2JMGA

Solution structure of v7r mutant of hiv-1 myristoylated matrix protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
131
structure length
131
Chain Sequence
b'GARASRLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag polyprotein
publication title Point mutations in the HIV-1 matrix protein turn off the myristyl switch.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 33
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2006-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2jmgA01
2H3FA 4IC9A 4ICAA 2K4HA 1TAMA 2NV3A 2JMGA 1UPHA 2N1RA 2HMXA 2H3VA 2GOLA 2H3QA 1HEKA 2H3IA 2LYAA 4JMUA 2K4EA 2H3ZA 1ECWA 2LYBA 1ED1A 1HIWA 1L6NA 2K4IA 1A6SA
chains in the Genus database with same CATH superfamily
2HHXA 4MEYA 3AN1A 5CP2A 1D8BA 4ELTA 2YX8A 5KFXA 2PFQA 3ZDBA 5DBCA 1ZRNA 3SI8A 4F8RA 4PGYA 1A76A 3HPOA 4RT2A 4RQ4A 4P4PA 1KQQA 4KMOB 3QU7A 3TFSA 5KFVA 2E8MA 2UVVA 1X9XA 5ALXA 4F71A 1KKXA 4PZNA 1PUZA 1NK4A 4DL7A 1ZQMA 2W11A 1WUDA 1NZPA 4YN4A 2YMLA 4BUGA 3TANA 1NNLA 4C8MA 4KLSA 4KX3A 1FIQA 2BDPA 5L1IA 1KFDA 4UB3A 4YFKA 2I6XA 5AI5A 4UW9A 3TADC 1MN8A 3T79A 5JU5A 7ICKA 1Y88A 2C2EA 1D8YA 3RTVA 1Z3EB 3PMNA 5ALYA 7ICFA 3SYZA 3M6KA 1Z4NA 4JV1A 2JV3A 5J0YA 3NGDA 4ED1A 2OM6A 3SR6A 1Z00A 3UQ2A 3WKDA 2BZFA 3G6XA 4NLCA 4J9OA 4QZEA 2WTFA 2NRZA 1ZQZA 4F50A 3NVZA 9ICPA 5DB9A 8ICHA 4IR1A 3CRXA 3HKZC 3QU2A 1A77A 3TAPA 2I9GA 2XC9A 3A0HU 9ICNA 9ICQA 2HBMA 5ALSA 4R65A 4TQRA 4KLDA 4GIBA 4KLLA 4ECQA 2HBKA 2BR0A 4XUSA 1SGGA 4ELUA 2JZBB 3EWAA 2ASJA 4F5RA 5AI4A 4IQTA 3R9KA 2G5IB 1Z19A 5J2AA 3MGIA 4LJXA 2F8LA 2YMMA 3HWTA 4EBDA 4RQ0A 5KT3A 4UATA 5CRXA 3EPIA 8ICNA 4U7CA 4J9RA 5ALNA 5ALQA 5DQHA 4UAUA 3LK9A 2C2RA 2J6TA 3PR4A 4CNQA 4KTQA 2EDUA 4BXOB 4O5EA 5AM5A 3HX0A 4CF3A 4OJPA 4R64A 3V7LA 4TURA 1IV8A 8ICJA 3N7PD 5ALUA 2C2DA 9ICJA 1ED1A 2BCUA 5ALRA 1SWWA 2D8CA 3WK7A 2EQYA 3QZ8A 1UA0A 4YMMA 1TVAA 4PHAA 3N7RC 3WK8A 3AU2A 1N56A 1BGXT 2DUYA 1P7DA 1B43A 1OXJA 4C0ZA 2UVRA 1SKWA 5E79U 1ZQQA 2NO5A 2VA2A 2EAOA 4DCCA 4DQRA 3DV9A 1IXRA 1BPBA 5AIBA 4M9HA 4QIWC 1SV4A 1X9WA 4DQQA 2BCRA 2RHFA 4M47A 3JPQA 4QJFB 2XGQA 3C21A 3ETRA 3JPSA 3Q8KA 5AM2A 5DGBA 5AI0A 3KHRA 2KKVA 3VC8A 5AKJA 5KG5A 2VA8A 5DQIA 4GXKA 3NRWA 1ZQJA 2ZG6A 2AGOA 1SWVA 5AK6A 4NV0A 8ICLA 1COOA 3TQ1A 1BNOA 2F1JA 1S76D 1TAMA 4EELA 3BZKA 3GQCA 1N2XA 4UB6U 1XC9A 1TKDA 3GV8B 2IA6A 1T7PA 7ICOA 3RRHA 4Y2PA 3MDAA 2BHNA 2B21A 3QUTA 4B9NA 2NRXA 3H40A 1UQVA 4KLJA 4JV2A 1S8OA 2FMQA 5J2CA 4XRHA 2GO7A 1KEJA 2R8JA 3SV4A 5ALIA 4EENA 7ICRA 1ZD4A 4F4YA 2YTUA 1V9PA 2GH1A 2RLTA 4F4WA 5JUMA 2EZXA 4A8EA 3RR8A 3IG8A 3B0YA 3NS1A 2F76X 4BX9C 2W54A 1PVRA 3IG5A 3OHAA 4C8KA 2K4HA 2ZIUB 2G08A 5IIOA 5J2KA 1S5LU 1UT8A 4DL4A 5HNKA 5G5GA 5KT2A 3PX6A 3B0XA 5ALGA 4O3OA 4P0QA 3H8SA 4Y2XA 4KITB 5KG2A 3ISCA 5AKKA 3H4DA 4IR9A 3OSNA 4KLEA 8ICOA 5J0QA 4TUQA 3RRGA 1T4GA 4E0DA 4Z6CA 5DB6A 4YXMA 2PI5A 2FI1A 1RXWA 4QZ9A 3QUQA 1YT3A 2VJ5A 1BPDA 2W8LA 2W9CB 2HHQA 1BVSA 5KT7A 4M9LA 2LYHA 2KIWA 1ZQRA 4F93B 7ICPA 4C4TA 1HJPA 3TI0A 2BCQA 2N1RA 2HI0A 4GC6A 3RJFA 4NLNA 1VJ5A 3GV7B 4DO9A 3UXOA 1ZQ1C 1K1QA 2KHQA 4B9MA 5ALOA 3WK6A 4DEZA 3N4MB 1NK7A 4PGXA 4C8LA 4QWEA 1KRPA 2KJ9A 4KLOA 4QZAA 4ED2A 7ICTA 5DG7A 1NJYA 1L3VA 3IRUA 2YMQA 4C80A 2M9NA 2VIXA 4QZIA 2YQEA 2KZMA 1COKA 4US8A 9ICBA 2F1HA 4YR0A 2DPJA 4FS1A 3GV5B 4UAVA 1DXSA 3TARA 4O5KA 2IBKA 1M6YA 3AQFA 1X2IA 2HVHA 3WK9A 2QB1A 4O0IA 5KFYA 4B9SA 1ZQYA 4DF8A 3QNMA 3CP8A 2IMWP 2KSOA 2R8IA 4ECWA 1ZD3A 1D9DA 3Q8RB 2Y1JA 4DSEA 4EEKA 3RJEA 5AI6A 2JH1A 4ED8A 1N5WA 3SD7A 5B66U 5J0SA 2KIVA 4J9MA 1BPZA 3CNHA 2HVIA 4ECYA 3M9OB 2OHFA 1RQNA 3PW7A 3E58A 2XVTA 3PSPA 2XICA 2KJ5A 4M6WB 2E3TA 3M6ZA 4Z6FA 2IOFK 3HJEA 4NM2A 3HKZF 1ZQDA 1Z00B 1Z4OA 2CN1A 4ECZA 1KDHA 3H0MB 1ZQBA 4P0PA 2PMZF 5KFHA 3C5FA 4NXZA 4ECVA 3ZDCA 3QU5A 3UMBA 1WWUA 5DKWA 4I2HA 7ICHA 2BQUA 4IRCA 1L8LA 3PV8A 3FM9A 9ICAA 4TUSA 1CEZA 1NKCA 5C0YA 4C4SA 9ICVA 2KE7A 5ALLA 1B22A 2ESEA 5KFDA 5TISU 4QZFA 3Q8MA 2J6UA 2ISOA 4UAWA 2Y0SF 2VJ4A 3M8RA 5D4BA 5KFWA 3HW8A 4X5VA 5AKZA 4C7YA 3RJJA 1MSWD 3HRDD 3AM9A 2KOBA 2F77X 2P35A 3UM9A 4ECSA 2W9BA 5KNIA 4J03A 3BS5A 3JPRA 2LHTA 2RDIA 4FZNA 5AKYA 3ISBA 5AM4A 3MBYA 1X6JA 1D9FA 4FS2A 1PK3A 4KLFA 2H5XA 4DS5A 4ED7A 2AXTU 5KFCA 5KG4A 4DOBA 3PMLA 5F3XB 2DGZA 