2JMKA

Solution structure of ta0956
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
110
Chain Sequence
b'MTLCAMYNISMAGSHPTTICVVMDRFLESFSELYDIIDENDTDVMMDFISRFARTDEIMPEDKTVGFVVVNADKKLMSVSFSDIDENMKKVIKATAEKFKNKGFKVETDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Ta0956
molecule tags Protein binding
source organism Thermoplasma acidophilum
publication title Solution structure of the hypothetical novel-fold protein TA0956 from Thermoplasma acidophilum
pubmed doi rcsb
total genus 25
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11513 TA0956 Thermoplasma acidophilum protein TA0956
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1010 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2jmkA00
2K24A 2JMKA
chains in the Genus database with same CATH superfamily
2CCQA 2J62A 5HEHA 3UQ7A 2UUBT 1FIOA 1J5WA 1XDOA 3N9MA 1U4QA 2YKSA 4U3CA 3AAEB 1J1JA 3N2OA 4DO0A 4JYAT 4QX7B 4KHZF 5L3GB 1US7B 4E7ZA 4IE0A 5ABFA 2L8KA 2C5IT 1O3XA 4PJNA 1Y01A 4P09A 1UK5A 3NRXA 1IJ6A 2VL0A 3QC9A 4UF0B 4HTEA 3EVYA 3AEFA 3AE7A 5AQIB 3OTOT 2WAUA 3QUJA 5F5WA 2XQYA 5JDMA 2LHNA 4OK0A 2YINA 2WDVA 4H9RC 4O2BE 4YJ3E 5JR9B 5LHGB 4DUYT 3LBXA 4H9QC 5LCYA 2HPJA 3RGLA 3VR9A 4JI5T 1SA0E 2UXBT 2V1DB 4DV5T 3Q5DA 5IYZE 1T8BA 2BKNA 4CN4A 5JRCB 5FY7A 2XAFB 4YT0A 1BR1A 4LF8T 2YDRA 1U5PA 4AXPA 1JNZA 2CA5A 2V7LA 3ESLA 3UQ4A 4KMCA 3ZPOA 3CQCB 1E7PA 4TV9E 5HXEA 2X68A 4EXTA 3CK6A 3OVUA 1D1AA 5LMUT 4X65T 4C91A 3J9X1 5TAOA 3KFWX 3PE0A 3UU4A 4NPPA 2ZLYA 3O1HA 2PBIA 2FJDA 3IBPA 5FP3A 4H9PC 4AKHA 4JEUB 2X9WA 3CX8B 1Z0PA 2JRKA 4UELA 4CI3B 4IHJE 4OHFA 1HNZT 2I59A 3RYHE 3PUAA 4AKRB 2VK9A 4PK4A 1ZV4X 1N32T 1DU2A 2LEHA 4X5TA 1JNRA 2Q9QD 3ZMZB 5L47A 1WR6A 3ZC1A 2Y6XA 1SHZC 3FB2A 4A5XA 5AFUL 4YSZA 4JLEA 4DR7T 2NR4A 5ABFB 3MXZA 4ZS3A 4MALA 4TWHA 1D0ZA 1MNDA 