2JMGA

Solution structure of v7r mutant of hiv-1 myristoylated matrix protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
131
structure length
131
Chain Sequence
GARASRLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag polyprotein
publication title Point mutations in the HIV-1 matrix protein turn off the myristyl switch.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 33
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2006-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2jmgA01
1HEKA 2K4EA 4JMUA 2H3QA 2H3FA 4ICAA 2H3ZA 2GOLA 2K4HA 2N1RA 1HIWA 2JMGA 1A6SA 1ED1A 2NV3A 1UPHA 2LYBA 4IC9A 1L6NA 2H3VA 1ECWA 2HMXA 1TAMA 2H3IA 2K4IA 2LYAA
chains in the Genus database with same CATH superfamily
4DSKA 1QQ5A 4RQ5A 3MGIA 3OHAA 2HVHA 4UAYA 3AQFA 5ALDA 2A1JB 3PW5A 3QU7A 3PSFA 3N28A 5AKEA 1JN3A 3NGDA 4J9NA 2W9BB 2NRVA 4F91B 3MFHA 3QE9Y 4Y2TA 3KHHA 3FM9A 5CWRA 4TURA 3Q8QB 3C1ZA 1B0XA 2MU2A 2WB1F 2NO4A 1A77A 1ZQJA 2YMPA 4M04A 2DUYA 5KFCA 4DS4A 3ALRA 2W3SA 3K4GA 4UB1A 3Q8RB 1NZPA 1J97A 4OCZA 9ICMA 4F4WA 2J6SA 2JMGA 5KFHA 5IIMA 4R64A 1NZBA 2AQ0A 2EAPA 2OM6A 4DL4A 4M9GA 2K4IA 1UA1A 8ICTA 5AM1A 3BS5B 2AJQA 8ICFA 2ISPA 2CXYA 3ZDDA 4G3IA 3THVA 5AI4A 3RH6A 8ICZA 4PH5A 1X9SA 1MA7A 1L3SA 3UXNA 1L7OA 5J0TA 1HUOA 3WK6A 2D6FC 5J0XA 4RQ3A 2PMZF 5CRXA 3Q8KA 1MQ3A 2J6TA 5AKGA 2KKPA 4RT3A 3UMGA 1U47A 3CYMA 1DXSA 4K4IA 3TFRA 3EYZA 4YFKA 2K60A 1ZQOA 1WG8A 1ZQZA 1Y88A 1N60A 4KN4A 2W43A 2ZTCA 5DG8A 2RQ5A 4J03A 4P4PA 5KG5A 3UM9A 1TKDA 1QSSA 4P4MA 2VANA 4GXJA 1ZQFA 3A0HU 4I29A 3SI8A 3EPIA 1KBUA 2R8KA 4ECRA 2AGPA 2HOFA 3Q8LA 3C28A 1RQNA 1DK3A 5HMLA 4DS5A 1L7PA 1TVAA 3M1YA 5IIIA 4ELUA 4HAIA 2F2AB 1ZQNA 4PPXA 2F1JA 3KBBA 4ECXA 2YMQA 4R65A 4CF5A 2NRTA 3LK9A 1OUQA 2RDJA 2W55A 4TUSA 2W8KA 4P0PA 1D8BA 2LBOA 2XY5A 2LMRA 2W7PA 3RB3A 4J9LA 2ZG6A 1PUZA 2XGPA 2RLTA 4ECZA 5EE0A 1HJPA 9ICGA 5C5JA 1ZQQA 3DDHA 9ICNA 1X6IA 4IS7A 5IINA 4UQGA 2Q4TA 1JIHA 2BDPA 4YG2A 4CF4A 1QH9A 4EENA 1L8OA 4EX7A 1KW4A 1RQLA 2JV3A 3V6KA 3HW8A 4UAZA 4QWEA 4MFAA 4QZIA 2KIWA 4ZH4A 1WUDA 4GXKA 2PFPA 9ICOA 3IHQB 2QARA 2ZJ8A 3BZCA 5HR7A 3H0MB 2HHVA 4GC6A 4ECYA 3SV4A 4DL2A 2KJ9A 1Z1BA 3SEIA 4KTQA 3LYSA 4ED2A 3V7JA 5H2FU 3Q8MA 1ZQAA 3IN5A 5KFFA 4FS2A 4J9QA 4B9VA 1ZQEA 1ZQCA 5KFPA 2I5HA 4JMUA 2AQ4A 9ICUA 3RJHA 4Z6DA 1GO3F 4GXIA 1BNPA 1N56A 1Z3EB 5HHHA 4J9OA 2YQEA 5EWFA 3SAHA 8ICKA 4Y2RA 3RFAA 5TZVA 3PMLA 1X40A 5KFWA 4US8A 3N4MB 3HILA 3MR5A 2MUTA 2JGAA 5ALZA 3K1ZA 4KMOB 5KG1A 1KRPA 3GFKB 2O6KA 4OJ5A 3CNHA 1ZQDA 4KLGA 5KL1B 2E1FA 1SXDA 3RAQA 5KFQA 5JTIA 4MF2A 2WAQF 3KZXA 4EYHB 3EWAA 2EZXA 1DK2A 4I27A 3OSNA 3FDSA 3I28A 3RBDA 2M0NA 5DB9A 3E58A 4QZCA 4X5VA 1U45A 4FFDA 3E2EA 2K8BB 2ZIWA 1ZQLA 2DFLA 3Q8PB 2XGQA 4F50A 5ALEA 2J6UA 3PSPA 4F71A 8ICAA 3GIJA 3LVVA 4ED7A 1ZYQA 2PFOA 5ALPA 5TISU 1CEZA 1VJ5A 5HP4A 3KHRA 4F3OA 4ICAA 1PK1A 2WFAA 4F92B 1M6YA 4UATA 1UA0A 8ICPA 5EE9A 3UMCA 1PK3A 4P0PB 1ZD4A 3QZ8A 4DF4A 1KTQA 4M6WA 1DRGA 4ED8A 1OXJA 3G6XA 5CHGA 3GDXA 4QZHA 1LV5A 2IOFK 5EWGA 9ICBA 3NVYA 1SL2A 2JH1A 1XNSA 4JV2A 4LVSA 2F8KA 5DQHA 3QU4A 4ACOA 4KLTA 4Z6EA 4RQMA 2FPKA 2PI5A 1NK5A 4Y2XA 2QARB 2BQUA 1ZQGA 2BPCA 1JUDA 5E79U 4YD1A 2FMSA 9ICTA 2Y9TA 4YCXA 2OWOA 3PSIA 3PR5B 5AKJA 1SKRA 2B21A 3HJEA 4IRKA 1T94A 2KHQA 5IIJA 3RJFA 4KLIA 2JHDA 5A0LA 3TI0A 4DL7A 5F9LA 4RQNA 2BPFA 3NVWA 3C2LA 7ICMA 4TUPA 3PO4A 5AK3A 2E8MA 2KICA 4MF8A 4O3OA 4QZDA 2LYBA 2MUTB 2KG5A 4UB6U 3EPGA 4Q44A 1ZD2P 3TAPA 4NY8A 2XY6A 3AN1A 2W54A 4YR0A 2D8CA 5IIOA 2VA2A 4P0QA 1ZQSA 2G0AA 5AKZA 2JEIA 4IR1A 4F5RA 2LHTA 5CR0A 3ONNA 3JPRA 4IQVA 1N5WA 4J9MA 1L3TA 1CRXA 4O5EA 3AM9A 1Q8KA 3GIKA 1L3VA 2LYAA 3ZDCA 3PW0A 1XO0A 2RDIA 2ZIWB 5KFBA 1ZQWA 3O0FA 1NK4A 1NJYA 3C5GA 2K89A 2ASLA 4DQSA 2BKEA 1HIWA 2NYVA 5ALTA 4UB4A 3VCBA 4KLEA 3G6YA 4NLKA 2JZBA 4O3MA 4O3QA 3ZDEA 5KAIU 5DB7A 5ALWA 3PX6A 2CPRA 4NLNA 3L5KA 2DWQA 1F44A 3T5JA 2C28A 3PNCA 4BUGA 5KFOA 3C5FA 5KFMA 1PK1B 5ALOA 3ZDBA 7ICEA 1S97A 3ORYA 2G07A 2JEGA 2P35A 2FMPA 9ICKA 1BPYA 4C8OA 3V7KA 3GILA 4QZEA 2KOBA 5L1KA 5KFGA 3LWLA 1BGXT 4M6WB 2BZFA 1ZOLA 3K1RB 8ICXA 5D4BA 5KAFU 2JEJA 4ELVA 5J2IA 2WHEA 1KQQA 4F5NA 1N61A 1KEJA 3QUBA 4DQPA 2H3ZA 5CEHA 8ICQA 3QX7A 3UPQA 4DQRA 3WKAA 3MDCA 2BPGA 5DG9A 5KT5A 3PR4A 4A8EA 4KLSA 4O5KA 3HP6A 