALG A;  2OM6 A;  4JK1 A;  2MAX A;  7ICI A;  2AHO B;  3G6V A;  5KG7 A;  2K89 A;  5AKH A;  5AK3 A;  1SKW A;  4Y2V A;  4KX3 A;  4J9N A;  4DOB A;  4QZE A;  1X9X A;  3N28 A;  4EBD A;  1NK7 A;  1SIJ A;  4OO1 J;  4QWE A;  4Z6D A;  4YFK A;  3QU5 A;  2JEJ A;  2E8M A;  1A76 A;  1XSL A;  5T14 A;  4DFJ A;  2R18 A;  5KFC A;  3MDA A;  3NVV A;  2F1H A;  4AYB C;  4PHD A;  3QYP A;  4M6W B;  7ICE A;  5ALH A;  5KG3 A;  1B43 A;  3EZ5 A;  1UA1 A;  2FJ6 A;  3RB6 A;  3H0R B;  4DFK A;  1UT5 A;  5ALD A;  2B21 A;  4B9U A;  3H7I A;  2IOH A;  2BCR A;  7ICK A;  2GWS A;  5KT3 A;  1ZQL A;  1M6Y A;  1TAU A;  3ALR A;  3E58 A;  1Z4N A;  2RP5 A;  2YML A;  3I1Y A;  4Y2J A;  3LK9 A;  4Y2X A;  2ATL A;  2FMQ A;  4IC9 A;  4DFM A;  4DSK A;  1ZQD A;  4YD2 A;  2Y0S C;  4P0P B;  3SI8 A;  5J0Q A;  2W8L A;  3ZDA A;  4J03 A;  4OJ6 A;  9ICC A;  4BJQ A;  4F2R A;  2NV3 A;  3H8S A;  5EWE A;  2HBK A;  2ZIW A;  7ICS A;  8ICO A;  4I2J A;  5DG9 A;  4PH5 A;  2YMM A;  5AKY A;  4C0Z A;  3GV5 B;  3ZD9 A;  5KG4 A;  4Y2S A;  1BGX T;  2HHS A;  2ZUD A;  3HWT A;  2KZ3 A;  2ZG6 A;  2WF6 A;  2FLN A;  2XCA A;  4QWD A;  7ICQ A;  5BPC A;  9ICL A;  1U9L A;  4P4O A;  2DF4 B;  3M1Y A;  2C28 A;  1J97 A;  5HMM A;  4PHE A;  5DGA A;  4M0A A;  5HR7 A;  4I2B A;  5EE3 A;  4BX9 C;  5KL8 B;  4NLB A;  2ZUC A;  3M6K A;  3QU9 A;  2JH7 A;  1KFD A;  2NRV A;  1JXE A;  3F2D A;  5J0S A;  4F2S A;  4Q8E A;  5CP2 A;  5J0W A;  1XU4 A;  7ICT A;  3WKC A;  2BCV A;  4F8R A;  4C80 A;  3C1Y A;  1X9W A;  4KLU A;  2AQ0 A;  4UB3 A;  1QQ6 A;  2K8B B;  1KFT A;  4QWB A;  4RQN A;  4J9M A;  1WWU A;  2WHE A;  5GTH U;  2WB1 C;  4ED6 A;  1ZYQ A;  4RT2 A;  4F4Z A;  2ZJ5 A;  1N62 A;  5KT5 A;  4M04 A;  3PW0 A;  4DSE A;  2HVI A;  4XA5 A;  1ZQN A;  8ICN A;  1KL9 A;  2C22 A;  1JN3 A;  4UB5 A;  1QTM A;  4UAT A;  5AHX A;  3TKA A;  2HHU A;  3EYZ A;  1CUK A;  3JPS A;  2H3Z A;  4F93 B;  1L6N A;  2EZY A;  4B9L A;  3H8W A;  5KFH A;  4CF4 A;  5CRX A;  2OH2 A;  1SKR A;  4MFA A;  3DEE A;  3WU2 U;  1RM6 C;  5CEH A;  5J2E A;  4ECU A;  1KRP