4YTNA 4YY3T 4JI0T 3P4WA 1ZOYA 2PG8A 5DQVA 3RKGA 2Z6EA 3N5LA 1I6ZA 4COFA 1OEDA 2A9UA 4LF4T 3P4RA 4CXXA 3GWHA 3OYZA 4EGWA 3A8YC 1M62A 2Q9QA 3P4SA 5ABHA 1WFDA 2QYWA 2WWVA 3ZKRA 2KNDA 4EV6A 4DR4T 3AECA 4EYUA 1VCTA 4QWNB 5AQMB 2W4XA 2KT9A 3OJAA 5HEUA 3RYCE 4CN6A 4ZI2C 3ZC0A 2C5KT 2LSGA 3GMIA 3H37A 3MJXA 3UULA 3NRYA 2VB6A 1MNEA 1YW0A 4UV8B 4GOUA 3N9NA 2VASA 3AEGA 4Q25A 1ZP0A 5FL0A 3K3OA 5A1LA 4NXMT 4ASKA 2XAQB 4GYSA 2XSAA 5FY0A 3A5XA 5JVDE 4ILAA 2WZIA 4E7SA 3JC6D 2UXXB 1IZNB 2MOZA 1UGOA 1VRBA 2DWKA 3I0QA 4QXHB 4O4HE 2ACZA 5FYMA 2WZHA 2A3DA 3O1JA 3UT5E 4HWDA 5IUXA 2WM9A 2WCAA 4DIDB 4BJMA 3VRBA 5AQVB 2VKJA 2XM2A 1YXRA 2LT3A 5LG3A 5DQWA 3RC8A 1MIYA 3AXJA 2DCFA 1GQEA 4HN9A 5KXJA 1HCIA 1UX5A 3FZMB 4UEMA 3TLVA 3BQLA 2UUAT 1SE7A 2LE8A 4TNVA 3B5MA 5AQKB 4A98A 4HFHA 3LK3B 3ZSSA 2WMNA 2YDSA 3AE4A 3ZYLA 3O9XA 4ADZA 5JQGE 1IBLT 3UU8A 5C8YE 3EHZA 3ONXA 4NUVA 3RI5A 4A97A 2XY8B 2BG9E 1T72A 2JQKA 1LVKA 2V26A 2H88A 3AE8A 1ZHCA 5CGMA 2IC9A 3J7Yq 2DL1A 3CKDA 4Z8XA 3RIFA 4AQGA 3PUVF 4DR5T 4KI0F 4H63H 3LDQB 4TX5A 5JR9A 3GN5A 5EK3A 2M67A 2EHOD 5LHIB 2X66A 4ZOLE 2WBLA 3QK6A 3DTOA 4HGAA 1BR2A 3NZPA 4YSXA 2VURA 3TLUA 5HXHA 5AQHB 4CQIA 3AA0B 2XAJB 2WDRA 4V1Av 5L4HA 2BKOA 2N2NA 3D0TA 3FBZA 2D5UA 2D9DA 2RP4A 3ZJ1A 2JIWA 3AEAA 4TWFA 5LXTE 1IBMT 2BVMA 4JI8T 1MIVA 3EAMA 1Z8UA 5ADXL 1V9DA 3ONLC 1FEWA 2XQ5A 3LG7A 2IUBA 1XDPA 5AQLB 3JADA 4UVBB 4F8HA 4LMJA 4QKNA 5FY1A 2N1GA 3MKDA 3PURA 4PJJA 4X64T 3AA7B 2KZ7B 5HXRA 2CXFA 3PUGA 5ABEA 5HYAA 2EHOB 5AQUB 5LYJE 4DR6T 3AE1A 1CUNA 2XQ6A 3ZT7A 3TLTA 3KV5A 4ZXLA 3E08A 1HX1B 2RPAA 4IL4A 1LVFA 4JEHB 2LSIA 2V6YB 1HR0T 4IE5A 4GYRA 3AXJB 1LRZA 3R6NA 4LMLA 4OYKA 4X20E 5F3JA 2XQ7A 4UV9B 4J2CA 5AQRB 5C2TA 5LHHB 5BR8T 2AXDS 3OYXA 2GK9A 5EK2A 2AE9A 2FUPA 4NIQA 4EZHA 4ISSA 4YHJA 3V5SA 4U31A 4KP3C 1KNRA 3ZN0B 4BAYB 