4NL9A 2H3VA 3MFIA 2ZXHA 1U9LA 3KHGA 4Q45A 4Q8FA 3AL0B 3H4BA 2HSZA 1A0PA 3QYPA 3NRZA 5KG7A 4RU9A 3OTQA 2ISOA 1MQ2A 4C8LA 9ICJA 3RJIA 3G6VA 1L8LA 1D8LA 1NK6A 3QEBZ 4BWMA 7ICFA 4ECSA 1ZQRA 2R8GA 5ALIA 4M47A 3F53A 3RB0A 4F4KA 3RRHA 1RG6A 2UVRA 2I1QA 5JUMA 1V38A 3HPOA 4DL6A 2OCEA 5KT6A 4NLCA 4KLDA 2PFQA 7ICTA 1NKEA 3TFSA 2NRXA 4QZBA 4JK1A 5DGAA 3RRGA 7ICRA 4RQ0A 1SKWA 2W04A 4NLBA 4P0QB 7ICGA 9ICWA 3L4PA 2YTUA 5J8YA 2KFZA 2W9CB 2BQ3A 1KDHA 2FLPA 3RBEA 4GIBA 2F44A 4ED3A 1K5OA 5ALSA 4AYBC 4UBCA 3KFUF 7ICHA 5AI5A 2ZTEA 4RQ4A 3N7RC 3F2DA 4GFJA 3SD7A 5BPCA 5J2FA 5DQIA 3E0FA 1U49A 1TAMA 4UB8U 8ICMA 1VDVA 4DFKA 4MEYA 5ALMA 2VA8A 3QNMA 1B4FA 4NL9C 2JZBB 3D6JA 3OSPA 2EZYA 1UPHA 2XIDA 1ZD5A 2HBJA 2EAMA 4DSLA 4CNQA 4CDGA 1QLNA 5KNIA 2JXJA 1ZJMA 2E1EA 2KZMA 4RNMA 2HHUA 7ICSA 2LI6A 2LM1A 1ZQHA 4KLQA 5J2HA 5AKYA 3CP8A 3WU2U 1X2IA 2DL0A 7ICKA 1X6JA 3B0XA 1F5SA 3KZIU 2G5IB 3JPPA 3B9JA 1RYSA 3TACB 9ICAA 4DSEA 3PX0A 2EZZA 3WKBA 3M9OB 1NJXA 1XC9A 4ECUA 5ALHA 4K4GA 3HWTA 1Z4NA 3C23A 1COKA 4KLFA 1ZQBA 1BPDA 3NTUA 4YR3A 4DF8A 5B5EU 1FIQA 2MA1A 8ICLA 5J8YC 4YXJA 2KKVA 1ZQVA 4FZNA 3M8SA 2PXIA 4YN4A 3I76A 4C7YA 1SGGA 1A76A 1ZRMA 2RRDA 2HOQA 1O03A 3PSTA 1Z19A 5DLFA 3SZ2A 1TFRA 3TARA 2Y0SC 3C21A 3KD3A 1UQVA 4RUCA 4F93B 3MDAA 1AROP 2QB0A 1S0OA 1XU4A 4NLZA 4QJFB 3PMNA 2KHVA 3JPSA 4O9MA 3GZFA 1RPLA 5KT4A 3CRXA 2WF6A 4KLJA 1K1SA 1URJA 1SWVA 4DLEA 1N5XA 1N48A 2H3FA 3H0LB 7ICLA 2HCFA 9ICPA 3C2KA 1SIJA 2NRWA 1S9FA 3QUTA 5JU5A 4J9KA 2ZIUA 9ICEA 3FYHA 4OJPA 2DPJA 3PW7A 5DBAA 4RQ2A 1BPBA 7ICIA 7ICQA 1JI7A 4B9NA 2W03A 8ICVA 4BXOA 3MR2A 2E8NA 4DOCA 4ED0A 4NLGA 3VC8A 1ZQTA 1QQ6A 3GV5B 4PHEA 4UB2A 3JPTA 4DL5A 4TQRA 2DPIA 1ZQUA 8ICIA 1TK0A 3SAFA 4I2AA 4YD2A 3UQ0A 2OEHA 4RQ7A 4DFMA 4UW9A 4LJXA 3EW9A 2EAOA 4US9A 3SR6A 2I6XA 8ICEA 4FE3A 2DF4B 3GV8B 4C4SA 4JV1A 4QWCA 5KFUA 1DGSA 5J0RA 4IRCA 4RNOA 2IMWP 1XS9D 2W9AA 8ICJA 3TANA 3WKEA 5L1JA 4DL3A 2WF9A 5CJ7A 7ICJA 3H0RB 1ZETA 1A6SA 2WTFA 5J2AA 2JH7A 2HOIA 2YY6A 3AQEA 3DV9A 8ICNA 5DQGA 1P7DA 1X42A 1T3NA 4F5OA 3ISCA 1TE2A 2F76X 4C8NA 4F72A 4DEZA 2M9NA 4JB3A 1ED1A 3ETRA 5KFIA 1WCLA 2RHFA 5AI6A 1XSPA 5AK5A 5DBCA 4KLMA 4DSJA 1TAQA 1TAUA 1H38A 2K8AA 1K1QA 5ALNA 5J0QA 4YQWA 5L9XA 1YZ6A 2OYYA 4I2CA 4OD0A 5ALUA 4J9PA 5B66U 1Z00A 5DBBA 5HR6A 1RDFA 4AYBF 3V6JA 1L7NA 4OJOA 2K4HA 4YMMA 3GIIA 1UCVA 5ALYA 2QB0B 2Y1IA 5J2JA 4RT2A 4KLLA 3IM1A 5JRTA 4B9MA 3OPXA 4DLGA 4QZFA 3RR8A 4EBDA 4Y2YA 4LZGA 2IOHA 2ZIUB 4PGXA 2F1HA 3F2BA 8ICUA 2GO7A 2ODGA 1L5UA 3QEAZ 5F3XB 4Y2PA 4Y2QA 2VKQA 2XY7A 8ICSA 4UAVA 2ALZA 4RNNA 5DB6A 4BXOB 4UAUA 4TUQA 1NK8A 2FPLA 3BQ2A 5AM4A 2ESEA 8ICCA 1CUKA 1ZQIA 3N7PD 1HEKA 2KMDA 2KD1A 1SWWA 3DEEA 4UASA 4RPZA 3JPQA 2IHNA 3BDPA 2A1AA 1VLBA 5G5HA 4EBCA 1EXNA 7ICNA 2N1RA 5ALFA 4UAWA 4P2HA 1V9PA 2GLEA 1ZQMA 5AKIA 3MR3A 4J9RA 4QZ9A 1S77D 3NVVA 5AK6A 1SL0A 1IIPA 5J0PA 4O0IA 4JV0A 5KT7A 1BNOA 2V4QA 1QQ7A 3M7DA 1IM4A 2KK0A 1SB3C 3ZD8A 2CN1A 5J0SA 1S0NA 2DQNB 4CRXA 1LKYA 1NJZA 2XO7A 1JXEA 2AGOA 3N7SC 5CA7A 2HDOA 5DLGA 2F8LA 3BQ1A 2HHQA 2ES6A 3RJEA 2KJ5A 3K75D 3KOOA 4DO9A 1PVPA 1Q3UA 2Y0SF 2W9MA 4GLXA 1QCKA 4EEKA 4PZOA 5BOLA 4NWIA 3V7LA 8ICYA 4IQTA 2PMZC 5AI0A 1L7MA 5AM0A 4NM2A 1PZNA 3WK7A 4FBUA 4YP3A 1N2XA 5KFKA 4I28A 1S5LU 4KITB 4DFDA 1ZJNA 1IG6A 1NJWA 4DQQA 4Q43A 2W9CA 1Z4OA 1NKBA 2XVTA 1WYGA 3H4DA 3AEVA 1RYRA 5AKXA 1WWVA 1Z00B 2G06A 9ICXA 2H3QA 1UT5A 2YN4A 3WK4A 5KT3A 3IG8A 5ALVA 5G5GA 4YMNA 4DSFA 9ICIA 4PGYA 1TV9A 8ICWA 9ICCA 2ASDA 3SYZA 4KX3A 4QWAA 2HMXA 2FI1A 4J9SA 2EQYA 1CI4A 1F0MA 5FP0A 2QB1A 3Q8SB 2R8JA 1S76D 2OHFA 1X66A 4QZAA 4RPXA 2P6RA 3L3FX 4BJQA 4I2EA 4DFPA 1X9WA 1U48A 3NS1A 5EE1A 2V4RA 1IXRA 3GIMA 3NRWA 4QW9A 4CCHA 2K8CB 2DKZA 4DOAA 2C2RA 3ICXA 8ICGA 2C22A 4GC7A 1RXWA 2W11A 3QUCA 2MAXA 3IRUA 5J0YA 4R8UA 2BHNA 3NVZA 1ZXIA 5KG4A 1YZ7A 3RH5A 4I2GA 4B9SA 3C29A 4QZ8A 3QXGA 2AHOB 5IILA 9ICLA 2KVCA 5J2CA 3ZI4A 3TAQA 5AM5A 2Z7JA 2FLNA 2NRZA 3BQTA 5KFRA 2KZ3A 1LKYB 2QKQA 4CE6A 4KMUA 4YMOA 5KG0A 2BDUA 5C0YA 4R63A 4K4HA 3KTQA 1UT8A 3SV3A 5HMMA 1XSLA 3HKZC 3TQ1A 4HYKA 1T8EA 1JALA 4IQUA 5AI8A 5ALLA 5AKLA 1KL9A 2Q0ZX 4AP9A 2HVIA 5J29A 1V85A 4BX9C 2LYHA 2WF5A 2F77X 2VA3A 3WK9A 4IL6U 3UQ2A 1YT3A 4R66A 3OJUA 4E0DA 2XICA 4ED6A 4UARA 4EZ6A 5KFNA 3SMVA 5AM3A 4F8RA 3H7IA 3RR7A 