4KMUA 3C1ZA 2KG5A 1URJA 5DG8A 4IRDA 4RQ3A 2W3SA 2JH7A 1ZQXA 2KFZA 2A19A 1S0NA 4CF5A 1ZOLA 4EX6A 3MR6A 3ONNA 7ICLA 3FAHA 5K4LA 2ZTEA 3IN5A 8ICEA 4UB2A 4I2AA 4EZ9A 3ISDA 1J2NA 1Z1VA 3OJUA 2WF5A 1X9SA 4AYBF 5KFMA 5J8YA 2FJ6A 8ICFA 5H2FU 3T5KA 3KTQA 4G3IA 1WG8A 4QNLA 4YD1A 8ICZA 1TFRA 4Y2TA 2F44A 2PFOA 1SL1A 7ICVA 2QB0A 3GFKB 3QU9A 8ICCA 5CB1A 4JMUA 2W9AA 1ZXIA 3T5LA 2MA1A 4RT3A 4NL9A 5HHIA 5AK3A 2E5SA 4IC9A 1C20A 2LPEA 4Y2UA 1T3NA 4F92B 2PXIA 1N48A 1U45A 4OJ6A 5AM0A 1T8EA 2BCSA 5AKGA 5KT5A 2HDOA 4TUPA 2LKYA 3EW9A 5AI9A 3I1YA 4KLGA 4XQ8A 2KNJA 2ASDA 4DOCA 5J2GA 2A1JA 1Q46A 1XU4A 5G5HA 4UB8U 4R8UB 2WF7A 5KFTA 5IILA 2C28A 1BNPA 4B9UA 2ZUCA 3T5HA 3EUB2 2NO4A 4DL2A 4CDGA 4Y2YA 2OH2A 2HOQA 4M9GA 4QZ8A 2D6FC 3T3FA 1XSPA 2XCAA 1KN5A 2JXJA 4NJ8A 2A1AA 5F9LA 5BOMA 4O9MA 3MR2A 3LVVA 2HBLA 1ZQHA 4RZRA 4TQSA 1FO4A 5F9NA 2JEIA 5JTIA 1TK5A 2PMZC 3NVYA 1DGSA 4FE3A 8ICIA 3KBBA 2QARA 3WKEA 3J81j 7ICEA 3KFUF 4IL6U 2I5HA 1S0MA 2JEGA 3ZD8A 3MGHA 4DQSA 3BQ0A 2XO7A 2K4PA 3KD3A 1XSNA 2JEFA 1O03A 1UA1A 2IOHA 2KP7A 3L4PA 4KLQA 2JRZA 5AKEA 3PSFA 2Y0SC 4Y2QA 1ZQAA 1X9MA 4MFAA 3GZFA 3SMVA 1D8LA 3ETLA 1U48A 3RB4A 5AIAA 4YQWA 5HR7A 1JRPA 4RQ5A 2WF9A 3TADA 2ALZA 3D2QA 2F3NA 3QZ7A 5L1MA 4RQ2A 2NRVA 1L7NA 3IV6A 2I1QA 8ICQA 1HIWA 8ICSA 1ZQWA 3MFIA 1ZQLA 1RG6A 1RXVA 4RPYA 3HP6A 5DLFA 4OO1J 5J2JA 9ICRA 3T5JA 5L1JA 3CYMA 1VLBA 4C8NA 2HOIA 4GC7A 2W55A 2ZIWA 2K60A 4Q43A 4F4KA 4HAIA 2LBOA 3PR5B 2DKZA 4M04A 9ICCA 3ZDDA 4QWAA 3SENA 2W8KA 1QSSA 2W43A 2FLPA 2AU0A 4YCXA 4UB4A 2W3RA 1NI3A 4J9LA 4ZOHC 1N5XA 2ZJ8A 3IHQB 3SAFA 2HCFA 3OPXA 4RNOA 1J2MA 1U4BA 4AYBC 1OW5A 3MC1A 1N60A 2RQ5A 4LZDA 4I2IA 1ZQOA 3SZ2A 3N7SC 2W03A 1S97A 3C28A 4F91B 3MR5A 2MAXA 1PK1A 4ED0A 5EE3A 2HHVA 3M7DA 8ICVA 3M8SA 1RYRA 3PW5A 2OWOA 4JUZA 2XY6A 2E8NA 2A3VA 3UXNA 5J0OA 4OJLA 3BJYA 1CRXA 2C22A 4ELVA 2WAQF 5D46A 2RDJA 4B9LA 1X66A 3F5EA 1NOMA 4J9QA 1Q8KA 5DB8A 5KFOA 1TK0A 1KTQA 2G5HB 5J0WA 4NWIA 1S0OA 2ZIVB 5KFPA 4M0AA 7ICIA 1QCKA 4WJ3B 4P0PB 9ICUA 4DLGA 4UASA 3F2CA 4ECUA 5DLGA 1A0PA 4RQNA 2KFNA 1L7MA 7ICMA 3L3FX 5KFGA 5IINA 4O3MA 4FZLA 4LZGA 2XGPA 3E0FA 5CHGA 4RU9A 2ZTDA 3PW0A 4DQIA 5CR0A 1LKYB 4QZDA 4Q8EA 4DFJA 5EWFA 4YP3A 4ED3A 2F2AB 2J6SA 2ZTCA 4RQ6A 5T14A 4P4MA 4KN7A 2DBYA 4RQMA 1IG6A 2AHOB 3H7IA 2KZZA 1ZQPA 1U9LA 1DK2A 3IM1A 4F5QA 5J2IA 3M1YA 4Y2JA 1ECWA 1KW4A 8ICPA 3JPPA 2ZJ5A 2XI9A 2GLEA 3QXGA 2E1EA 9ICSA 3LDAA 5KFLA 3THVA 1QQ5A 1V97A 3C2MA 4B9VA 2MSNA 4YMNA 5J2DA 4DL5A 4FBTA 5IIKA 3EPGA 4UAYA 1JN3A 1NZBA 3AMZA 2NRWA 4QZGA 1N62A 3KKAC 2M0NA 4GFJA 4BXOA 1DGJA 1LVHA 4JV0A 3RH6A 1SKRA 3F2DA 4I27A 5ALWA 5KG6A 3GIJA 3C2LA 1ZQNA 4R66A 4O3SA 2FLNA 2K4IA 1TAUA 3ZD9A 8ICGA 4RUCA 4DS4A 3QEBZ 1ZQUA 5HMLA 2WB1F 4US9A 2V4RA 3RBDA 3MDCA 2ZIXA 1UT5A 1TK8A 1MQ3A 1NK8A 2OYYA 3QEAZ 2EANA 4DLEA 5KG1A 4DSJA 1H38A 5JRTA 2HSZA 2E1FA 3HT3A 4R63A 3PW4A 5ALJA 3MFHA 1T94A 3SAHA 2VKQA 3RH4A 1UPHA 5ALDA 5GTIU 5J2EA 4F2RA 5AK5A 3PZPA 1U47A 1JALA 1F0MA 1K1SA 4B6JA 4Q44A 1OUQA 3ORYA 1BPEA 4DFMA 1L5UA 4BJQA 2WF6A 2LI6A 4DWIA 9ICGA 2K8CB 4UARA 2YB1A 1UCVA 4OJ5A 7ICSA 1ZQFA 5EE9A 3FYHA 2XIDA 2IHMA 4FO6A 4UBBA 3AU6A 4OJOA 4J9PA 8ICYA 2WAQC 1N61A 5AM3A 2BPCA 1SV0C 3UXPA 8ICTA 1KBUA 4K4HA 3Q8QB 1QQ7A 1ZETA 4MFFA 3RB0A 1F5SA 1SXEA 3F2BA 3JPOA 2NRTA 4QZHA 2DQNB 3NUQA 5L1KA 1NKEA 4JWNA 1XWLA 3RJHA 1L7PA 3RJKA 1YZ7A 3Q8PB 3K4GA 1ZYQA 2Z7JA 1ZQIA 3ZDEA 3PO4A 4UBCA 1NJXA 2OXOA 2K89A 4NLBA 4NLGA 4RNNA 1HUOA 2UVWA 4I2GA 3UMGA 3TACB 3RAQA 1S0VA 4DQPA 4I2DA 5J2BA 4ED6A 4DFKA 1WWVA 1LB2B 5KFJA 4DFDA 4EEYA 4C7ZA 2HBJA 4ECTA 8ICRA 3SV3A 2BPGA 3LYSA 4F2SA 1ZQKA 2HMXA 7ICUA 5ALVA 1MA7A 5AKLA 1QLNA 4BWJA 1RPLA 4I28A 9ICTA 3PX0A 5KAFU 3OJSA 2W9CA 2JEJA 3BDPA 3I28A 5AKXA 5J0RA 4FZMA 4KLMA 5EWEA 9ICIA 2G06A 9ICOA 4RPZA 3MABA 3TFRA 4QWDA 5J2FA 2E8OA 4DF4A 1QH9A 9ICHA 3O0FA 5B5EU 3ALRA 5J29A 3RR7A 4EX7A 1JIHA 3PW2A 3H0LB 2AQ4A 1TE2A 5AICA 2FPMA 3N28A 2FMPA 1SB3C 3V7JA 2NV3A 5EE1A 1AROP 4O3RA 2PKEA 2LM1A 2G0AA 2Y9UA 4JWMA 8ICBA 3IDWA 3WU2U 4DSIA 2KTQA 1DOQA 2AH5A 2L5YA 3WKCA 5KFRA 3F53A 5CEHA 1B0XA 4K4IA 3C23A 2WB1C 3KZXA 1PK1B 1L3TA 3C1YA 1LV5A 2H3QA 1XNSA 5TZVA 4CF4A 3RFAA 4Z6EA 4BDPA 4I2BA 8ICMA 4MF8A 4F4XA 1V38A 1NK9A 2MRLA 2RRDA 2HHWA 4PL2A 3TKAA 3MR3A 4QWCA 3LWMA 1RZTA 4ECXA 2OCEA 