1HFAA 2CPTA 4QXBB 3LBXB 3UFEA 3O1IA 3CMLA 4UXNB 2A2FX 2NW7A 2VVSA 2XTLA 3ZT5A 4WBOA 4C90A 3ABVA 3AAAB 4L0RA 2JQHA 3CVRA 3N2KE 5FXWA 2BG9A 4PNIA 4TNWA 2UXDT 5FXZA 2YK0A 3U3IA 1UX4A 2CLYC 4OYJA 5LP6E 2J1DG 3K1SA 2YEVC 5H6RB 4ZEYA 2OA5A 4I50E 1G73A 4ILUA 4ZZCA 5AQPB 1KK7A 2BBHA 2ODVA 3UU3A 5FVLA 2W63A 4IGUA 3KBTA 5AQSB 1OEDC 1OXZA 1YKHB 2MYSA 3ETUA 5HXCA 3TLWA 3NVOA 5ABGA 4H9NC 3PJAJ 3NWIA 2ZM0A 5LMNT 3UUBA 2Y8DA 3ZMTB 4AIUA 1WRDA 3P4QA 1WYBA 2KINB 2W67A 3P4PA 3PUQA 2OLTA 4Z90A 3IEEA 4EZ4A 2WY2A 5LA6E 2CBJA 1T98A 2P9BA 3V5UA 1B7TA 2BBJA 2VQFT 3IHRA 4LF9T 3LK2B 3MA9A 2WU2A 2Y48B 3JAFA 1MMAA 4IIJE 5FMNA 3QB5A 4DV7T 5AQNB 1D0YA 2H7VC 3FXDB 1KNPA 2VVNA 4IE7A 1UCUA 4QX8B 1ZEEA 4X1KE 5F8PA 2XUEA 3LJCA 5E0OA 5LJMA 3H3MA 3C4ZA 3LFMA 5L3CB 4G2AA 3ZYKA 5L3EB 4B3RT 4XBFB 4JV5T 5DABA 4U74A 2NW8A 3OKQA 4LF7T 2BS2A 3FZKB 1XMOT 2YOEA 4DBQA 4U2YA 1H7CA 1E1HB 2HN1A 3VKGA 5DJQC 4ILCA 2EHOA 2CM0A 3AA6B 5JDLA 3ZLIA 4AKLA 3RIUC 4O2AE 2HHHT 4YTPA 3ZYMA 2KLQA 3AEDA 2DHRA 5HEGA 5L3DB 2KWIB 1D1BA 2X0HA 5LB7B 4A56A 3HKDE 2LSYA 4DR3T 4LFAT 3BQIA 3KDSE 1KF6A 2WMOA 5FXVA 2XSBA 4JBWF 4IREA 5M4YA 4H9OC 4JI2T 3WI3A 1EZ3A 2KXPB 4EAHA 4DV0T 5JRCA 1D0XA 2YU1A 4BJNA 3PDYA 4Z91A 5J2UE 2WS3A 5JDHA 4FJOA 3RYIE 1WLXA 5CA1E 2CWOA 3R84B 4B6XA 4PJLA 4NXNT 1MMGA 2VKOA 5FNVE 1HS7A 4AI6A 2RA1A 3RC3A 5L3FB 4DV3T 3ZSTA 2ZMAA 2ZM8A 3GA8A 5L4EA 2LOPA 2EHOC 1OWAA 3PUSA 4HWFA 2V7IA 2UU9T 4JI4T 2MAWA 5EK4A 4DV1T 4GKKT 2K48A 1G8XA 5EZYE 3ANWB 4GK0E 4HFEA 4HKAA 5AQTB 4DBRA 5LGNB 1FMWA 4IDOA 3VKHA 4LF6T 5ETWA 4K0KT 2B1EA 2M6BA 3BK9A 3RX6A 3AE9A 2LSKA 3PUXF 2LM9A 2XASB 2SPCA 5LNKA 4CXYA 5J0ZA 1NEKA 4IL9A 2CRBA 3ETVA 4HFVA 4HWIB 4I43B 2CEAA 3G06A 1J5ET 2NWBA 2BZBA 2WDQA 4B3TT 3U78A 1OEDE 3FBLA 4OX9T 2VKHA 1BR0A 4O4LE 4DV4T 2CE7A 2HN2A 3FZFB 3AE3A 3ZMVB 4JUYA 5LBQB 