2LPEA 4DWIA 4MEXA 4PHAA 5J2GA 2IHMA 2UVUA 9ICFA 4B9LA 2XC9A 2HBKA 1X9XA 2E8PA 3M9NB 4UBBA 4I2JA 2BCVA 5DDMA 2OXOA 1ZD3A 2KE7A 2YMMA 2OH2A 3T3FA 2A3VA 4M9LA 1FFVA 2KP7A 1QSLA 2P66A 5DB8A 1BVSA 3AU6A 2FPMA 2H3IA 1T7PA 4IRDA 1KLNA 2LM4A 4F4ZA 2VJ4A 3RH4A 5AIBA 3IDWA 4M0AA 2F3NA 2HHWA 5J2DA 4ECTA 4PHDA 1PVQA 1KFTA 4FZLA 1RYUA 4RQ6A 2YX8A 4LZDA 1D9FA 1C20A 4RZRA 4C80A 2DKXA 3EUB2 2G08A 4NV0A 4I2DA 5L1MA 2BGWA 3HX0A 4EYIB 3LVWA 5J2KA 2GOLA 1S0VA 2HBMA 5J2EA 1NI3A 2HW3A 1HUZA 1NNLA 4IC9A 2KTQA 2EDUA 5KT2A 3C1YA 2ZIVA 2D3DA 5J0WA 2L5YA 3GU3A 3AMZA 2R8IA 4R8UB 4ECQA 1SV0A 1PVRA 5ALQA 4M9NA 4I2HA 4USAA 1L3UA 4UB3A 5KFSA 3D2SA 4EBEA 2MRLA 5L1LA 3RJKA 4CF3A 4KLUA 1N63A 3A0BU 3IP4B 4MFFA 4ECVA 5AKKA 1KKXA 1LB2B 1FEZA 4F2SA 1SKSA 1JMSA 2LKYA 5KL8B 5D46A 2K4PA 5AM2A 3S6JA 5CP2A 3FC4A 5K4LA 2KEYA 1QTMA 2YMLA 1DGJA 4MFCA 2BCSA 3MC1A 1UHUA 3H40A 1XSNA 3UMBA 4NM1A 5DDYA 3PO5A 4XUSA 9ICVA 8ICOA 4U7CA 4BGDA 5AHXA 5GTHU 2VJ5A 2W3RA 5ALXA 1J2MA 4B6JA 3RTVA 1SXEA 2NO5A 4PZNA 1ECWA 1BPXA 3LDAA 3KKAA 1NKCA 8ICRA 3F5EA 5KG2A 3T5HA 5KFTA 2ZUCA 5AIAA 2K4EA 4QWBA 4FBTA 3GV7B 3RAXA 4YVZA 3LWMA 2ASJA 3M9MB 4OJ6A 1QSYA 1B43A 4C4RA 2YB1A 5DG7A 2B6GA 3BQ7A 3U26A 5DGBA 3RB6A 1SV0C 3BJYA 2FMQA 3D2QA 2C2EA 5AKHA 2DBYA 3M8RA 4PHPA 2QLTA 3WKCA 1NOMA 1NK9A 2BQRA 2ATLA 4KX5A 4I2BA 2WF8A 5HNKA 2BCUA 4XA5A 4WJ3B 2JRZA 3TKAA 3OHBA 4QNLA 4PGQA 3ETLA 3QU9A 3SAGA 2AU0A 3T5KA 4TQSA 1T4GA 3HKZF 1S10A 2XCAA 2A19A 1BPEA 4NJ8A 2ZIVB 1X9MA 1KFSA 4G9BA 1LVHA 1D9DA 1TK5A 4QWDA 2PFNA 4F5PA 1ZQXA 4O3SA 3CW2C 3HT3A 2FE9A 3D2NA 2KFNA 3B0YA 3JPOA 5KTQA 3ISBA 2JEFA 4QIWC 4Z6FA 1COOA 3KKAC 2ZXIA 2FLLA 2UVWA 3NUQA 3F5AA 3OJSA 1O08A 3IV6A 3ISDA 4Q8EA 2KN7A 3UXPA 4YR2A 2HHXA 2JR5A 4DCCA 1SL1A 2AXTU 3H8JA 5EWEA 1DOQA 4M9HA 4EZ9A 2PKEA 2GH1A 3WKDA 2AGQA 2IBKA 1IV8A 1V97A 2KJ8A 5KFLA 2IOFA 4RPYA 2HBLA 1RM6C 4IQWA 1FFUA 3QU2A 2R8HA 7ICOA 2C2DA 2E8OA 5ALGA 2EANA 3BQ0A 5KFXA 3KHLA 5D49A 3WK5A 2KV2A 3QU5A 1ZQPA 4O5CA 9ICQA 3BZKA 2Y1JA 5BOMA 5EOZA 2E5SA 4EX6A 2KSOA 1SV4A 3J81j 3ZD9A 5KG3A 1ZQYA 4Y2VA 4JWMA 2VIXA 3QZ7A 1JX4A 1S8OA 2WB1C 1MSWD 2HI0A 3RJGA 3I1YA 2G09A 5L1IA 1JXLA 3PZPA 3RF9A 4DOBA 1Z1VA 3AUOA 2KIVA 4PL2A 5KFZA 4ZOHC 4DQIA 5EE3A 1T3QA 2B0CA 8ICHA 5KG6A 3PW2A 2MSNA 2ZJAA 3ZDAA 1ZQ1C 2F1IA 2P6UA 3MABA 4EEYA 2DGZA 2IA6A 1MN8A 4C8MA 4O3RA 3WK8A 3NASA 2ZIXA 1SZHA 3PX4A 3H8SA 2R18A 4PL1A 5AI9A 5KFEA 1XO1A 1KSPA 1RZTA 9ICRA 4ECWA 3F2CA 3SENA 2EH9A 3RJJA 2BCRA 4BWJA 2E3TA 3N97B 5CB1A 1MC8A 4B9UA 4RUAA 2ZJ5A 2HHSA 4BDPA 4F4YA 4EELA 4U6PA 1FO4A 3EZ5A 2UVVA 7ICPA 1NK7A 2I9GA 5DKWA 4F2RA 2ZUDA 4I2FA 5KFYA 4ED1A 1WWUA 2GWSA 1SZPA 4QW8A 1OW5A 1Q3VA 4NXZA 3MGVA 2FDRA 1S0MA 1N62A 4Z6CA 5AK4A 2W8LA 4C4TA 4KLOA 2A1JA 3M6ZA 3SQIA 2BR0A 3MBYA 2W9BA 4RQ1A 3H8MA 5KFJA 3HRDD 1Q46A 4P4OA 2KZZA 4C0ZA 4Y2JA 3V72A 4C7ZA 3PY8A 1ZRNA 4YXMA 4B9TA 1J2NA 5ALRA 5ALKA 2NV3A 3R9KA 2ZTDA 5KFDA 7ICUA 1RXVA 2WF7A 2AH5A 2HHTA 2KSOB 1C7YA 4DFJA 3TADA 4M2YA 5F9NA 4DSIA 5GTIU 3BS5A 2FJ6A 3PVXA 5HHIA 2XI9A 1NK0A 4Y2UA 5J0OA 4C8KA 4ELTA 4FS1A 4UB5A 4OO1J 2XCPA 3C2MA 4CGZA 5ALJA 2CRXA 1JROA 5T14A 4XQ8A 3PW4A 1BPZA 2H5XA 1D8YA 1AQ6A 3FAHA 5IIKA 3H8WA 5J2BA 3BS7A 3JPNA 3ED5A 1XWLA 4QZGA 4QIWF 4MHVA 4O3NA 3OGUA 4IR9A 8ICBA 4JWNA 3AU2A 4O3PA 1L6NA 4Y2SA 5KFVA 4XRHA 4F5QA 3UXOA 4PJ0U 4M9JA 2KVSA 2ZIXB 3MGHA 4KN7A 4OJLA 1B22A 3IG5A 1U4BA 1KN5A 3QUQA 1ZQKA 4F4XA 7ICVA 4JUZA 1KFDA 3RB4A 5J0UA 9ICHA 5KFAA 2RP5A 2YB4A 2KNJA 4I2IA 9ICSA 4RQ8A 3M6KA 2W7OA 3V6HA 1JRPA 2BCQA 1WCNA 2ZUBA 2V9WA 4KLHA 3TADC 3GQCA 1TK8A 2Y9UA 2WAQC 3T79A 5AICA 4FZMA 2G5HB 4FO6A 2PI4A 3T5LA 3MR6A 3PV8A
chains in the Genus database with same CATH topology