5BOLA 2DF4B 2QLTA 2R8KA 3OSPA 3NTUA 3AUOA 1IM4A 5KG7A 4B9TA 1C7YA 2BCVA 4OCZA 3M9MB 4KX5A 3D2NA 4IQVA 1ZQTA 5AKHA 2PFNA 3PX4A 3Q8LA 4M6WA 4CE6A 4EYIB 2KN7A 4C8OA 4PHEA 3JPTA 1S77D 3RH5A 3PNCA 1BPYA 4YD2A 4Z6DA 2W7OA 1IIPA 3CW2C 1KLNA 3UQ0A 4K4GA 3GILA 4C4RA 2B6GA 1CUKA 4KLUA 4P0QB 1YZ6A 5BPCA 3PSIA 1RYSA 4FFDA 4BWMA 5EOZA 1NJWA 1U49A 3AQEA 3RAXA 1SIJA 2K4EA 4FBUA 2R18A 1JI7A 3WK5A 3GIMA 5CJ7A 2PI4A 1A6SA 5HHHA 2XCPA 5KT4A 2XY7A 4PJ0U 2R8HA 1X6IA 4I2CA 4MF2A 3FDSA 5DBAA 4DFPA 1QSLA 3NVVA 3QU4A 3H4BA 4NLKA 3K1RB 4PHPA 5KFUA 4PZOA 5ALFA 7ICNA 3BQ2A 2ZXHA 1L8OA 2YB4A 3BQTA 2Y9TA 4YVZA 4PPXA 5C5JA 1NJZA 3QUCA 2LYBA 5KG3A 3D6JA 1NK0A 8ICUA 1RQLA 4U6PA 4PH5A 1Q3VA 2VANA 2ZUBA 2ISPA 4Q45A 4M9NA 2FPKA 2JHDA 5J0UA 4F5NA 2MUTA 1L3UA 3GIIA 4NM1A 2P6RA 1XS9D 3V6HA 4DOAA 3GDXA 2DKXA 5J2HA 5L9XA 1SZPA 4O3NA 3BZCA 4RQ8A 5DDMA 4Y2VA 5DQGA 2ODGA 5EWGA 2VA3A 5J0XA 2XY5A 4JK1A 5KT6A 2P66A 2CXYA 4M2YA 4KLHA 5AM1A 2ZIXB 2BDUA 3LWLA 2HOFA 1L3SA 2KD1A 1JX4A 9ICMA 9ICXA 3WKBA 1CI4A 8ICKA 3HILA 1TV9A 5ALTA 5AK4A 4F5PA 5HR6A 1WYGA 4UAZA 5DDYA 5KFIA 2AJQA 5IIIA 2OEHA 2KSOB 4O5CA 3L5KA 1JXLA 1SL0A 4F72A 8ICWA 4XA5A 4O3PA 4NY8A 3KHLA 1DK3A 1SZHA 1S10A 1GO3F 2HHSA 2G09A 1RM6C 2UVUA 3WK4A 3WKAA 1DRGA 4F4ZA 3H8MA 3OGUA 3H8WA 3PY8A 2JMGA 4NLZA 4I29A 3RB3A 2HHTA 1J97A 3EZ5A 3D2SA 3NVWA 5KFZA 4F3OA 3RF9A 1S9FA 2ZUDA 2Q4TA 1X40A 3QYPA 5KFEA 2KVSA 1KSPA 4QW9A 4YR2A 1FEZA 4QW8A 1NKBA 4RUAA 4G9BA 2F1IA 4CCHA 2WFAA 3C2KA 3LVWA 4R8UA 2AQ0A 2GOLA 5D49A 2Q0ZX 1NK6A 3F5AA 2YMPA 4UB1A 4PGQA 3RBEA 5KG0A 3RJIA 4RNMA 4IRKA 1EXNA 3QE9Y 5ALHA 1L7OA 3C29A 5KFKA 1TAQA 3V72A 2GWSA 2F8KA 2V9WA 1AQ6A 2ZJAA 2QKQA 4USAA 3KOOA 1O08A 1WCNA 2KK0A 2W9BB 4Y2SA 9ICLA 3BS5B 5DG9A 3ZDAA 2DFLA 5HP4A 7ICGA 3UPQA 1N63A 1ZQEA 2ASLA 2KKPA 5ALEA 2JZBA 5ALZA 3G6VA 2WF8A 2BQRA 2KMDA 5AI8A 2EAPA 4RQ1A 3AL0B 4KN4A 1HEKA 4DL3A 2HW3A 2KV2A 4YG2A 2DWQA 2YY6A 3PVXA 4ACOA 3G6YA 4IS7A 3Q8SB 5A0LA 2JR5A 2PFPA 2BKEA 5J0PA 5GTHU 3BS7A 2AGQA 1BPXA 4GLXA 2KJ8A 1ZJMA 5EE0A 1PZNA 2W9MA 5KFFA 4RQ7A 2CRXA 2ZXIA 3V6KA 3N97B 5AHXA 4ZH4A 3ED5A 2JGAA 1KFTA 1KFSA 5KL1B 2FPLA 4I2FA 2W7PA 1Z1BA 4GXIA 1JMSA 4Y2RA 2EH9A 3GU3A 2H3VA 4J9NA 3I76A 2QB0B 5DB7A 2DPIA 3RJGA 3BQ1A 1QTMA 4MFCA 3JPNA 2RP5A 3NRZA 3GIKA 2KHVA 1ZJNA 5KFAA 9ICKA 3MGVA 2IOFA 2CPRA 4CGZA 1JUDA 4O3QA 3S6JA 1JROA 3B9JA 2K8BB 5CA7A 1ZRMA 3KHHA 5J0TA 4EBCA 3UMCA 5ALMA 2R8GA 5KAIU 1RYUA 2KEYA 5L1LA 4Q8FA 1ZQCA 3SAGA 2H3ZA 4P2HA 5DBBA 2ES6A 3H0RB 4UQGA 1ZQGA 1L6NA 5KFQA 5CWRA 4QZBA 4IQWA 4ICAA 3SQIA 4LVSA 2A1JB 5HMMA 4M9JA 8ICXA 4EYHB 1XO1A 3PSTA 4J9SA 3A0BU 3KKAA 4DL6A 2FLLA 1QQ6A 1MQ2A 1XO0A 3BQ7A 5KFBA 9ICWA 2IHNA 3OHBA 1X42A 3AEVA 5ALKA 2Y1IA 2KZ3A 4HYKA 4I2JA 2FDRA 3V6JA 3ZI4A 4I2EA 3FC4A 3H8JA 2ZIVA 3C5GA 2AGPA 1VDVA 3M9NB 2QARB 4MEXA 3QX7A 4PHDA 5ALPA 5FP0A 3VCBA 2FE9A 1Q3UA 3V7KA 2BGWA 1KL9A 4J9KA 1F44A 1UHUA 2ATLA 5KTQA 1XSLA 2ZIUA 2LM4A 1ZQVA 2G07A 2DL0A 5KFSA 3DDHA 1FFVA 1ZD5A 5J8YC 4YMOA 1HUZA 2LMRA 2EAMA 7ICQA 3OTQA 3KHGA 1K5OA 4YXJA 4DSFA 4CRXA 1LKYA 4DSLA 2H3FA 1ZQSA 1PVPA 4BGDA 3RB6A 1NK5A 2EZYA 4PL1A 3K75D 4NL9C 2V4QA 4UB5A 3U26A 4GXJA 5AKIA 5DGAA 2BQ3A 1SXDA 3NASA 4OD0A 1FFUA 5KL8B 1SL2A 2B0CA 2EZZA 1MC8A 3PO5A 3E2EA 4EZ6A 2NYVA 3TAQA 7ICJA 4F5OA 3DEEA 1SV0A 2MUTB 1ZD2P 1SKSA 1PVQA 2WHEA 4IQUA 4MHVA 3IP4B 1B4FA 5KFNA 4KLTA 2K8AA 5IIJA 4RPXA 2MU2A 2ZIWB 3EYZA 3KZIU 1RDFA 2O6KA 4EBEA 1QSYA 3QUBA 4QZCA 5IIMA 2P6UA 2YN4A 4KLIA 9ICFA 2KICA 4QIWF 2D3DA 8ICAA 1T3QA 9ICEA 2BPFA 3K1ZA 4P4OA 4ECRA 2FMSA 4AP9A 4QWBA 2HHUA 2H3IA 2LYAA 2KVCA 4YR3A 3SEIA 1JXEA 4DSKA 2W04A 3ICXA 1V85A 1WCLA 4JB3A 2E8PA
chains in the Genus database with same CATH topology