4DMWA 4IE4A 3DJBA 4HFIA 3AAIA 1MMNA 1QUUA 4QH4A 2E5LT 3AE6A 1E2AA 2V5DA 4HEAA 2JQ9A 2ZM6T 3ZMUB 4DUZT 1N36T 3L39A 3TKLB 2E9XB 3ZN1B 3AA1B 2LRLA 2E5VA 4IT4A 2VWAA 3PUZF 5J1GA 3T1HT 4GIWA 4H63V 3C4WA 5LG4A 4HE8A 2UUCT 2JMHA 1KEYA 2NP9A 4KX6A 4YXDA 2YDQA 2BDEA 1W0BA 2JMKA 3AEEA 3F2EA 3HL6A 4ZI2D 4HFBA 3VU7H 2IDOB 3CQXC 5C3JA 5LGTB 2K3WA 4X62T 2X67A 2CHOA 4ZI3D 2G0UA 4HWCA 4JI1T 4HFDA 3SRZA 4JI7T 3L8RA 5L3BB 1NWMX 2X9XA 2ES0A 3CQGB 2XZEA 2Q9QB 3CX7B 2BG9C 2D2SA 2XQ8A 4QXCB 4WBNE 4DV6T 2L9QA 2XQ4A 3RPUA 2I6HA 2LKGA 2V6YA 4ILBA 4U7YA 3RRCA 1I94T 3Q2MA 4ERRA 3NZQA 4X66T 2DI4A 4EB6E 1Y64B 3ZJ2A 2PFVA 4M1PA 4U2ZA 2FBWA 2Q9QC 2FJBA 3EABA 2ODUA 2WP9A 4N78D 5AQFB 1UUSA 3EI0A 1X79A 3FZHB 3PTRB 3PUYF 4PFPA 4U72A 1VOMA 2H7OA 4PK6A 3UUXB 3NBXX 4EEBA 3OBVE 4B3ST 1FMVA 1S35A 3BQKA 1OEDB 3SOLA 4DR2T 1W9RA 2BS3A 2W61A 3L3PA 3OPCA 4UF0A 4UVAB 3AE2A 4DMVA 4EIWA 4GK5E 2H89A 3HI2A 4AISA 1SUMB 4L5GA 3X1DA 2X0YA 5KMGP 1XWMA 2W00A 4TWDA 2KWHA 2W62A 5FXXA 1NENA 3Q9DA 4IE6A 4YJ2E 4YLHA 1XNQT 3RF1A 4WYVA 4ZS2A 2E9XA 3TLSA 3ZCIA 2X0LB 4U33A 2HH7A 4ZI7E 3T1YT 2PTFA 2OV9A 1D1CA 1MMDA 3EDVA 4MBQA 2E8IA 5IHYA 2IHR1 3N2GE 4P0BA 4P1NA 3H3AA 5FVKA 2XAGB 5CFBA 5CJ5A 2YU2A 1N33T 4TN7B 1N34T 3JAEA 2J47A 3RKOA 2NOXA 2MBGA 4TV8E 1XZYA 3C50A 2CXLA 1M7KA 3E22E 5HCMA 3SFDA 4EOZB 5HEJA 4LFCT 1AJ3A 2CXDA 2CBIA 2KSRA 2W66A 1W09A 3MZKB 3VHLA 1YD8G 2R6GF 5HWYA 3RH3A 5H6QB 1HTJF 1YKEB 3HR0A 2E2AA 2X9HA 1LKXA 4UR9A 2BS4A 1MIWA 2IW5B 2KMFA 5HWXA 1VCSA 3I9YA 3KV6A 4DV2T 2MTQA 1X9BA 2LSJA 3MK7C 5FKYA 2XQAA 3RIAA 5L2LA 4OFZA 4QH5A 2M6IA 4EEDA 2XHEB 2XAHB 3KBUA 3ONJA 4AKGA 3I1AA 3PU8A 2JPFA 4LMKA 2VQET 3ZCJA 3FZLB 3E0ZA 3HKBE 3GN5B 2WWUA 4AQFA 2WB5A 4WNKA 3K3NA 2QA7A 5LOVE 5CB4E 3C4XA 2CLYB 3C64A 4K0UA 2V7MA 2IC6A 3QB5K 3SS1A 2IMLA 1XMQT 2QRXA 2IAKA 2LRKA 3N9PA 