1XO0A 4NV0A 3F5EA 1DRGA 2ZIWB 2ZIXA 3O0FA 2BDUA 2K4EA 3AQFA 4JMUA 1SZHA 3LVWA 4NLCA 5C0YA 1GO3F 2K89A 2GH1A 2R18A 4PL1A 2GOLA 2ZIUB 4FE3A 2XI9A 3PSFA 1KBUA 1HIWA 3F2BA 2DF4B 2HBMA 4OJ6A 3HKZC 3VCBA 3F2CA 2MA1A 3SAHA 2XVTA 2YB1A 3RFAA 2KJ8A 4O3MA 2VKQA 4IC9A 4OO1J 2HOFA 2KKVA 2JH1A 4FZNA 3C28A 1XNSA 4CGZA 4ACOA 2CPRA 2CRXA 2W04A 2JGAA 2RRDA 2HOQA 2WB1F 2ZIVA 4NLBA 1F44A 2HBLA 3D2QA 5T14A 4P0QB 3K1ZA 3GU3A 3PSTA 4KMOB 4U6PA 1Z19A 4BUGA 2G06A 3N7PD 4BX9C 1HEKA 2F2AB 2H3QA 2KD1A 3DEEA 3ALRA 2G07A 2Y0SC 3IG8A 4AYBC 2F77X 3KFUF 4OJ5A 1PVRA 2N1RA 2JMGA 3H0RB 2KV2A 5KL1B 2E1FA 4QIWF 1A6SA 1YT3A 3PSIA 3N7RC 3F2DA 4GFJA 3D2SA 2JH7A 2XICA 4KX5A 1NZBA 2HOIA 2KOBA 4KX3A 2OM6A 2WAQF 1OUQA 1L6NA 3KZXA 3SMVA 1IIPA 2MRLA 3AQEA 2W7OA 3E0FA 1T94A 2HMXA 2KHQA 1TAMA 1Q3VA 2K4IA 1P7DA 4P0PA 1D8BA 2LBOA 2ZIXB 2W7PA 3M7DA 2E5SA 4QJFB 2JHDA 5A0LA 3MGVA 2KHVA 2M0NA 4WJ3B 3GZFA 2F76X 2ZG6A 4OJLA 3IP4B 2CN1A 3IG5A 3CRXA 1URJA 2HBKA 4QNLA 2H3FA 2DQNB 3SAGA 4CRXA 2K8BB 2ZIWA 2H3ZA 2OXOA 1MA7A 3H0LB 1ED1A 2LKYA 2OH2A 2KICA 3HKZF 2D6FC 2A3VA 1UPHA 2XIDA 2ZIUA 5KL8B 2RHFA 3M6ZA 3N7SC 2HBJA 4OJPA 3SQIA 2LYBA 2VIXA 2Q4TA 2ZIVB 3PSPA 3L3FX 4A8EA 2F8LA 4BJQA 4CDGA 2H3VA 2PMZF 2E1EA 2ZXHA 2KJ5A 3LVVA 2KEYA 3NRWA 2K8AA 2WB1C 2RP5A 2H3IA 2YB4A 5CRXA 4C0ZA 2W03A 2KNJA 2K8CB 2KKPA 2OYYA 2VJ4A 2G09A 1PVPA 3AL0B 3CYMA 1Q3UA 3M6KA 2KIWA 3ICXA 3D2NA 4P0QA 1A0PA 2G0AA 3VC8A 1WUDA 2Y0SF 3RF9A 3PZPA 3CP8A 5HR6A 4ICAA 4AYBF 4U7CA 4PL2A 4OJOA 2K4HA 2VJ5A 4QIWC 2LHTA 2NV3A 5HR7A 3H0MB 4NWIA 3SAFA 2G5IB 3ONNA 2KJ9A 1Z1BA 2ZXIA 3C29A 1PVQA 2WAQC 3LYSA 4FZLA 2KVCA 2PMZC 3NUQA 3T79A 4P0PB 2YX8A 1ZQ1C 2G5HB 3F5AA 4FZMA 1CRXA 1ECWA 3F53A 2Z7JA 3IN5A 2DGZA 2G08A 2LYAA 3OPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HEK A;  2K4E A;  4JMU A;  2H3Q A;  2H3F A;  4ICA A;  2H3Z A;  2GOL A;  2K4H A;  2N1R A;  1HIW A;  2JMG A;  1A6S A;  1ED1 A;  2NV3 A;  1UPH A;  2LYB A;  4IC9 A;  1L6N A;  2H3V A;  1ECW A;  2HMX A;  1TAM A;  2H3I A;  2K4I A;  2LYA A; 
#chains in the Genus database with same CATH topology
 4DSK A;  1QQ5 A;  4RQ5 A;  3MGI A;  3OHA A;  2HVH A;  4UAY A;  3AQF A;  5ALD A;  2A1J B;  3PW5 A;  3QU7 A;  3PSF A;  3N28 A;  5AKE A;  1JN3 A;  3NGD A;  4J9N A;  2W9B B;  2NRV A;  4F91 B;  3MFH A;  3QE9 Y;  4Y2T A;  3KHH A;  3FM9 A;  5CWR A;  4TUR A;  3Q8Q B;  3C1Z A;  1B0X A;  2MU2 A;  2WB1 F;  2NO4 A;  1A77 A;  1ZQJ A;  2YMP A;  4M04 A;  2DUY A;  5KFC A;  4DS4 A;  3ALR A;  2W3S A;  3K4G A;  4UB1 A;  3Q8R B;  1NZP A;  1J97 A;  4OCZ A;  9ICM A;  4F4W A;  2J6S A;  2JMG A;  5KFH A;  5IIM A;  4R64 A;  1NZB A;  2AQ0 A;  2EAP A;  2OM6 A;  4DL4 A;  4M9G A;  2K4I A;  1UA1 A;  8ICT A;  5AM1 A;  3BS5 B;  2AJQ A;  8ICF A;  2ISP A;  2CXY A;  3ZDD A;  4G3I A;  3THV A;  5AI4 A;  3RH6 A;  8ICZ A;  4PH5 A;  1X9S A;  1MA7 A;  1L3S A;  3UXN A;  1L7O A;  5J0T A;  1HUO A;  3WK6 A;  2D6F C;  5J0X A;  4RQ3 A;  2PMZ F;  5CRX A;  3Q8K A;  1MQ3 A;  2J6T A;  5AKG A;  2KKP A;  4RT3 A;  3UMG A;  1U47 A;  3CYM A;  1DXS A;  4K4I A;  3TFR A;  3EYZ A;  4YFK A;  2K60 A;  1ZQO A;  1WG8 A;  1ZQZ A;  1Y88 A;  1N60 A;  4KN4 A;  2W43 A;  2ZTC A;  5DG8 A;  2RQ5 A;  4J03 A;  4P4P A;  5KG5 A;  3UM9 A;  1TKD A;  1QSS A;  4P4M A;  2VAN A;  4GXJ A;  1ZQF A;  3A0H U;  4I29 A;  3SI8 A;  3EPI A;  1KBU A;  2R8K A;  4ECR A;  2AGP A;  2HOF A;  3Q8L A;  3C28 A;  1RQN A;  1DK3 A;  5HML A;  4DS5 A;  1L7P A;  1TVA A;  3M1Y A;  5III A;  4ELU A;  4HAI A;  2F2A B;  1ZQN A;  4PPX A;  2F1J A;  3KBB A;  4ECX A;  2YMQ A;  4R65 A;  4CF5 A;  2NRT A;  3LK9 A;  1OUQ A;  2RDJ A;  2W55 A;  4TUS A;  2W8K A;  4P0P A;  1D8B A;  2LBO A;  2XY5 A;  2LMR A;  2W7P A;  3RB3 A;  4J9L A;  2ZG6 A;  1PUZ A;  2XGP A;  2RLT A;  4ECZ A;  5EE0 A;  1HJP A;  9ICG A;  5C5J A;  1ZQQ A;  3DDH A;  9ICN A;  1X6I A;  4IS7 A;  5IIN A;  4UQG A;  2Q4T A;  1JIH A;  2BDP A;  4YG2 A;  4CF4 A;  1QH9 A;  4EEN A;  1L8O A;  4EX7 A;  1KW4 A;  1RQL A;  2JV3 A;  3V6K A;  3HW8 A;  4UAZ A;  4QWE A;  4MFA A;  4QZI A;  2KIW A;  4ZH4 A;  1WUD A;  4GXK A;  2PFP A;  9ICO A;  3IHQ B;  2QAR A;  2ZJ8 A;  3BZC A;  5HR7 A;  3H0M B;  2HHV A;  4GC6 A;  4ECY A;  3SV4 A;  4DL2 A;  2KJ9 A;  1Z1B A;  3SEI A;  4KTQ A;  3LYS A;  4ED2 A;  3V7J A;  5H2F U;  3Q8M A;  1ZQA A;  3IN5 A;  5KFF A;  4FS2 A;  4J9Q A;  4B9V A;  1ZQE A;  1ZQC A;  5KFP A;  2I5H A;  4JMU A;  2AQ4 A;  9ICU A;  3RJH A;  4Z6D A;  1GO3 F;  4GXI A;  1BNP A;  1N56 A;  1Z3E B;  5HHH A;  4J9O A;  2YQE A;  5EWF A;  3SAH A;  8ICK A;  4Y2R A;  3RFA A;  5TZV A;  3PML A;  1X40 A;  5KFW A;  4US8 A;  3N4M B;  3HIL A;  3MR5 A;  2MUT A;  2JGA A;  5ALZ A;  3K1Z A;  4KMO B;  5KG1 A;  1KRP A;  3GFK B;  2O6K A;  4OJ5 A;  3CNH A;  1ZQD A;  4KLG A;  5KL1 B;  2E1F A;  1SXD A;  3RAQ A;  5KFQ A;  5JTI A;  4MF2 A;  2WAQ F;  3KZX A;  