A;  2IA6 A;  3PSI A;  4JV2 A;  4RPX A;  3V7K A;  3RJG A;  2C2R A;  5BOM A;  1KTQ A;  1BNP A;  2EAO A;  5ALX A;  2D8C A;  3RRG A;  1JMS A;  1XWL A;  4BWM A;  5III A;  2E5S A;  4I2A A;  1ZQX A;  1ZRN A;  3HJE A;  5AK4 A;  3ORY A;  3UQ0 A;  1NJY A;  2HOI A;  4O9M A;  3D2Q A;  5DB6 A;  2ZJA A;  2XGP A;  1NOM A;  3PMN A;  4TQR A;  3IG8 A;  2LM1 A;  3M8S A;  1QSY A;  5DDM A;  3PSP A;  2WAQ F;  2LHT A;  2PFN A;  5J2G A;  4PGQ A;  4DOC A;  1DXS A;  3HPO A;  1NKE A;  4R66 A;  1V9P A;  8ICQ A;  5F3X B;  2IHM A;  2OEH A;  5IIN A;  2D6F C;  2P6R A;  4GXK A;  2FLL A;  4P4P A;  2XY7 A;  1DK3 A;  4HYK A;  1MQ3 A;  2VKQ A;  1N48 A;  1D9D A;  3T5K A;  2EZZ A;  3PNC A;  4ECR A;  1NK0 A;  7ICJ A;  3C5F A;  3PO4 A;  4NM1 A;  5KG0 A;  4KLJ A;  2D3D A;  1BPY A;  1JI7 A;  1UT8 A;  1VJ5 A;  4Z6F A;  2YB4 A;  3SD7 A;  1ZJM A;  2ZIU A;  7ICF A;  1ZQI A;  4QZD A;  3RR8 A;  3A0H U;  2I1Q A;  4MF8 A;  2Y9U A;  4F5N A;  5C5J A;  3EPG A;  2E1F A;  4PGY A;  1SWV A;  2P66 A;  3T5L A;  2XI9 A;  4XRH A;  1WCL A;  4Y2Y A;  4DS5 A;  3PW2 A;  4CF3 A;  1KDH A;  3MGV A;  4M9L A;  2ZIX A;  3IDW A;  2HW3 A;  4EEY A;  1SXE A;  4Z6E A;  3C2M A;  1NK6 A;  3ICX A;  3KOO A;  3WK5 A;  4R8U B;  2HBJ A;  1ZQV A;  2QAR A;  4ACO A;  5CJ7 A;  2MU2 A;  3OJS A;  7ICN A;  5G5G A;  4J9R A;  4EEL A;  4DCC A;  4LZG A;  3C5G A;  2W55 A;  1L8O A;  1X66 A;  2BPC A;  2EZX A;  2LMR A;  4EZ9 A;  1DOQ A;  2W8K A;  8ICW A;  3BQ1 A;  4YXM A;  2ODG A;  5HP4 A;  1U48 A;  4CCH A;  1Z3E B;  4OJL A;  5DQG A;  2F44 A;  4IRK A;  2K8C B;  5J2J A;  4JB3 A;  2NO4 A;  3ZDE A;  4KMO B;  2A1J B;  4CF5 A;  1V97 A;  2VA2 A;  2KSO A;  4G9B A;  4R63 A;  1FFU A;  5ALU A;  5AKZ A;  4RQ4 A;  4P4M A;  2AU0 A;  4UW9 A;  5DQI A;  3JPT A;  3QZ7 A;  3OTQ A;  3GIL A;  4MFF A;  5ALM A;  4KLI A;  4M9N A;  5KFX A;  1HUZ A;  3G6Y A;  5AI6 A;  1XO1 A;  1ZET A;  2J6S A;  2LKY A;  1F5S A;  2MRL A;  2KFN A;  3QUQ A;  3PO5 A;  4F4X A;  1J2M A;  2FPL A;  5L1J A;  4IR9 A;  2KJ9 A;  2G09 A;  4UAY A;  5AK5 A;  5AKL A;  3G6X