4XAXB 2WU5A 1HF8A 3FHNA 5HXSA 2BG9B 5J2TE 4CI2B 4DNDA 2B76A 4PJMA 2W2UA 4F6RC 2NTYA 2LKHA 3CIRA 5CA0E 3EUHA 4DR1T 3UUNA 4YHHT 4LF5T 2ACXA 3UTKA 2CWYA 2C0SA 1ZKEA 3Q5WA 4MHCA 2DLRA 2DNXA 5HAXA 3KVBA 2X9YA 2F4VT 1QSDA 4UIGA 3AB3B 3AE5A 3L09A 4L9IA 2FJAA 3T8OA 3NKZA 4QHOA 5AQJB 4HWHA 3ZT6A 4ISTA 3K3QC 3Q5XA 5JTGA 4YFSA 2QGSA 3HKCE 3AVRA 2FJEA 4IDZA 2CMRA 1WR0A 3CPZA 1QLBA 3MACA 4KUMB 4X1IE 5AQOB 4TZ4C 3UUMA 2H3RA 3DP7A 3JC6C 4KBMB 2V7KA 2LOSA 2A72A 5LGUB 5IWAT 1NAFA 3LSVA 3PUWF 3RQUA 2D0UA 2LJLA 3K8PC 4FI5A 4PFOA 3RLFF 3F57A 4NUUA 3PJAA 4AQFC 4ANJA 4CZZB 5LJNA 2YN6A 3O4XE 5HCJA 2E9XD 3P50A 4HFCA 3S4UA 4KHPT 4EYYR 3RQWA 3PV0F 4IDPA 2JJ9A 2XQ9A 3IA3A 4PAGA 3SFEA 3VRAA 3FXEB 3CWZB 1T7SA 3HKEE 2NTXA 2BVLA 3ANWA 1HNXT 2V8SV 1UURA 1WCRA 2NW9A 3RIUA 1XNRT 4I55E 2XM1A 2BKPA 2UXCT 2J4GA 2VKDA 4CI1B 3AVSA 5JH7E 1HG2A 2LHRA 2V6XA 5LBMA 3PU3A 2HPLA 5HEOA 5BMVE 1R8IA 4IDQA 3KV4A 3SWHA 3RHWA 4CXWA 3I0OA 4YTMA 3IF8B 4QH1A 5FL1A 4O8SA 3UFGA 4JI6T 2X51A 4UVCB 1IAPA 1HG5A 3Q5EA 1S94A 4ZZBA 5JR9C 2XJ7A 3B57A 4TUYE 1YQ3A 3VR8A 2E9XC 2XPKA 4I0UA 2DWGA 2W0GA 3QNUA 5JDGA 3QOFA 3RRWA 4BA9A 3HA4A 2IIUA 4B3MT 1HNWT 4AQYT 1CHUA 2WQYA 1IBKT 4DVDA 1W0AA 2XQ3A 3ZMSB 3N9QA 5KX5E 2K5BB 2LLYA 5JDQA 4IDNA 4P0AA 1YQ4A 2D0TA 4O4JE 2C5JA 4H9SE 2LM2A 4CN1A 1IJ5A 5JDNA 4I4TE 5AQGB 4WZXA 2PJQA 4ZI3C 3N9OA 5JDFA 3RYFE 3UU5A 4ZHQE 2I0MA 4JI3T 4G63A 2CHNA 1BR4A 2UXNB 4GKJT 2L3LA 2ZM2A 4PW8A 3EDUA 3JCFA 2V5CA 3AEBA 1KNZA 4LFBT 4AKIA 4PK5A 4O4IE 2VL8A 3P8CD 2JQQA 3ZEFB 2WSSV 4MLKA 2QVAA 3KV9A 4YSYA 1KFYA 2K24A 2V7JA 3B13A 3CX6B 3LK42 1L0VA 4X1YE 3UU6A 3W15B 3WAKA 5KDMC 4WW0A 1WYCA 3WAJA 4MFRA 3M65A 3I9WA 5GONE 2MPKA 2K9AA 3KINB 4XZCA 5JREA 3P7IA 1FJGT 3C98B 5AQQB 3M3ZB 3A7MA 1HX8A 3F31A 4U7IA 3KVAA 3N9LA 3C51A 2N9DA
chains in the Genus database with same CATH topology