2E1FA 2HOQA 2JGAA 2D6FC 3VCBA 1Q3VA 2RRDA 1Q3UA 2JHDA 4PL2A 5KL1B 4NV0A 1D8BA 2YX8A 1T94A 2G5IB 2F2AB 2HBJA 3SAHA 1F44A 2VKQA 3PSPA 2XVTA 3LVVA 5T14A 2HBLA 3ONNA 2W7PA 1TAMA 1Z19A 2XICA 1Z1BA 2KJ5A 2ZIUA 3LYSA 1UPHA 3LVWA 2N1RA 3M6ZA 3GU3A 2DF4B 2F8LA 2H3VA 2HMXA 2GOLA 3SAFA 2G07A 3HKZF 3F5AA 3OPXA 3IN5A 1MA7A 3PZPA 2PMZC 4KMOB 4AYBC 2CN1A 5CRXA 1ECWA 1OUQA 1ZQ1C 4FE3A 3H0MB 4U7CA 4P0PA 2PMZF 2RP5A 4CRXA 4AYBF 3KFUF 4FZMA 2KHQA 2KHVA 2XI9A 4KX5A 2H3FA 3D2NA 4BJQA 3MGVA 3C29A 2G06A 3N7SC 1PVPA 2W03A 2CPRA 2E1EA 3C28A 4CGZA 2K8CB 4U6PA 4OJPA 2YB1A 4PL1A 4OJ5A 1WUDA 4QNLA 2K8BB 5C0YA 4BUGA 2ZIXB 3M7DA 2KJ9A 2GH1A 2XIDA 4KX3A 2BDUA 2HOFA 4OJOA 3PSFA 2KEYA 2Y0SC 3O0FA 4JMUA 3N7PD 3SAGA 2MA1A 2H3ZA 2KD1A 2WAQC 3ALRA 4A8EA 2A3VA 5KL8B 1ED1A 2W7OA 1IIPA 3H0RB 3GZFA 2Y0SF 4OJLA 1CRXA 2VJ4A 1KBUA 3H0LB 3SMVA 1NZBA 3IG8A 3T79A 1L6NA 2WAQF 2KKPA 2F76X 2E5SA 4IC9A 4ICAA 3SQIA 4BX9C 4P0QB 2VIXA 5HR6A 1PVRA 3IG5A 5HR7A 2M0NA 3PSIA 3F5EA 4GFJA 3DEEA 3F2BA 2K4HA 1PVQA 2ZIUB 2DQNB 2G08A 2NV3A 3NUQA 2G5HB 3N7RC 4OJ6A 3D2QA 3M6KA 4NWIA 1P7DA 3IP4B 3PSTA 3AL0B 1HEKA 2K8AA 2KOBA 2OM6A 2KV2A 3AQEA 4C0ZA 2F77X 2G0AA 2ZIVB 2ZIWB 3F2DA 4WJ3B 2K4EA 4ACOA 4NLCA 1XO0A 2R18A 1SZHA 2LHTA 4P0PB 2Z7JA 1GO3F 1HIWA 4FZNA 2LKYA 3AQFA 4QIWC 5A0LA 2G09A 2K4IA 1A6SA 3F2CA 2RHFA 3F53A 1A0PA 4P0QA 2KNJA 2OXOA 1DRGA 3CRXA 2KICA 4QIWF 2K89A 4OO1J 4NLBA 4QJFB 2WB1C 3HKZC 3KZXA 3CP8A 3L3FX 3K1ZA 2JMGA 4O3MA 2KJ8A 3CYMA 2HBMA 2H3QA 2WB1F 1XNSA 2H3IA 2KKVA 2LYAA 2ZIXA 2ZXHA 4FZLA 2KVCA 2HOIA 3RF9A 2ZIVA 2DGZA 3RFAA 3D2SA 1YT3A 2Q4TA 2YB4A 2OYYA 3E0FA 2ZIWA 1URJA 2VJ5A 3VC8A 2CRXA 2ZXIA 2JH1A 2LYBA 2W04A 3ICXA 4CDGA 3NRWA 2LBOA 2JH7A 2OH2A 2HBKA 2ZG6A 2MRLA 2KIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3F A;  4IC9 A;  4ICA A;  2K4H A;  1TAM A;  2NV3 A;  2JMG A;  1UPH A;  2N1R A;  2HMX A;  2H3V A;  2GOL A;  2H3Q A;  1HEK A;  2H3I A;  2LYA A;  4JMU A;  2K4E A;  2H3Z A;  1ECW A;  2LYB A;  1ED1 A;  1HIW A;  1L6N A;  2K4I A;  1A6S A; 
#chains in the Genus database with same CATH topology
 2HHX A;  4MEY A;  3AN1 A;  5CP2 A;  1D8B A;  4ELT A;  2YX8 A;  5KFX A;  2PFQ A;  3ZDB A;  5DBC A;  1ZRN A;  3SI8 A;  4F8R A;  4PGY A;  1A76 A;  3HPO A;  4RT2 A;  4RQ4 A;  4P4P A;  1KQQ A;  4KMO B;  3QU7 A;  3TFS A;  5KFV A;  2E8M A;  2UVV A;  1X9X A;  5ALX A;  4F71 A;  1KKX A;  4PZN A;  1PUZ A;  1NK4 A;  4DL7 A;  1ZQM A;  2W11 A;  1WUD A;  1NZP A;  4YN4 A;  2YML A;  4BUG A;  3TAN A;  1NNL A;  4C8M A;  4KLS A;  4KX3 A;  1FIQ A;  2BDP A;  5L1I A;  1KFD A;  4UB3 A;  4YFK A;  2I6X A;  5AI5 A;  4UW9 A;  3TAD C;  1MN8 A;  3T79 A;  5JU5 A;  7ICK A;  1Y88 A;  2C2E A;  1D8Y A;  3RTV A;  1Z3E B;  3PMN A;  5ALY A;  7ICF A;  3SYZ A;  3M6K A;  1Z4N A;  4JV1 A;  2JV3 A;  5J0Y A;  3NGD A;  4ED1 A;  2OM6 A;  3SR6 A;  1Z00 A;  3UQ2 A;  3WKD A;  2BZF A;  3G6X A;  4NLC A;  4J9O A;  4QZE A;  2WTF A;  2NRZ A;  1ZQZ A;  4F50 A;  3NVZ A;  9ICP A;  5DB9 A;  8ICH A;  4IR1 A;  3CRX A;  3HKZ C;  3QU2 A;  1A77 A;  3TAP A;  2I9G A;  2XC9 A;  3A0H U;  9ICN A;  9ICQ A;  2HBM A;  5ALS A;  4R65 A;  4TQR A;  4KLD A;  4GIB A;  4KLL A;  4ECQ A;  2HBK A;  2BR0 A;  4XUS A;  1SGG A;  4ELU A;  2JZB B;  3EWA A;  2ASJ A;  4F5R A;  5AI4 A;  4IQT A;  3R9K A;  2G5I B;  1Z19 A;  5J2A A;  3MGI A;  4LJX A;  2F8L A;  2YMM A;  3HWT A;  4EBD A;  4RQ0 A;  5KT3 A;  4UAT A;  5CRX A;  3EPI A;  8ICN A;  4U7C A;  4J9R A;  5ALN A;  5ALQ A;  5DQH A;  4UAU A;  3LK9 A;  2C2R A;  2J6T A;  3PR4 A;  4CNQ A;  4KTQ A;  2EDU A;  4BXO B;  4O5E A;  5AM5 A;  3HX0 A;  4CF3 A;  4OJP A;  4R64 A;  3V7L A;  4TUR A;  1IV8 A;  8ICJ A;  3N7P D;  5ALU A;  2C2D A;  9ICJ A;  1ED1 A;  2BCU A;  5ALR A;  1SWW A;  2D8C A;  3WK7 A;  2EQY A;  3QZ8 A;  1UA0 A;  4YMM A;  1TVA A;  4PHA A;  3N7R C;  3WK8 A;  3AU2 A;  1N56 A;  1BGX T;  2DUY A;  1P7D A;  1B43 A;  1OXJ A;  4C0Z A;  2UVR A;  1SKW A;  5E79 U;  1ZQQ A;  2NO5 A;  2VA2 A;  2EAO A;  4DCC A;  4DQR A;  3DV9 A;  1IXR A;  1BPB A;  5AIB A;  4M9H A;  4QIW C;  1SV4 A;  1X9W A;  4DQQ A;  2BCR A;  2RHF A;  4M47 A;  3JPQ A;  4QJF B;  2XGQ A;  3C21 A;  3ETR A;  3JPS A;  3Q8K A;  5AM2 A;  5DGB A;  5AI0 A;  3KHR A;  2KKV A;  3VC8 A;  5AKJ A;  5KG5 A;  2VA8 A;  5DQI A;  4GXK A;  3NRW A;  1ZQJ A;  2ZG6 A;  2AGO A;  1SWV A;  5AK6 A;  4NV0 A;  8ICL A;  1COO A;  3TQ1 A;  1BNO A;  2F1J A;  1S76 D;  1TAM A;  4EEL A;  3BZK A;  3GQC A;  1N2X A;  4UB6 U;  1XC9 A;  1TKD A;  3GV8 B;  2IA6 A;  1T7P A;  7ICO A;  3RRH A;  4Y2P A;  3MDA A;  2BHN A;  2B21 A;  3QUT A;  4B9N A;  2NRX A;  3H40 A;  1UQV A;  4KLJ A;  4JV2 A;  1S8O A;  2FMQ A;  5J2C A;  4XRH A;  2GO7 A;  1KEJ A;  2R8J A;  3SV4 A;  5ALI A;  4EEN A;  7ICR A;  1ZD4 A;  4F4Y A;  2YTU A;  1V9P A;  2GH1 A;  2RLT A;  4F4W A;  5JUM A;  2EZX A;  4A8E A;  3RR8 