A;  1HEK A;  3ETL A;  4Y2U A;  2JGA A;  8ICH A;  3V7J A;  4UB2 A;  3SQI A;  1GO3 F;  2P35 A;  1S0M A;  3ISD A;  9ICW A;  5ALN A;  2W7P A;  4OJ5 A;  5F9L A;  3RH5 A;  1KBU A;  2DQN B;  1S9F A;  1ZQO A;  1L3V A;  2FE9 A;  1SL0 A;  2H3V A;  3MGI A;  1HIW A;  4Y2R A;  1NK9 A;  3H4B A;  4FO6 A;  1TV9 A;  3OSP A;  3OHA A;  4DSI A;  1CI4 A;  3WK9 A;  2DBY A;  2F76 X;  3R9K A;  4DF8 A;  3NAS A;  1WWV A;  2OHF A;  3NS1 A;  5J8Y C;  3B0Y A;  3GQC A;  1RXW A;  2LYB A;  1PZN A;  4KLO A;  3RJJ A;  3IM1 A;  2YTU A;  4J9S A;  2XGQ A;  1F0M A;  3IN5 A;  4YXJ A;  4DO9 A;  2DKZ A;  2W9A A;  5KFK A;  8ICY A;  1SL2 A;  1TFR A;  2BQR A;  4O3R A;  4YN4 A;  9ICN A;  8ICJ A;  5AI4 A;  2ZIW B;  1ZQW A;  2ZJ8 A;  1Q3V A;  2VA8 A;  2NO5 A;  2BGW A;  2ZTD A;  1XC9 A;  2N1R A;  2ISP A;  8ICZ A;  5J8Y A;  3ZDD A;  1PVP A;  3FYH A;  1HJP A;  4FZN A;  5AIC A;  3HKZ F;  4QNL A;  4F5O A;  4US8 A;  5HNK A;  3WKB A;  1ZQC A;  3UMC A;  4RQ2 A;  2R8J A;  3TAD A;  4DSJ A;  8ICT A;  1Z1B A;  1NJZ A;  3HKZ C;  1KW4 A;  2AGO A;  1AQ6 A;  2FMP A;  2BDP A;  4EYH B;  1BPE A;  4F72 A;  3RJI A;  5KFG A;  1U4B A;  3RF9 A;  2BPF A;  2W9M A;  5D46 A;  4IQV A;  3KHH A;  2JR5 A;  4TUS A;  4WJ3 B;  4C8M A;  1ZQP A;  1D8B A;  3QU4 A;  3V7L A;  4K4G A;  1N5X A;  9ICE A;  3QNM A;  1X6I A;  4KLQ A;  2E8N A;  2ISO A;  4ELT A;  1DK2 A;  3SEN A;  3U26 A;  5ALW A; 
#chains in the Genus database with same CATH homology
 3IG8 A;  3M6K A;  3CYM A;  3H0L B;  2JH7 A;  2CPR A;  1T94 A;  3F2D A;  3L3F X;  2G5H B;  4AYB C;  3AL0 B;  4QIW C;  3PSP A;  2WAQ F;  2A3V A;  2F76 X;  1NZB A;  2PMZ F;  3OPX A;  2LHT A;  2WAQ C;  2Z7J A;  2ZIU B;  4AYB F;  4ICA A;  4P0Q A;  4P0P A;  3N7P D;  4OJP A;  4OJL A;  3PZP A;  2K4I A;  1WUD A;  2Q4T A;  1P7D A;  2HMX A;  2RHF A;  2K8C B;  3E0F A;  3SQI A;  3T79 A;  2VJ4 A;  3CRX A;  2KD1 A;  2H3Q A;  2LYB A;  3H0R B;  2JHD A;  3ONN A;  3D2S A;  2VIX A;  1URJ A;  4KMO B;  3K1Z A;  1YT3 A;  2K8B B;  3F2B A;  2D6F C;  3LVW A;  4NLC A;  1ED1 A;  1ECW A;  