2CCQA 1FIOA 3N9MA 1U4QA 3AAEB 3N2OA 4DO0A 4QX7B 5L3GB 1US7B 4E7ZA 4IE0A 2L8KA 2C5IT 1O3XA 4PJNA 4P09A 3NRXA 1IJ6A 3QC9A 4UF0B 4HTEA 3EVYA 2WAUA 3QUJA 2XQYA 5JDMA 2LHNA 4OK0A 2YINA 4H9RC 4O2BE 4YJ3E 5LHGB 3LBXA 4H9QC 5LCYA 2HPJA 1SA0E 2V1DB 5IYZE 5JRCB 5FY7A 2XAFB 1BR1A 1U5PA 4AXPA 2CA5A 2V7LA 3ESLA 3ZPOA 4KMCA 3CQCB 4TV9E 5HXEA 2X68A 4EXTA 1D1AA 4C91A 3J9X1 5TAOA 3KFWX 3PE0A 2ZLYA 3O1HA 2PBIA 3IBPA 5FP3A 4H9PC 4JEUB 2X9WA 3CX8B 1Z0PA 2JRKA 4UELA 4CI3B 4IHJE 4OHFA 2I59A 3RYHE 3PUAA 4AKRB 2VK9A 4PK4A 1ZV4X 2LEHA 2Q9QD 3ZMZB 1WR6A 3ZC1A 2Y6XA 1SHZC 3FB2A 5AFUL 4JLEA 3MXZA 4ZS3A 4MALA 1D0ZA 1MNDA 2PG8A 5DQVA 2Z6EA 3N5LA 4CXXA 3GWHA 3OYZA 2Q9QA 2KNDA 4EYUA 4QWNB 3RYCE 3OJAA 2KT9A 4ZI2C 3ZC0A 2C5KT 2LSGA 3GMIA 3H37A 3MJXA 3UULA 3NRYA 2VB6A 1MNEA 1YW0A 4UV8B 4GOUA 3N9NA 2VASA 3K3OA 5A1LA 4ASKA 2XAQB 4GYSA 5FY0A 3A5XA 5JVDE 4E7SA 3JC6D 1IZNB 2MOZA 1VRBA 2UXXB 2DWKA 3I0QA 4QXHB 4O4HE 5FYMA 3UT5E 2A3DA 3O1JA 2WM9A 4BJMA 2VKJA 2LT3A 5DQWA 3RC8A 1MIYA 2DCFA 4HN9A 1HCIA 1UX5A 4UEMA 3BQLA 2LE8A 3LK3B 2WMNA 3ZYLA 3O9XA 4ADZA 5JQGE 5C8YE 3ONXA 4NUVA 1LVKA 2V26A 3J7Yq 1ZHCA 2IC9A 3CKDA 4Z8XA 4AQGA 4H63H 4TX5A 5JR9A 3GN5A 5EK3A 2M67A 2EHOD 5LHIB 2X66A 4ZOLE 2WBLA 3QK6A 3DTOA 4HGAA 1BR2A 3NZPA 5HXHA 4CQIA 3AA0B 2XAJB 4V1Av 3ZJ1A 2N2NA 3D0TA 3FBZA 2D5UA 5LXTE 2RP4A 2BVMA 1MIVA 5ADXL 1V9DA 1FEWA 3LG7A 4UVBB 4QKNA 5FY1A 2N1GA 3MKDA 3PURA 4PJJA 3AA7B 2KZ7B 5HXRA 2CXFA 3PUGA 5HYAA 2EHOB 5LYJE 1CUNA 3KV5A 3E08A 1LVFA 4JEHB 2LSIA 4IE5A 4GYRA 1LRZA 3R6NA 4OYKA 4X20E 5F3JA 4UV9B 4J2CA 5LHHB 3OYXA 2GK9A 5EK2A 4EZHA 4ISSA 4YHJA 3V5SA 3ZN0B 4KP3C 4BAYB 1HFAA 4QXBB 3LBXB 3UFEA 3O1IA 3CMLA 4UXNB 2A2FX 2NW7A 2XTLA 4WBOA 4C90A 3AAAB 4L0RA 3CVRA 3N2KE 5FXWA 4PNIA 5FXZA 2YK0A 3U3IA 1UX4A 2CLYC 4OYJA 5LP6E 2J1DG 2YEVC 5H6RB 2OA5A 