4EYH B;  3EWA A;  2EZX A;  1DK2 A;  4I27 A;  3OSN A;  3FDS A;  3I28 A;  3RBD A;  2M0N A;  5DB9 A;  3E58 A;  4QZC A;  4X5V A;  1U45 A;  4FFD A;  3E2E A;  2K8B B;  2ZIW A;  1ZQL A;  2DFL A;  3Q8P B;  2XGQ A;  4F50 A;  5ALE A;  2J6U A;  3PSP A;  4F71 A;  8ICA A;  3GIJ A;  3LVV A;  4ED7 A;  1ZYQ A;  2PFO A;  5ALP A;  5TIS U;  1CEZ A;  1VJ5 A;  5HP4 A;  3KHR A;  4F3O A;  4ICA A;  1PK1 A;  2WFA A;  4F92 B;  1M6Y A;  4UAT A;  1UA0 A;  8ICP A;  5EE9 A;  3UMC A;  1PK3 A;  4P0P B;  1ZD4 A;  3QZ8 A;  4DF4 A;  1KTQ A;  4M6W A;  1DRG A;  4ED8 A;  1OXJ A;  3G6X A;  5CHG A;  3GDX A;  4QZH A;  1LV5 A;  2IOF K;  5EWG A;  9ICB A;  3NVY A;  1SL2 A;  2JH1 A;  1XNS A;  4JV2 A;  4LVS A;  2F8K A;  5DQH A;  3QU4 A;  4ACO A;  4KLT A;  4Z6E A;  4RQM A;  2FPK A;  2PI5 A;  1NK5 A;  4Y2X A;  2QAR B;  2BQU A;  1ZQG A;  2BPC A;  1JUD A;  5E79 U;  4YD1 A;  2FMS A;  9ICT A;  2Y9T A;  4YCX A;  2OWO A;  3PSI A;  3PR5 B;  5AKJ A;  1SKR A;  2B21 A;  3HJE A;  4IRK A;  1T94 A;  2KHQ A;  5IIJ A;  3RJF A;  4KLI A;  2JHD A;  5A0L A;  3TI0 A;  4DL7 A;  5F9L A;  4RQN A;  2BPF A;  3NVW A;  3C2L A;  7ICM A;  4TUP A;  3PO4 A;  5AK3 A;  2E8M A;  2KIC A;  4MF8 A;  4O3O A;  4QZD A;  2LYB A;  2MUT B;  2KG5 A;  4UB6 U;  3EPG A;  4Q44 A;  1ZD2 P;  3TAP A;  4NY8 A;  2XY6 A;  3AN1 A;  2W54 A;  4YR0 A;  2D8C A;  5IIO A;  2VA2 A;  4P0Q A;  1ZQS A;  2G0A A;  5AKZ A;  2JEI A;  4IR1 A;  4F5R A;  2LHT A;  5CR0 A;  3ONN A;  3JPR A;  4IQV A;  1N5W A;  4J9M A;  1L3T A;  1CRX A;  4O5E A;  3AM9 A;  1Q8K A;  3GIK A;  1L3V A;  2LYA A;  3ZDC A;  3PW0 A;  1XO0 A;  2RDI A;  2ZIW B;  5KFB A;  1ZQW A;  3O0F A;  1NK4 A;  1NJY A;  3C5G A;  2K89 A;  2ASL A;  4DQS A;  2BKE A;  1HIW A;  2NYV A;  5ALT A;  4UB4 A;  3VCB A;  4KLE A;  3G6Y A;  4NLK A;  2JZB A;  4O3M A;  4O3Q A;  3ZDE A;  5KAI U;  5DB7 A;  5ALW A;  3PX6 A;  2CPR A;  4NLN A;  3L5K A;  2DWQ A;  1F44 A;  3T5J A;  2C28 A;  3PNC A;  4BUG A;  5KFO A;  3C5F A;  5KFM A;  1PK1 B;  5ALO A;  3ZDB A;  7ICE A;  1S97 A;  3ORY A;  2G07 A;  2JEG A;  2P35 A;  2FMP A;  9ICK A;  1BPY A;  4C8O A;  3V7K A;  3GIL A;  4QZE A;  2KOB A;  5L1K A;  5KFG A;  3LWL A;  1BGX T;  4M6W B;  2BZF A;  1ZOL A;  3K1R B;  8ICX A;  5D4B A;  5KAF U;  2JEJ A;  4ELV A;  5J2I A;  2WHE A;  1KQQ A;  4F5N A;  1N61 A;  1KEJ A;  3QUB A;  4DQP A;  2H3Z A;  5CEH A;  8ICQ A;  3QX7 A;  3UPQ A;  4DQR A;  3WKA A;  3MDC A;  2BPG A;  5DG9 A;  5KT5 A;  3PR4 A;  4A8E A;  4KLS A;  4O5K A;  3HP6 A;  4NL9 A;  2H3V A;  3MFI A;  2ZXH A;  1U9L A;  3KHG A;  4Q45 A;  4Q8F A;  3AL0 B;  3H4B A;  2HSZ A;  1A0P A;  3QYP A;  3NRZ A;  5KG7 A;  4RU9 A;  3OTQ A;  2ISO A;  1MQ2 A;  4C8L A;  9ICJ A;  3RJI A;  3G6V A;  1L8L A;  1D8L A;  1NK6 A;  3QEB Z;  4BWM A;  7ICF A;  4ECS A;  1ZQR A;  2R8G A;  5ALI A;  4M47 A;  3F53 A;  3RB0 A;  4F4K A;  3RRH A;  1RG6 A;  2UVR A;  2I1Q A;  5JUM A;  1V38 A;  3HPO A;  4DL6 A;  2OCE A;  5KT6 A;  4NLC A;  4KLD A;  2PFQ A;  7ICT A;  1NKE A;  3TFS A;  2NRX A;  4QZB A;  4JK1 A;  5DGA A;  3RRG A;  7ICR A;  4RQ0 A;  1SKW A;  2W04 A;  4NLB A;  4P0Q B;  7ICG A;  9ICW A;  3L4P A;  2YTU A;  5J8Y A;  2KFZ A;  2W9C B;  2BQ3 A;  1KDH A;  2FLP A;  3RBE A;  4GIB A;  2F44 A;  4ED3 A;  1K5O A;  5ALS A;  4AYB C;  4UBC A;  3KFU F;  7ICH A;  5AI5 A;  2ZTE A;  4RQ4 A;  3N7R C;  3F2D A;  4GFJ A;  3SD7 A;  5BPC A;  5J2F A;  5DQI A;  3E0F A;  1U49 A;  1TAM A;  4UB8 U;  8ICM A;  1VDV A;  4DFK A;  4MEY A;  5ALM A;  2VA8 A;  3QNM A;  1B4F A;  4NL9 C;  2JZB B;  3D6J A;  3OSP A;  2EZY A;  1UPH A;  2XID A;  1ZD5 A;  2HBJ A;  2EAM A;  4DSL A;  4CNQ A;  4CDG A;  1QLN A;  5KNI A;  2JXJ A;  1ZJM A;  2E1E A;  2KZM A;  4RNM A;  2HHU A;  7ICS A;  2LI6 A;  2LM1 A;  1ZQH A;  4KLQ A;  5J2H A;  5AKY A;  3CP8 A;  3WU2 U;  1X2I A;  2DL0 A;  7ICK A;  1X6J A;  3B0X A;  1F5S A;  3KZI U;  2G5I B;  3JPP A;  3B9J A;  1RYS A;  3TAC B;  9ICA A;  4DSE A;  3PX0 A;  2EZZ A;  3WKB A;  3M9O B;  1NJX A;  1XC9 A;  4ECU A;  5ALH A;  4K4G A;  3HWT A;  1Z4N A;  3C23 A;  1COK A;  4KLF A;  1ZQB A;  1BPD A;  3NTU A;  4YR3 A;  4DF8 A;  5B5E U;  1FIQ A;  2MA1 A;  8ICL A;  5J8Y C;  4YXJ A;  2KKV A;  1ZQV A;  4FZN A;  3M8S A;  2PXI A;  4YN4 A;  3I76 A;  4C7Y A;  1SGG A;  1A76 A;  