3D2N A;  3IN5 A;  4FZL A;  2KKV A;  1A6S A;  2JMG A;  2CRX A;  2W04 A;  5C0Y A;  2ZIV A;  2KOB A;  3NRW A;  3VC8 A;  3C29 A;  2VKQ A;  4CGZ A;  1A0P A;  2H3I A;  2LYA A;  2WB1 C;  1Q3U A;  5A0L A;  4NLB A;  3SAG A;  4U7C A;  2ZIV B;  3ALR A;  4FE3 A;  4CRX A;  2KIW A;  2WB1 F;  2HOQ A;  1PVR A;  2HOF A;  2XID A;  2ZIW B;  1XO0 A;  2KJ8 A;  2RP5 A;  2RRD A;  2W03 A;  1Q3V A;  4JMU A;  2HBM A;  3F53 A;  3H0M B;  4NWI A;  3LVV A;  2N1R A;  3AQF A;  3GZF A;  2YB4 A;  2KVC A;  2KV2 A;  4NV0 A;  4CDG A;  5HR6 A;  4IC9 A;  2ZIU A;  1PVP A;  4FZN A;  2LKY A;  1OUQ A;  2MRL A;  3HKZ F;  2Y0S C;  2VJ5 A;  2F77 X;  2MA1 A;  4QNL A;  4P0P B;  4OJ6 A;  3RFA A;  2KHQ A;  3CP8 A;  3SAF A;  1SZH A;  2OYY A;  4BJQ A;  2KJ9 A;  2E1F A;  2G09 A;  2KNJ A;  1Z19 A;  2NV3 A;  3M6Z A;  5KL1 B;  2JH1 A;  2H3Z A;  2XVT A;  1PVQ A;  4OJO A;  1Z1B A;  2ZIX B;  2ZXI A;  2HBK A;  2ZIW A;  1HEK A;  2YB1 A;  2KKP A;  1L6N A;  3HKZ C;  2KEY A;  4P0Q B;  2KHV A;  2XI9 A;  2BDU A;  3N7R C;  3KFU F;  4KX5 A;  5CRX A;  1MA7 A;  2OH2 A;  4C0Z A;  2E1E A;  2G07 A;  2KJ5 A;  2F2A B;  3DEE A;  2OM6 A;  2CN1 A;  3F5E A;  2JGA A;  3LYS A;  3MGV A;  2G5I B;  2ZIX A;  2KIC A;  2YX8 A;  3NUQ A;  2G0A A;  2ZG6 A;  2K89 A;  3ICX A;  3KZX A;  3RF9 A;  3PSI A;  2LBO A;  1GO3 F;  1UPH A;  3GU3 A;  3PSF A;  2GOL A;  4QJF B;  3M7D A;  4A8E A;  3SAH A;  4QIW F;  2HBJ A;  3N7S C;  3SMV A;  4ACO A;  2M0N A;  2G08 A;  2XIC A;  1XNS A;  2Y0S F;  4GFJ A;  2W7P A;  4OJ5 A;  4WJ3 B;  4KX3 A;  2W7O A;  2K8A A;  1D8B A;  1KBU A;  2DQN B;  2ZXH A;  2DF4 B;  1ZQ1 C;  2G06 A;  2H3F A;  3PST A;  4PL2 A;  3VCB A;  4OO1 J;  2E5S A;  4BUG A;  3C28 A;  1TAM A;  3IG5 A;  2GH1 A;  1F44 A;  4PL1 A;  1DRG A;  3O0F A;  2OXO A;  3F5A A;  2H3V A;  2K4E A;  2HOI A;  4O3M A;  2PMZ C;  3D2Q A;  1IIP A;  3F2C A;  5HR7 A;  2K4H A;  3AQE A;  4BX9 C;  5T14 A;  1HIW A;  2R18 A;  5KL8 B;  1CRX A;  4FZM A;  2F8L A;  3IP4 B;  2DGZ A;  2HBL A;  4U6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...