A;  3IG8 A;  3B0Y A;  3NS1 A;  2F76 X;  4BX9 C;  2W54 A;  1PVR A;  3IG5 A;  3OHA A;  4C8K A;  2K4H A;  2ZIU B;  2G08 A;  5IIO A;  5J2K A;  1S5L U;  1UT8 A;  4DL4 A;  5HNK A;  5G5G A;  5KT2 A;  3PX6 A;  3B0X A;  5ALG A;  4O3O A;  4P0Q A;  3H8S A;  4Y2X A;  4KIT B;  5KG2 A;  3ISC A;  5AKK A;  3H4D A;  4IR9 A;  3OSN A;  4KLE A;  8ICO A;  5J0Q A;  4TUQ A;  3RRG A;  1T4G A;  4E0D A;  4Z6C A;  5DB6 A;  4YXM A;  2PI5 A;  2FI1 A;  1RXW A;  4QZ9 A;  3QUQ A;  1YT3 A;  2VJ5 A;  1BPD A;  2W8L A;  2W9C B;  2HHQ A;  1BVS A;  5KT7 A;  4M9L A;  2LYH A;  2KIW A;  1ZQR A;  4F93 B;  7ICP A;  4C4T A;  1HJP A;  3TI0 A;  2BCQ A;  2N1R A;  2HI0 A;  4GC6 A;  3RJF A;  4NLN A;  1VJ5 A;  3GV7 B;  4DO9 A;  3UXO A;  1ZQ1 C;  1K1Q A;  2KHQ A;  4B9M A;  5ALO A;  3WK6 A;  4DEZ A;  3N4M B;  1NK7 A;  4PGX A;  4C8L A;  4QWE A;  1KRP A;  2KJ9 A;  4KLO A;  4QZA A;  4ED2 A;  7ICT A;  5DG7 A;  1NJY A;  1L3V A;  3IRU A;  2YMQ A;  4C80 A;  2M9N A;  2VIX A;  4QZI A;  2YQE A;  2KZM A;  1COK A;  4US8 A;  9ICB A;  2F1H A;  4YR0 A;  2DPJ A;  4FS1 A;  3GV5 B;  4UAV A;  1DXS A;  3TAR A;  4O5K A;  2IBK A;  1M6Y A;  3AQF A;  1X2I A;  2HVH A;  3WK9 A;  2QB1 A;  4O0I A;  5KFY A;  4B9S A;  1ZQY A;  4DF8 A;  3QNM A;  3CP8 A;  2IMW P;  2KSO A;  2R8I A;  4ECW A;  1ZD3 A;  1D9D A;  3Q8R B;  2Y1J A;  4DSE A;  4EEK A;  3RJE A;  5AI6 A;  2JH1 A;  4ED8 A;  1N5W A;  3SD7 A;  5B66 U;  5J0S A;  2KIV A;  4J9M A;  1BPZ A;  3CNH A;  2HVI A;  4ECY A;  3M9O B;  2OHF A;  1RQN A;  3PW7 A;  3E58 A;  2XVT A;  3PSP A;  2XIC A;  2KJ5 A;  4M6W B;  2E3T A;  3M6Z A;  4Z6F A;  2IOF K;  3HJE A;  4NM2 A;  3HKZ F;  1ZQD A;  1Z00 B;  1Z4O A;  2CN1 A;  4ECZ A;  1KDH A;  3H0M B;  1ZQB A;  4P0P A;  2PMZ F;  5KFH A;  3C5F A;  4NXZ A;  4ECV A;  3ZDC A;  3QU5 A;  3UMB A;  1WWU A;  5DKW A;  4I2H A;  7ICH A;  2BQU A;  4IRC A;  1L8L A;  3PV8 A;  3FM9 A;  9ICA A;  4TUS A;  1CEZ A;  1NKC A;  5C0Y A;  4C4S A;  9ICV A;  2KE7 A;  5ALL A;  1B22 A;  2ESE A;  5KFD A;  5TIS U;  4QZF A;  3Q8M A;  2J6U A;  2ISO A;  4UAW A;  2Y0S F;  2VJ4 A;  3M8R A;  5D4B A;  5KFW A;  3HW8 A;  4X5V A;  5AKZ A;  4C7Y A;  3RJJ A;  1MSW D;  3HRD D;  3AM9 A;  2KOB A;  2F77 X;  2P35 A;  3UM9 A;  4ECS A;  2W9B A;  5KNI A;  4J03 A;  3BS5 A;  3JPR A;  2LHT A;  2RDI A;  4FZN A;  5AKY A;  3ISB A;  5AM4 A;  3MBY A;  1X6J A;  1D9F A;  4FS2 A;  1PK3 A;  4KLF A;  2H5X A;  4DS5 A;  4ED7 A;  2AXT U;  5KFC A;  5KG4 A;  4DOB A;  3PML A;  5F3X B;  2DGZ A;  4KMU A;  3C1Z A;  2KG5 A;  1URJ A;  5DG8 A;  4IRD A;  4RQ3 A;  2W3S A;  2JH7 A;  1ZQX A;  2KFZ A;  2A19 A;  1S0N A;  4CF5 A;  1ZOL A;  4EX6 A;  3MR6 A;  3ONN A;  7ICL A;  3FAH A;  5K4L A;  2ZTE A;  3IN5 A;  8ICE A;  4UB2 A;  4I2A A;  4EZ9 A;  3ISD A;  1J2N A;  1Z1V A;  3OJU A;  2WF5 A;  1X9S A;  4AYB F;  5KFM A;  5J8Y A;  2FJ6 A;  8ICF A;  5H2F U;  3T5K A;  3KTQ A;  4G3I A;  1WG8 A;  4QNL A;  4YD1 A;  8ICZ A;  1TFR A;  4Y2T A;  2F44 A;  2PFO A;  1SL1 A;  7ICV A;  2QB0 A;  3GFK B;  3QU9 A;  8ICC A;  5CB1 A;  4JMU A;  2W9A A;  1ZXI A;  3T5L A;  2MA1 A;  4RT3 A;  4NL9 A;  5HHI A;  5AK3 A;  2E5S A;  4IC9 A;  1C20 A;  2LPE A;  4Y2U A;  1T3N A;  4F92 B;  2PXI A;  1N48 A;  1U45 A;  4OJ6 A;  5AM0 A;  1T8E A;  2BCS A;  5AKG A;  5KT5 A;  2HDO A;  4TUP A;  2LKY A;  3EW9 A;  5AI9 A;  3I1Y A;  4KLG A;  4XQ8 A;  2KNJ A;  2ASD A;  4DOC A;  5J2G A;  2A1J A;  1Q46 A;  1XU4 A;  5G5H A;  4UB8 U;  4R8U B;  2WF7 A;  5KFT A;  5IIL A;  2C28 A;  1BNP A;  4B9U A;  2ZUC A;  3T5H A;  3EUB 2;  2NO4 A;  4DL2 A;  4CDG A;  4Y2Y A;  2OH2 A;  2HOQ A;  4M9G A;  4QZ8 A;  2D6F C;  3T3F A;  1XSP A;  2XCA A;  1KN5 A;  2JXJ A;  4NJ8 A;  2A1A A;  5F9L A;  5BOM A;  4O9M A;  3MR2 A;  3LVV A;  2HBL A;  1ZQH A;  4RZR A;  4TQS A;  1FO4 A;  5F9N A;  2JEI A;  5JTI A;  1TK5 A;  2PMZ C;  3NVY A;  1DGS A;  4FE3 A;  8ICI A;  3KBB A;  2QAR A;  3WKE A;  3J81 j;  7ICE A;  3KFU F;  4IL6 U;  2I5H A;  1S0M A;  2JEG A;  3ZD8 A;  3MGH A;  4DQS A;  3BQ0 A;  2XO7 A;  2K4P A;  3KD3 A;  1XSN A;  2JEF A;  1O03 A;  1UA1 A;  2IOH A;  2KP7 A;  3L4P A;  4KLQ A;  2JRZ A;  5AKE A;  3PSF A;  2Y0S C;  4Y2Q A;  1ZQA A;  1X9M A;  4MFA A;  3GZF A;  3SMV A;  1D8L A;  3ETL A;  1U48 A;  3RB4 A;  5AIA A;  4YQW A;  5HR7 