1ZRM A;  2RRD A;  2HOQ A;  1O03 A;  3PST A;  1Z19 A;  5DLF A;  3SZ2 A;  1TFR A;  3TAR A;  2Y0S C;  3C21 A;  3KD3 A;  1UQV A;  4RUC A;  4F93 B;  3MDA A;  1ARO P;  2QB0 A;  1S0O A;  1XU4 A;  4NLZ A;  4QJF B;  3PMN A;  2KHV A;  3JPS A;  4O9M A;  3GZF A;  1RPL A;  5KT4 A;  3CRX A;  2WF6 A;  4KLJ A;  1K1S A;  1URJ A;  1SWV A;  4DLE A;  1N5X A;  1N48 A;  2H3F A;  3H0L B;  7ICL A;  2HCF A;  9ICP A;  3C2K A;  1SIJ A;  2NRW A;  1S9F A;  3QUT A;  5JU5 A;  4J9K A;  2ZIU A;  9ICE A;  3FYH A;  4OJP A;  2DPJ A;  3PW7 A;  5DBA A;  4RQ2 A;  1BPB A;  7ICI A;  7ICQ A;  1JI7 A;  4B9N A;  2W03 A;  8ICV A;  4BXO A;  3MR2 A;  2E8N A;  4DOC A;  4ED0 A;  4NLG A;  3VC8 A;  1ZQT A;  1QQ6 A;  3GV5 B;  4PHE A;  4UB2 A;  3JPT A;  4DL5 A;  4TQR A;  2DPI A;  1ZQU A;  8ICI A;  1TK0 A;  3SAF A;  4I2A A;  4YD2 A;  3UQ0 A;  2OEH A;  4RQ7 A;  4DFM A;  4UW9 A;  4LJX A;  3EW9 A;  2EAO A;  4US9 A;  3SR6 A;  2I6X A;  8ICE A;  4FE3 A;  2DF4 B;  3GV8 B;  4C4S A;  4JV1 A;  4QWC A;  5KFU A;  1DGS A;  5J0R A;  4IRC A;  4RNO A;  2IMW P;  1XS9 D;  2W9A A;  8ICJ A;  3TAN A;  3WKE A;  5L1J A;  4DL3 A;  2WF9 A;  5CJ7 A;  7ICJ A;  3H0R B;  1ZET A;  1A6S A;  2WTF A;  5J2A A;  2JH7 A;  2HOI A;  2YY6 A;  3AQE A;  3DV9 A;  8ICN A;  5DQG A;  1P7D A;  1X42 A;  1T3N A;  4F5O A;  3ISC A;  1TE2 A;  2F76 X;  4C8N A;  4F72 A;  4DEZ A;  2M9N A;  4JB3 A;  1ED1 A;  3ETR A;  5KFI A;  1WCL A;  2RHF A;  5AI6 A;  1XSP A;  5AK5 A;  5DBC A;  4KLM A;  4DSJ A;  1TAQ A;  1TAU A;  1H38 A;  2K8A A;  1K1Q A;  5ALN A;  5J0Q A;  4YQW A;  5L9X A;  1YZ6 A;  2OYY A;  4I2C A;  4OD0 A;  5ALU A;  4J9P A;  5B66 U;  1Z00 A;  5DBB A;  5HR6 A;  1RDF A;  4AYB F;  3V6J A;  1L7N A;  4OJO A;  2K4H A;  4YMM A;  3GII A;  1UCV A;  5ALY A;  2QB0 B;  2Y1I A;  5J2J A;  4RT2 A;  4KLL A;  3IM1 A;  5JRT A;  4B9M A;  3OPX A;  4DLG A;  4QZF A;  3RR8 A;  4EBD A;  4Y2Y A;  4LZG A;  2IOH A;  2ZIU B;  4PGX A;  2F1H A;  3F2B A;  8ICU A;  2GO7 A;  2ODG A;  1L5U A;  3QEA Z;  5F3X B;  4Y2P A;  4Y2Q A;  2VKQ A;  2XY7 A;  8ICS A;  4UAV A;  2ALZ A;  4RNN A;  5DB6 A;  4BXO B;  4UAU A;  4TUQ A;  1NK8 A;  2FPL A;  3BQ2 A;  5AM4 A;  2ESE A;  8ICC A;  1CUK A;  1ZQI A;  3N7P D;  1HEK A;  2KMD A;  2KD1 A;  1SWW A;  3DEE A;  4UAS A;  4RPZ A;  3JPQ A;  2IHN A;  3BDP A;  2A1A A;  1VLB A;  5G5H A;  4EBC A;  1EXN A;  7ICN A;  2N1R A;  5ALF A;  4UAW A;  4P2H A;  1V9P A;  2GLE A;  1ZQM A;  5AKI A;  3MR3 A;  4J9R A;  4QZ9 A;  1S77 D;  3NVV A;  5AK6 A;  1SL0 A;  1IIP A;  5J0P A;  4O0I A;  4JV0 A;  5KT7 A;  1BNO A;  2V4Q A;  1QQ7 A;  3M7D A;  1IM4 A;  2KK0 A;  1SB3 C;  3ZD8 A;  2CN1 A;  5J0S A;  1S0N A;  2DQN B;  4CRX A;  1LKY A;  1NJZ A;  2XO7 A;  1JXE A;  2AGO A;  3N7S C;  5CA7 A;  2HDO A;  5DLG A;  2F8L A;  3BQ1 A;  2HHQ A;  2ES6 A;  3RJE A;  2KJ5 A;  3K75 D;  3KOO A;  4DO9 A;  1PVP A;  1Q3U A;  2Y0S F;  2W9M A;  4GLX A;  1QCK A;  4EEK A;  4PZO A;  5BOL A;  4NWI A;  3V7L A;  8ICY A;  4IQT A;  2PMZ C;  5AI0 A;  1L7M A;  5AM0 A;  4NM2 A;  1PZN A;  3WK7 A;  4FBU A;  4YP3 A;  1N2X A;  5KFK A;  4I28 A;  1S5L U;  4KIT B;  4DFD A;  1ZJN A;  1IG6 A;  1NJW A;  4DQQ A;  4Q43 A;  2W9C A;  1Z4O A;  1NKB A;  2XVT A;  1WYG A;  3H4D A;  3AEV A;  1RYR A;  5AKX A;  1WWV A;  1Z00 B;  2G06 A;  9ICX A;  2H3Q A;  1UT5 A;  2YN4 A;  3WK4 A;  5KT3 A;  3IG8 A;  5ALV A;  5G5G A;  4YMN A;  4DSF A;  9ICI A;  4PGY A;  1TV9 A;  8ICW A;  9ICC A;  2ASD A;  3SYZ A;  4KX3 A;  4QWA A;  2HMX A;  2FI1 A;  4J9S A;  2EQY A;  1CI4 A;  1F0M A;  5FP0 A;  2QB1 A;  3Q8S B;  2R8J A;  1S76 D;  2OHF A;  1X66 A;  4QZA A;  4RPX A;  2P6R A;  3L3F X;  4BJQ A;  4I2E A;  4DFP A;  1X9W A;  1U48 A;  3NS1 A;  5EE1 A;  2V4R A;  1IXR A;  3GIM A;  3NRW A;  4QW9 A;  4CCH A;  2K8C B;  2DKZ A;  4DOA A;  2C2R A;  3ICX A;  8ICG A;  2C22 A;  4GC7 A;  1RXW A;  2W11 A;  3QUC A;  2MAX A;  3IRU A;  5J0Y A;  4R8U A;  2BHN A;  3NVZ A;  1ZXI A;  5KG4 A;  1YZ7 A;  3RH5 A;  4I2G A;  4B9S A;  3C29 A;  4QZ8 A;  3QXG A;  2AHO B;  5IIL A;  9ICL A;  2KVC A;  5J2C A;  3ZI4 A;  3TAQ A;  5AM5 A;  2Z7J A;  2FLN A;  2NRZ A;  3BQT A;  5KFR A;  2KZ3 A;  1LKY B;  2QKQ A;  4CE6 A;  4KMU A;  4YMO A;  5KG0 A;  2BDU A;  5C0Y A;  4R63 A;  4K4H A;  3KTQ A;  1UT8 A;  3SV3 