A;  1JRP A;  4RQ5 A;  2WF9 A;  3TAD A;  2ALZ A;  3D2Q A;  2F3N A;  3QZ7 A;  5L1M A;  4RQ2 A;  2NRV A;  1L7N A;  3IV6 A;  2I1Q A;  8ICQ A;  1HIW A;  8ICS A;  1ZQW A;  3MFI A;  1ZQL A;  1RG6 A;  1RXV A;  4RPY A;  3HP6 A;  5DLF A;  4OO1 J;  5J2J A;  9ICR A;  3T5J A;  5L1J A;  3CYM A;  1VLB A;  4C8N A;  2HOI A;  4GC7 A;  2W55 A;  2ZIW A;  2K60 A;  4Q43 A;  4F4K A;  4HAI A;  2LBO A;  3PR5 B;  2DKZ A;  4M04 A;  9ICC A;  3ZDD A;  4QWA A;  3SEN A;  2W8K A;  1QSS A;  2W43 A;  2FLP A;  2AU0 A;  4YCX A;  4UB4 A;  2W3R A;  1NI3 A;  4J9L A;  4ZOH C;  1N5X A;  2ZJ8 A;  3IHQ B;  3SAF A;  2HCF A;  3OPX A;  4RNO A;  1J2M A;  1U4B A;  4AYB C;  1OW5 A;  3MC1 A;  1N60 A;  2RQ5 A;  4LZD A;  4I2I A;  1ZQO A;  3SZ2 A;  3N7S C;  2W03 A;  1S97 A;  3C28 A;  4F91 B;  3MR5 A;  2MAX A;  1PK1 A;  4ED0 A;  5EE3 A;  2HHV A;  3M7D A;  8ICV A;  3M8S A;  1RYR A;  3PW5 A;  2OWO A;  4JUZ A;  2XY6 A;  2E8N A;  2A3V A;  3UXN A;  5J0O A;  4OJL A;  3BJY A;  1CRX A;  2C22 A;  4ELV A;  2WAQ F;  5D46 A;  2RDJ A;  4B9L A;  1X66 A;  3F5E A;  1NOM A;  4J9Q A;  1Q8K A;  5DB8 A;  5KFO A;  1TK0 A;  1KTQ A;  2G5H B;  5J0W A;  4NWI A;  1S0O A;  2ZIV B;  5KFP A;  4M0A A;  7ICI A;  1QCK A;  4WJ3 B;  4P0P B;  9ICU A;  4DLG A;  4UAS A;  3F2C A;  4ECU A;  5DLG A;  1A0P A;  4RQN A;  2KFN A;  1L7M A;  7ICM A;  3L3F X;  5KFG A;  5IIN A;  4O3M A;  4FZL A;  4LZG A;  2XGP A;  3E0F A;  5CHG A;  4RU9 A;  2ZTD A;  3PW0 A;  4DQI A;  5CR0 A;  1LKY B;  4QZD A;  4Q8E A;  4DFJ A;  5EWF A;  4YP3 A;  4ED3 A;  2F2A B;  2J6S A;  2ZTC A;  4RQ6 A;  5T14 A;  4P4M A;  4KN7 A;  2DBY A;  4RQM A;  1IG6 A;  2AHO B;  3H7I A;  2KZZ A;  1ZQP A;  1U9L A;  1DK2 A;  3IM1 A;  4F5Q A;  5J2I A;  3M1Y A;  4Y2J A;  1ECW A;  1KW4 A;  8ICP A;  3JPP A;  2ZJ5 A;  2XI9 A;  2GLE A;  3QXG A;  2E1E A;  9ICS A;  3LDA A;  5KFL A;  3THV A;  1QQ5 A;  1V97 A;  3C2M A;  4B9V A;  2MSN A;  4YMN A;  5J2D A;  4DL5 A;  4FBT A;  5IIK A;  3EPG A;  4UAY A;  1JN3 A;  1NZB A;  3AMZ A;  2NRW A;  4QZG A;  1N62 A;  3KKA C;  2M0N A;  4GFJ A;  4BXO A;  1DGJ A;  1LVH A;  4JV0 A;  3RH6 A;  1SKR A;  3F2D A;  4I27 A;  5ALW A;  5KG6 A;  3GIJ A;  3C2L A;  1ZQN A;  4R66 A;  4O3S A;  2FLN A;  2K4I A;  1TAU A;  3ZD9 A;  8ICG A;  4RUC A;  4DS4 A;  3QEB Z;  1ZQU A;  5HML A;  2WB1 F;  4US9 A;  2V4R A;  3RBD A;  3MDC A;  2ZIX A;  1UT5 A;  1TK8 A;  1MQ3 A;  1NK8 A;  2OYY A;  3QEA Z;  2EAN A;  4DLE A;  5KG1 A;  4DSJ A;  1H38 A;  5JRT A;  2HSZ A;  2E1F A;  3HT3 A;  4R63 A;  3PW4 A;  5ALJ A;  3MFH A;  1T94 A;  3SAH A;  2VKQ A;  3RH4 A;  1UPH A;  5ALD A;  5GTI U;  5J2E A;  4F2R A;  5AK5 A;  3PZP A;  1U47 A;  1JAL A;  1F0M A;  1K1S A;  4B6J A;  4Q44 A;  1OUQ A;  3ORY A;  1BPE A;  4DFM A;  1L5U A;  4BJQ A;  2WF6 A;  2LI6 A;  4DWI A;  9ICG A;  2K8C B;  4UAR A;  2YB1 A;  1UCV A;  4OJ5 A;  7ICS A;  1ZQF A;  5EE9 A;  3FYH A;  2XID A;  2IHM A;  4FO6 A;  4UBB A;  3AU6 A;  4OJO A;  4J9P A;  8ICY A;  2WAQ C;  1N61 A;  5AM3 A;  2BPC A;  1SV0 C;  3UXP A;  8ICT A;  1KBU A;  4K4H A;  3Q8Q B;  1QQ7 A;  1ZET A;  4MFF A;  3RB0 A;  1F5S A;  1SXE A;  3F2B A;  3JPO A;  2NRT A;  4QZH A;  2DQN B;  3NUQ A;  5L1K A;  1NKE A;  4JWN A;  1XWL A;  3RJH A;  1L7P A;  3RJK A;  1YZ7 A;  3Q8P B;  3K4G A;  1ZYQ A;  2Z7J A;  1ZQI A;  3ZDE A;  3PO4 A;  4UBC A;  1NJX A;  2OXO A;  2K89 A;  4NLB A;  4NLG A;  4RNN A;  1HUO A;  2UVW A;  4I2G A;  3UMG A;  3TAC B;  3RAQ A;  1S0V A;  4DQP A;  4I2D A;  5J2B A;  4ED6 A;  4DFK A;  1WWV A;  1LB2 B;  5KFJ A;  4DFD A;  4EEY A;  4C7Z A;  2HBJ A;  4ECT A;  8ICR A;  3SV3 A;  2BPG A;  3LYS A;  4F2S A;  1ZQK A;  2HMX A;  7ICU A;  5ALV A;  1MA7 A;  5AKL A;  1QLN A;  4BWJ A;  1RPL A;  4I28 A;  9ICT A;  3PX0 A;  5KAF U;  3OJS A;  2W9C A;  2JEJ A;  3BDP A;  3I28 A;  5AKX A;  5J0R A;  4FZM A;  4KLM A;  5EWE A;  9ICI A;  2G06 A;  9ICO A;  4RPZ A;  3MAB A;  3TFR A;  4QWD A;  5J2F A;  2E8O A;  4DF4 A;  1QH9 A;  9ICH A;  3O0F A;  5B5E U;  3ALR A;  5J29 A;  3RR7 A;  4EX7 A;  1JIH A;  3PW2 A;  3H0L B;  2AQ4 A;  1TE2 A;  5AIC A;  2FPM A;  3N28 A;  2FMP A;  1SB3 C;  3V7J A;  2NV3 A;  5EE1 A;  1ARO P;  4O3R A;  2PKE A;  2LM1 A;  2G0A A;  2Y9U A;  4JWM A;  8ICB A;  3IDW A;  3WU2 U;  4DSI A;  2KTQ A;  1DOQ A;  2AH5 A;  2L5Y A;  3WKC A;  5KFR A;  3F53 A;  5CEH A;  1B0X A;  4K4I A;  3C23 A;  2WB1 C;  3KZX A;  1PK1 B;  1L3T A;  3C1Y A;  1LV5 A;  2H3Q A;  1XNS A;  5TZV A;  4CF4 A;  3RFA A;  4Z6E A;  4BDP A;  4I2B A;  8ICM A;  4MF8 A;  4F4X A;  1V38 A;  1NK9 A;  2MRL A;  2RRD A;  2HHW A;  4PL2 A;  3TKA A;  3MR3 A;  4QWC A;  3LWM A;  1RZT A;  4ECX A;  2OCE A;  5BOL A;  2DF4 B;  2QLT A;  2R8K A;  3OSP A;  3NTU A;  3AUO A;  1IM4 A;  5KG7 A;  4B9T A;  1C7Y A;  2BCV A;  4OCZ A;  3M9M B;  4KX5 A;  3D2N A;  4IQV A;  1ZQT A;  5AKH A;  2PFN A;  3PX4 A;  3Q8L A;  4M6W A;  4CE6 A;  4EYI B;  2KN7 A;  4C8O A;  4PHE A;  3JPT A;  1S77 D;  3RH5 A;  3PNC A;  1BPY A;  4YD2 A;  4Z6D A;  2W7O A;  1IIP A;  3CW2 C;  1KLN A;  3UQ0 A;  4K4G A;  3GIL A;  4C4R A;  2B6G A;  1CUK A;  4KLU A;  4P0Q B;  1YZ6 A;  5BPC A;  3PSI A;  1RYS A;  4FFD A;  4BWM A;  5EOZ A;  1NJW A;  1U49 A;  3AQE A;  3RAX A;  1SIJ A;  2K4E A;  4FBU A;  2R18 A;  1JI7 A;  3WK5 A;  3GIM A;  5CJ7 A;  2PI4 A;  1A6S A;  5HHH A;  2XCP A;  5KT4 A;  2XY7 A;  4PJ0 U;  2R8H A;  1X6I A;  4I2C A;  4MF2 A;  3FDS A;  5DBA A;  4DFP A;  1QSL A;  3NVV A;  3QU4 A;  3H4B A;  4NLK A;  3K1R B;  4PHP A;  5KFU A;  4PZO A;  5ALF A;  7ICN A;  3BQ2 A;  2ZXH A;  1L8O A;  2YB4 A;  3BQT A;  2Y9T A;  4YVZ A;  4PPX A;  5C5J A;  1NJZ A;  3QUC A;  2LYB A;  5KG3 A;  3D6J A;  1NK0 A;  8ICU A;  1RQL A;  4U6P A;  4PH5 A;  1Q3V A;  2VAN A;  2ZUB A;  2ISP A;  4Q45 A;  4M9N A;  2FPK A;  2JHD A;  5J0U A;  4F5N A;  2MUT A;  1L3U A;  3GII A;  4NM1 A;  2P6R A;  1XS9 D;  3V6H A;  4DOA A;  3GDX A;  2DKX A;  5J2H A;  5L9X A;  1SZP A;  4O3N A;  3BZC A;  4RQ8 A;  5DDM A;  4Y2V A;  5DQG A;  2ODG A;  5EWG A;  2VA3 A;  5J0X A;  2XY5 A;  4JK1 A;  5KT6 A;  2P66 A;  2CXY A;  4M2Y A;  4KLH A;  5AM1 A;  2ZIX B;  2BDU A;  3LWL A;  2HOF A;  1L3S A;  2KD1 A;  1JX4 A;  9ICM A;  9ICX A;  3WKB A;  1CI4 A;  8ICK A;  3HIL A;  1TV9 A;  5ALT A;  5AK4 A;  4F5P A;  5HR6 A;  1WYG A;  4UAZ A;  5DDY A;  5KFI A;  2AJQ A;  5III A;  2OEH A;  2KSO B;  4O5C A;  3L5K A;  1JXL A;  1SL0 A;  4F72 A;  8ICW A;  4XA5 A;  4O3P A;  4NY8 A;  3KHL A;  1DK3 A;  1SZH A;  1S10 A;  1GO3 F;  2HHS A;  2G09 A;  1RM6 C;  2UVU A;  3WK4 A;  3WKA A;  1DRG A;  4F4Z A;  3H8M A;  3OGU A;  3H8W A;  3PY8 A;  2JMG A;  4NLZ A;  4I29 A;  3RB3 A;  2HHT A;  1J97 A;  3EZ5 A;  3D2S A;  3NVW A;  5KFZ A;  4F3O A;  3RF9 A;  1S9F A;  2ZUD A;  2Q4T A;  1X40 A;  3QYP A;  5KFE A;  2KVS A;  1KSP A;  4QW9 A;  4YR2 A;  1FEZ A;  4QW8 A;  1NKB A;  4RUA A;  4G9B A;  2F1I A;  4CCH A;  2WFA A;  3C2K A;  3LVW A;  4R8U A;  2AQ0 A;  2GOL A;  5D49 A;  2Q0Z X;  1NK6 A;  3F5A A;  2YMP A;  4UB1 A;  4PGQ A;  3RBE A;  5KG0 A;  3RJI A;  4RNM A;  4IRK A;  1EXN A;  3QE9 Y;  5ALH A;  1L7O A;  3C29 A;  5KFK A;  1TAQ A;  3V72 A;  2GWS A;  2F8K A;  2V9W A;  1AQ6 A;  2ZJA A;  2QKQ A;  4USA A;  3KOO A;  1O08 A;  1WCN A;  2KK0 A;  2W9B B;  4Y2S A;  9ICL A;  3BS5 B;  5DG9 A;  3ZDA A;  2DFL A;  5HP4 A;  7ICG A;  3UPQ A;  1N63 A;  1ZQE A;  2ASL A;  2KKP A;  5ALE A;  2JZB A;  5ALZ A;  3G6V A;  2WF8 A;  2BQR A;  2KMD A;  5AI8 A;  2EAP A;  4RQ1 A;  3AL0 B;  4KN4 A;  1HEK A;  4DL3 A;  2HW3 A;  2KV2 A;  4YG2 A;  2DWQ A;  2YY6 A;  3PVX A;  4ACO A;  3G6Y A;  4IS7 A;  3Q8S B;  5A0L A;  2JR5 A;  2PFP A;  2BKE A;  5J0P A;  5GTH U;  3BS7 A;  2AGQ A;  1BPX A;  4GLX A;  2KJ8 A;  1ZJM A;  5EE0 A;  1PZN A;  2W9M A;  5KFF A;  4RQ7 A;  2CRX A;  2ZXI A;  3V6K A;  3N97 B;  5AHX A;  4ZH4 A;  3ED5 A;  2JGA A;  1KFT A;  1KFS A;  5KL1 B;  2FPL A;  4I2F A;  2W7P A;  1Z1B A;  4GXI A;  1JMS A;  4Y2R A;  2EH9 A;  3GU3 A;  2H3V A;  4J9N A;  3I76 A;  2QB0 B;  5DB7 A;  2DPI A;  3RJG A;  3BQ1 A;  1QTM A;  4MFC A;  3JPN A;  2RP5 A;  3NRZ A;  3GIK A;  2KHV A;  1ZJN A;  5KFA A;  9ICK A;  3MGV A;  2IOF A;  2CPR A;  4CGZ A;  1JUD A;  4O3Q A;  3S6J A;  1JRO A;  3B9J A;  2K8B B;  5CA7 A;  1ZRM A;  3KHH A;  5J0T A;  4EBC A;  3UMC A;  5ALM A;  2R8G A;  5KAI U;  1RYU A;  2KEY A;  5L1L A;  4Q8F A;  1ZQC A;  3SAG A;  2H3Z A;  4P2H A;  5DBB A;  2ES6 A;  3H0R B;  4UQG A;  1ZQG A;  1L6N A;  5KFQ A;  5CWR A;  4QZB A;  4IQW A;  4ICA A;  3SQI A;  4LVS A;  2A1J B;  5HMM A;  4M9J A;  8ICX A;  4EYH B;  1XO1 A;  3PST A;  4J9S