A;  5HMM A;  1XSL A;  3HKZ C;  3TQ1 A;  4HYK A;  1T8E A;  1JAL A;  4IQU A;  5AI8 A;  5ALL A;  5AKL A;  1KL9 A;  2Q0Z X;  4AP9 A;  2HVI A;  5J29 A;  1V85 A;  4BX9 C;  2LYH A;  2WF5 A;  2F77 X;  2VA3 A;  3WK9 A;  4IL6 U;  3UQ2 A;  1YT3 A;  4R66 A;  3OJU A;  4E0D A;  2XIC A;  4ED6 A;  4UAR A;  4EZ6 A;  5KFN A;  3SMV A;  5AM3 A;  4F8R A;  3H7I A;  3RR7 A;  2LPE A;  4DWI A;  4MEX A;  4PHA A;  5J2G A;  2IHM A;  2UVU A;  9ICF A;  4B9L A;  2XC9 A;  2HBK A;  1X9X A;  2E8P A;  3M9N B;  4UBB A;  4I2J A;  2BCV A;  5DDM A;  2OXO A;  1ZD3 A;  2KE7 A;  2YMM A;  2OH2 A;  3T3F A;  2A3V A;  4M9L A;  1FFV A;  2KP7 A;  1QSL A;  2P66 A;  5DB8 A;  1BVS A;  3AU6 A;  2FPM A;  2H3I A;  1T7P A;  4IRD A;  1KLN A;  2LM4 A;  4F4Z A;  2VJ4 A;  3RH4 A;  5AIB A;  3IDW A;  4M0A A;  2F3N A;  2HHW A;  5J2D A;  4ECT A;  4PHD A;  1PVQ A;  1KFT A;  4FZL A;  1RYU A;  4RQ6 A;  2YX8 A;  4LZD A;  1D9F A;  1C20 A;  4RZR A;  4C80 A;  2DKX A;  3EUB 2;  2G08 A;  4NV0 A;  4I2D A;  5L1M A;  2BGW A;  3HX0 A;  4EYI B;  3LVW A;  5J2K A;  2GOL A;  1S0V A;  2HBM A;  5J2E A;  1NI3 A;  2HW3 A;  1HUZ A;  1NNL A;  4IC9 A;  2KTQ A;  2EDU A;  5KT2 A;  3C1Y A;  2ZIV A;  2D3D A;  5J0W A;  2L5Y A;  3GU3 A;  3AMZ A;  2R8I A;  4R8U B;  4ECQ A;  1SV0 A;  1PVR A;  5ALQ A;  4M9N A;  4I2H A;  4USA A;  1L3U A;  4UB3 A;  5KFS A;  3D2S A;  4EBE A;  2MRL A;  5L1L A;  3RJK A;  4CF3 A;  4KLU A;  1N63 A;  3A0B U;  3IP4 B;  4MFF A;  4ECV A;  5AKK A;  1KKX A;  1LB2 B;  1FEZ A;  4F2S A;  1SKS A;  1JMS A;  2LKY A;  5KL8 B;  5D46 A;  2K4P A;  5AM2 A;  3S6J A;  5CP2 A;  3FC4 A;  5K4L A;  2KEY A;  1QTM A;  2YML A;  1DGJ A;  4MFC A;  2BCS A;  3MC1 A;  1UHU A;  3H40 A;  1XSN A;  3UMB A;  4NM1 A;  5DDY A;  3PO5 A;  4XUS A;  9ICV A;  8ICO A;  4U7C A;  4BGD A;  5AHX A;  5GTH U;  2VJ5 A;  2W3R A;  5ALX A;  1J2M A;  4B6J A;  3RTV A;  1SXE A;  2NO5 A;  4PZN A;  1ECW A;  1BPX A;  3LDA A;  3KKA A;  1NKC A;  8ICR A;  3F5E A;  5KG2 A;  3T5H A;  5KFT A;  2ZUC A;  5AIA A;  2K4E A;  4QWB A;  4FBT A;  3GV7 B;  3RAX A;  4YVZ A;  3LWM A;  2ASJ A;  3M9M B;  4OJ6 A;  1QSY A;  1B43 A;  4C4R A;  2YB1 A;  5DG7 A;  2B6G A;  3BQ7 A;  3U26 A;  5DGB A;  3RB6 A;  1SV0 C;  3BJY A;  2FMQ A;  3D2Q A;  2C2E A;  5AKH A;  2DBY A;  3M8R A;  4PHP A;  2QLT A;  3WKC A;  1NOM A;  1NK9 A;  2BQR A;  2ATL A;  4KX5 A;  4I2B A;  2WF8 A;  5HNK A;  2BCU A;  4XA5 A;  4WJ3 B;  2JRZ A;  3TKA A;  3OHB A;  4QNL A;  4PGQ A;  3ETL A;  3QU9 A;  3SAG A;  2AU0 A;  3T5K A;  4TQS A;  1T4G A;  3HKZ F;  1S10 A;  2XCA A;  2A19 A;  1BPE A;  4NJ8 A;  2ZIV B;  1X9M A;  1KFS A;  4G9B A;  1LVH A;  1D9D A;  1TK5 A;  4QWD A;  2PFN A;  4F5P A;  1ZQX A;  4O3S A;  3CW2 C;  3HT3 A;  2FE9 A;  3D2N A;  2KFN A;  3B0Y A;  3JPO A;  5KTQ A;  3ISB A;  2JEF A;  4QIW C;  4Z6F A;  1COO A;  3KKA C;  2ZXI A;  2FLL A;  2UVW A;  3NUQ A;  3F5A A;  3OJS A;  1O08 A;  3IV6 A;  3ISD A;  4Q8E A;  2KN7 A;  3UXP A;  4YR2 A;  2HHX A;  2JR5 A;  4DCC A;  1SL1 A;  2AXT U;  3H8J A;  5EWE A;  1DOQ A;  4M9H A;  4EZ9 A;  2PKE A;  2GH1 A;  3WKD A;  2AGQ A;  2IBK A;  1IV8 A;  1V97 A;  2KJ8 A;  5KFL A;  2IOF A;  4RPY A;  2HBL A;  1RM6 C;  4IQW A;  1FFU A;  3QU2 A;  2R8H A;  7ICO A;  2C2D A;  2E8O A;  5ALG A;  2EAN A;  3BQ0 A;  5KFX A;  3KHL A;  5D49 A;  3WK5 A;  2KV2 A;  3QU5 A;  1ZQP A;  4O5C A;  9ICQ A;  3BZK A;  2Y1J A;  5BOM A;  5EOZ A;  2E5S A;  4EX6 A;  2KSO A;  1SV4 A;  3J81 j;  3ZD9 A;  5KG3 A;  1ZQY A;  4Y2V A;  4JWM A;  2VIX A;  3QZ7 A;  1JX4 A;  1S8O A;  2WB1 C;  1MSW D;  2HI0 A;  3RJG A;  3I1Y A;  2G09 A;  5L1I A;  1JXL A;  3PZP A;  3RF9 A;  4DOB A;  1Z1V A;  3AUO A;  2KIV A;  4PL2 A;  5KFZ A;  4ZOH C;  4DQI A;  5EE3 A;  1T3Q A;  2B0C A;  8ICH A;  5KG6 A;  3PW2 A;  2MSN A;  2ZJA A;  3ZDA A;  1ZQ1 C;  2F1I A;  2P6U A;  3MAB A;  4EEY A;  2DGZ A;  2IA6 A;  1MN8 A;  4C8M A;  4O3R A;  3WK8 A;  3NAS A;  2ZIX A;  1SZH A;  3PX4 A;  3H8S A;  2R18 A;  4PL1 A;  5AI9 A;  5KFE A;  1XO1 A;  1KSP A;  1RZT A;  9ICR A;  4ECW A;  3F2C A;  3SEN A;  2EH9 A;  3RJJ A;  2BCR A;  4BWJ A;  2E3T A;  3N97 B;  5CB1 A;  1MC8 A;  4B9U A;  4RUA A;  2ZJ5 A;  2HHS A;  4BDP A;  4F4Y A;  4EEL A;  4U6P A;  1FO4 A;  3EZ5 A;  2UVV A;  7ICP A;  1NK7 A;  2I9G A;  5DKW A;  4F2R A;  2ZUD A;  4I2F A;  5KFY A;  4ED1 A;  1WWU A;  2GWS A;  1SZP A;  4QW8 A;  1OW5 A;  1Q3V A;  4NXZ A;  3MGV A;  2FDR A;  1S0M A;  1N62 A;  4Z6C A;  5AK4 A;  2W8L A;  4C4T A;  4KLO A;  2A1J A;  3M6Z A;  3SQI A;  2BR0 A;  3MBY A;  2W9B A;  4RQ1 A;  3H8M A;  5KFJ A;  3HRD D;  1Q46 A;  4P4O A;  2KZZ A;  4C0Z A;  4Y2J A;  3V72 A;  4C7Z A;  3PY8 A;  1ZRN A;  4YXM A;  4B9T A;  1J2N A;  5ALR A;  5ALK A;  2NV3 A;  3R9K A;  2ZTD A;  5KFD A;  7ICU A;  1RXV A;  2WF7 A;  2AH5 A;  2HHT A;  2KSO B;  1C7Y A;  4DFJ A;  3TAD A;  4M2Y A;  5F9N A;  4DSI A;  5GTI U;  3BS5 A;  2FJ6 A;  3PVX A;  5HHI A;  2XI9 A;  1NK0 A;  4Y2U A;  5J0O A;  4C8K A;  4ELT A;  4FS1 A;  4UB5 A;  4OO1 J;  2XCP A;  3C2M A;  4CGZ A;  5ALJ A;  2CRX A;  1JRO A;  5T14 A;  4XQ8 A;  3PW4 A;  1BPZ A;  2H5X A;  1D8Y A;  1AQ6 A;  3FAH A;  5IIK A;  3H8W A;  5J2B A;  3BS7 A;  3JPN A;  3ED5 A;  1XWL A;  4QZG A;  4QIW F;  4MHV A;  4O3N A;  3OGU A;  4IR9 A;  8ICB A;  4JWN A;  3AU2 A;  4O3P A;  1L6N A;  4Y2S A;  5KFV A;  4XRH A;  4F5Q A;  3UXO A;  4PJ0 U;  4M9J A;  2KVS A;  2ZIX B;  3MGH A;  4KN7 A;  4OJL A;  1B22 A;  3IG5 A;  1U4B A;  1KN5 A;  3QUQ A;  1ZQK A;  4F4X A;  7ICV A;  4JUZ A;  1KFD A;  3RB4 A;  5J0U A;  9ICH A;  5KFA A;  2RP5 A;  2YB4 A;  2KNJ A;  4I2I A;  9ICS A;  4RQ8 A;  3M6K A;  2W7O A;  3V6H A;  1JRP A;  2BCQ A;  1WCN A;  2ZUB A;  2V9W A;  4KLH A;  3TAD C;  3GQC A;  1TK8 A;  2Y9U A;  2WAQ C;  3T79 A;  5AIC A;  4FZM A;  2G5H B;  4FO6 A;  2PI4 A;  3T5L A;  3MR6 A;  3PV8 A; 
#chains in the Genus database with same CATH homology
 1XO0 A;  4NV0 A;  3F5E A;  1DRG A;  2ZIW B;  2ZIX A;  3O0F A;  2BDU A;  2K4E A;  3AQF A;  4JMU A;  1SZH A;  3LVW A;  4NLC A;  5C0Y A;  1GO3 F;  2K89 A;  2GH1 A;  2R18 A;  4PL1 A;  2GOL A;  2ZIU B;  4FE3 A;  2XI9 A;  3PSF A;  1KBU A;  1HIW A;  3F2B A;  2DF4 B;  2HBM A;  4OJ6 A;  3HKZ C;  3VCB A;  3F2C A;  2MA1 A;  3SAH A;  2XVT A;  2YB1 A;  3RFA A;  2KJ8 A;  4O3M A;  2VKQ A;  4IC9 A;  4OO1 J;  2HOF A;  2KKV A;  2JH1 A;  4FZN A;  3C28 A;  1XNS A;  4CGZ A;  4ACO A;  2CPR A;  2CRX A;  2W04 A;  2JGA A;  2RRD A;  2HOQ A;  2WB1 F;  2ZIV A;  4NLB A;  1F44 A;  2HBL A;  3D2Q A;  5T14 A;  4P0Q B;  3K1Z A;  3GU3 A;  3PST A;  4KMO B;  4U6P A;  1Z19 A;  4BUG A;  2G06 A;  3N7P D;  4BX9 C;  1HEK A;  2F2A B;  2H3Q A;  2KD1 A;  3DEE A;  3ALR A;  2G07 A;  2Y0S C;  3IG8 A;  4AYB C;  2F77 X;  3KFU F;  4OJ5 A;  1PVR A;  2N1R A;  2JMG A;  3H0R B;  2KV2 A;  5KL1 B;  2E1F A;  4QIW F;  1A6S A;  1YT3 A;  3PSI A;  3N7R C;  3F2D A;  4GFJ A;  3D2S A;  2JH7 A;  2XIC A;  4KX5 A;  1NZB A;  2HOI A;  2KOB A;  4KX3 A;  2OM6 A;  2WAQ F;  1OUQ A;  1L6N A;  3KZX A;  3SMV A;  1IIP A;  2MRL A;  3AQE A;  2W7O A;  3E0F A;  1T94 A;  2HMX A;  2KHQ A;  1TAM A;  1Q3V A;  2K4I A;  1P7D A;  4P0P A;  1D8B A;  2LBO A;  2ZIX B;  2W7P A;  3M7D A;  2E5S A;  4QJF B;  2JHD A;  5A0L A;  3MGV A;  2KHV A;  2M0N A;  4WJ3 B;  3GZF A;  2F76 X;  2ZG6 A;  4OJL A;  3IP4 B;  2CN1 A;  3IG5 A;  3CRX A;  1URJ A;  2HBK A;  4QNL A;  2H3F A;  2DQN B;  3SAG A;  4CRX A;  2K8B B;  2ZIW A;  2H3Z A;  2OXO A;  1MA7 A;  3H0L B;  1ED1 A;  2LKY A;  2OH2 A;  2KIC A;  3HKZ F;  2D6F C;  2A3V A;  1UPH A;  2XID A;  2ZIU A;  5KL8 B;  2RHF A;  3M6Z A;  3N7S C;  2HBJ A;  4OJP A;  3SQI A;  2LYB A;  2VIX A;  2Q4T A;  2ZIV B;  3PSP A;  3L3F X;  4A8E A;  2F8L A;  4BJQ A;  4CDG A;  2H3V A;  2PMZ F;  2E1E A;  2ZXH A;  2KJ5 A;  3LVV A;  2KEY A;  3NRW A;  2K8A A;  2WB1 C;  2RP5 A;  2H3I A;  2YB4 A;  5CRX A;  4C0Z A;  2W03 A;  2KNJ A;  2K8C B;  2KKP A;  2OYY A;  2VJ4 A;  2G09 A;  1PVP A;  3AL0 B;  3CYM A;  1Q3U A;  3M6K A;  2KIW A;  3ICX A;  3D2N A;  4P0Q A;  1A0P A;  2G0A A;  3VC8 A;  1WUD A;  2Y0S F;  3RF9 A;  3PZP A;  3CP8 A;  5HR6 A;  4ICA A;  4AYB F;  4U7C A;  4PL2 A;  4OJO A;  2K4H A;  2VJ5 A;  4QIW C;  2LHT A;  2NV3 A;  5HR7 A;  3H0M B;  4NWI A;  3SAF A;  2G5I B;  3ONN A;  2KJ9 A;  1Z1B A;  2ZXI A;  3C29 A;  1PVQ A;  2WAQ C;  3LYS A;  4FZL A;  2KVC A;  2PMZ C;  3NUQ A;  3T79 A;  4P0P B;  2YX8 A;  1ZQ1 C;  2G5H B;  3F5A A;  4FZM A;  1CRX A;  1ECW A;  3F53 A;  2Z7J A;  3IN5 A;  2DGZ A;  2G08 A;  2LYA A;  3OPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...