A;  3A0B U;  3KKA A;  4DL6 A;  2FLL A;  1QQ6 A;  1MQ2 A;  1XO0 A;  3BQ7 A;  5KFB A;  9ICW A;  2IHN A;  3OHB A;  1X42 A;  3AEV A;  5ALK A;  2Y1I A;  2KZ3 A;  4HYK A;  4I2J A;  2FDR A;  3V6J A;  3ZI4 A;  4I2E A;  3FC4 A;  3H8J A;  2ZIV A;  3C5G A;  2AGP A;  1VDV A;  3M9N B;  2QAR B;  4MEX A;  3QX7 A;  4PHD A;  5ALP A;  5FP0 A;  3VCB A;  2FE9 A;  1Q3U A;  3V7K A;  2BGW A;  1KL9 A;  4J9K A;  1F44 A;  1UHU A;  2ATL A;  5KTQ A;  1XSL A;  2ZIU A;  2LM4 A;  1ZQV A;  2G07 A;  2DL0 A;  5KFS A;  3DDH A;  1FFV A;  1ZD5 A;  5J8Y C;  4YMO A;  1HUZ A;  2LMR A;  2EAM A;  7ICQ A;  3OTQ A;  3KHG A;  1K5O A;  4YXJ A;  4DSF A;  4CRX A;  1LKY A;  4DSL A;  2H3F A;  1ZQS A;  1PVP A;  4BGD A;  3RB6 A;  1NK5 A;  2EZY A;  4PL1 A;  3K75 D;  4NL9 C;  2V4Q A;  4UB5 A;  3U26 A;  4GXJ A;  5AKI A;  5DGA A;  2BQ3 A;  1SXD A;  3NAS A;  4OD0 A;  1FFU A;  5KL8 B;  1SL2 A;  2B0C A;  2EZZ A;  1MC8 A;  3PO5 A;  3E2E A;  4EZ6 A;  2NYV A;  3TAQ A;  7ICJ A;  4F5O A;  3DEE A;  1SV0 A;  2MUT B;  1ZD2 P;  1SKS A;  1PVQ A;  2WHE A;  4IQU A;  4MHV A;  3IP4 B;  1B4F A;  5KFN A;  4KLT A;  2K8A A;  5IIJ A;  4RPX A;  2MU2 A;  2ZIW B;  3EYZ A;  3KZI U;  1RDF A;  2O6K A;  4EBE A;  1QSY A;  3QUB A;  4QZC A;  5IIM A;  2P6U A;  2YN4 A;  4KLI A;  9ICF A;  2KIC A;  4QIW F;  2D3D A;  8ICA A;  1T3Q A;  9ICE A;  2BPF A;  3K1Z A;  4P4O A;  4ECR A;  2FMS A;  4AP9 A;  4QWB A;  2HHU A;  2H3I A;  2LYA A;  2KVC A;  4YR3 A;  3SEI A;  1JXE A;  4DSK A;  2W04 A;  3ICX A;  1V85 A;  1WCL A;  4JB3 A;  2E8P A; 
#chains in the Genus database with same CATH homology
 2E1F A;  2HOQ A;  2JGA A;  2D6F C;  3VCB A;  1Q3V A;  2RRD A;  1Q3U A;  2JHD A;  4PL2 A;  5KL1 B;  4NV0 A;  1D8B A;  2YX8 A;  1T94 A;  2G5I B;  2F2A B;  2HBJ A;  3SAH A;  1F44 A;  2VKQ A;  3PSP A;  2XVT A;  3LVV A;  5T14 A;  2HBL A;  3ONN A;  2W7P A;  1TAM A;  1Z19 A;  2XIC A;  1Z1B A;  2KJ5 A;  2ZIU A;  3LYS A;  1UPH A;  3LVW A;  2N1R A;  3M6Z A;  3GU3 A;  2DF4 B;  2F8L A;  2H3V A;  2HMX A;  2GOL A;  3SAF A;  2G07 A;  3HKZ F;  3F5A A;  3OPX A;  3IN5 A;  1MA7 A;  3PZP A;  2PMZ C;  4KMO B;  4AYB C;  2CN1 A;  5CRX A;  1ECW A;  1OUQ A;  1ZQ1 C;  4FE3 A;  3H0M B;  4U7C A;  4P0P A;  2PMZ F;  2RP5 A;  4CRX A;  4AYB F;  3KFU F;  4FZM A;  2KHQ A;  2KHV A;  2XI9 A;  4KX5 A;  2H3F A;  3D2N A;  4BJQ A;  3MGV A;  3C29 A;  2G06 A;  3N7S C;  1PVP A;  2W03 A;  2CPR A;  2E1E A;  3C28 A;  4CGZ A;  2K8C B;  4U6P A;  4OJP A;  2YB1 A;  4PL1 A;  4OJ5 A;  1WUD A;  4QNL A;  2K8B B;  5C0Y A;  4BUG A;  2ZIX B;  3M7D A;  2KJ9 A;  2GH1 A;  2XID A;  4KX3 A;  2BDU A;  2HOF A;  4OJO A;  3PSF A;  2KEY A;  2Y0S C;  3O0F A;  4JMU A;  3N7P D;  3SAG A;  2MA1 A;  2H3Z A;  2KD1 A;  2WAQ C;  3ALR A;  4A8E A;  2A3V A;  5KL8 B;  1ED1 A;  2W7O A;  1IIP A;  3H0R B;  3GZF A;  2Y0S F;  4OJL A;  1CRX A;  2VJ4 A;  1KBU A;  3H0L B;  3SMV A;  1NZB A;  3IG8 A;  3T79 A;  1L6N A;  2WAQ F;  2KKP A;  2F76 X;  2E5S A;  4IC9 A;  4ICA A;  3SQI A;  4BX9 C;  4P0Q B;  2VIX A;  5HR6 A;  1PVR A;  3IG5 A;  5HR7 A;  2M0N A;  3PSI A;  3F5E A;  4GFJ A;  3DEE A;  3F2B A;  2K4H A;  1PVQ A;  2ZIU B;  2DQN B;  2G08 A;  2NV3 A;  3NUQ A;  2G5H B;  3N7R C;  4OJ6 A;  3D2Q A;  3M6K A;  4NWI A;  1P7D A;  3IP4 B;  3PST A;  3AL0 B;  1HEK A;  2K8A A;  2KOB A;  2OM6 A;  2KV2 A;  3AQE A;  4C0Z A;  2F77 X;  2G0A A;  2ZIV B;  2ZIW B;  3F2D A;  4WJ3 B;  2K4E A;  4ACO A;  4NLC A;  1XO0 A;  2R18 A;  1SZH A;  2LHT A;  4P0P B;  2Z7J A;  1GO3 F;  1HIW A;  4FZN A;  2LKY A;  3AQF A;  4QIW C;  5A0L A;  2G09 A;  2K4I A;  1A6S A;  3F2C A;  2RHF A;  3F53 A;  1A0P A;  4P0Q A;  2KNJ A;  2OXO A;  1DRG A;  3CRX A;  2KIC A;  4QIW F;  2K89 A;  4OO1 J;  4NLB A;  4QJF B;  2WB1 C;  3HKZ C;  3KZX A;  3CP8 A;  3L3F X;  3K1Z A;  2JMG A;  4O3M A;  2KJ8 A;  3CYM A;  2HBM A;  2H3Q A;  2WB1 F;  1XNS A;  2H3I A;  2KKV A;  2LYA A;  2ZIX A;  2ZXH A;  4FZL A;  2KVC A;  2HOI A;  3RF9 A;  2ZIV A;  2DGZ A;  3RFA A;  3D2S A;  1YT3 A;  2Q4T A;  2YB4 A;  2OYY A;  3E0F A;  2ZIW A;  1URJ A;  2VJ5 A;  3VC8 A;  2CRX A;  2ZXI A;  2JH1 A;  2LYB A;  2W04 A;  3ICX A;  4CDG A;  3NRW A;  2LBO A;  2JH7 A;  2OH2 A;  2HBK A;  2ZG6 A;  2MRL A;  2KIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...