4I50E 1G73A 4ILUA 1KK7A 2ODVA 3UTKA 2W63A 4IGUA 3KBTA 5HXCA 1YKHB 1OXZA 2MYSA 3ETUA 4H9NC 2ZM0A 2Y8DA 3ZMTB 1WRDA 1WYBA 2KINB 3PUQA 4EZ4A 3IEEA 5LA6E 1T98A 2P9BA 3V5UA 1B7TA 3IHRA 3LK2B 3MA9A 2Y48B 1MMAA 4IIJE 5FMNA 1D0YA 2H7VC 3FXDB 4IE7A 4QX8B 1UCUA 1ZEEA 4X1KE 5F8PA 2XUEA 3LJCA 5E0OA 5LJMA 3C4ZA 3LFMA 5L3CB 4G2AA 3ZYKA 5L3EB 4XBFB 5DABA 4U74A 2NW8A 3OKQA 4DBQA 1H7CA 1E1HB 5DJQC 2EHOA 2CM0A 3AA6B 5JDLA 3ZLIA 4AKLA 4O2AE 3ZYMA 2KLQA 2DHRA 5L3DB 1D1BA 2KWIB 4A56A 3HKDE 2LSYA 1AJ3A 3BQIA 3KDSE 2WMOA 5FXVA 5M4YA 4H9OC 3WI3A 1EZ3A 2KXPB 4EAHA 5JRCA 1D0XA 2YU1A 4BJNA 3PDYA 5J2UE 5JDHA 4FJOA 3RYIE 1WLXA 5CA1E 2CWOA 3R84B 4B6XA 4PJLA 1MMGA 2VKOA 5FNVE 1HS7A 4AI6A 2RA1A 3RC3A 5L3FB 2ZMAA 2ZM8A 3GA8A 2LOPA 2EHOC 1OWAA 3PUSA 2V7IA 5EK4A 2K48A 1G8XA 5EZYE 3ANWB 4GK0E 4HKAA 4DBRA 5LGNB 1FMWA 3VKHA 5ETWA 2B1EA 3BK9A 3RX6A 5LNKA 2LSKA 2LM9A 2XASB 2SPCA 4CXYA 4HFVA 3ETVA 4I43B 2CEAA 3VKGA 2NWBA 2BZBA 3U78A 3FBLA 1BR0A 2VKHA 4O4LE 2CE7A 4DMWA 3ZMVB 4JUYA 5LBQB 4IE4A 3DJBA 3AAIA 1MMNA 1QUUA 4HEAA 3ZMUB 3TKLB 2E9XB 3ZN1B 3AA1B 2VWAA 5J1GA 4GIWA 4H63V 3C4WA 5LG4A 4HE8A 2JMHA 2NP9A 2BDEA 2JMKA 4ZI2D 3F2EA 3HL6A 5LGTB 3VU7H 3CQXC 2X67A 4ZI3D 2G0UA 3SRZA 5L3BB 1NWMX 2X9XA 2ES0A 3CQGB 2Q9QB 3CX7B 2D2SA 4QXCB 4WBNE 2L9QA 3RPUA 3RRCA 3Q2MA 4ERRA 3NZQA 2DI4A 4EB6E 1Y64B 3ZJ2A 2PFVA 4M1PA 2Q9QC 2ODUA 4N78D 1X79A 4U72A 3PTRB 4PFPA 3UUXB 1VOMA 2H7OA 4PK6A 3NBXX 3OBVE 1FMVA 1S35A 3BQKA 3SOLA 3L3PA 2W61A 4UF0A 4UVAB 4DMVA 4EIWA 4GK5E 3HI2A 4L5GA 5KMGP 2W00A 2KWHA 2W62A 5FXXA 3Q9DA 4IE6A 4YJ2E 4YLHA 4ZS2A 2E9XA 3ZCIA 2X0LB 2HH7A 4ZI7E 1D1CA 1MMDA 3EDVA 4MBQA 2E8IA 5IHYA 3N2GE 4P0BA 3H3AA 2XAGB 2YU2A 4TN7B 3RKOA 2NOXA 2MBGA 4TV8E 3C50A 3E22E 2CXLA 4EOZB 2CXDA 3MZKB 3VHLA 1YD8G 5HWYA 3RH3A 5H6QB 1HTJF 1YKEB 3HR0A 2X9HA 1LKXA 1MIWA 2IW5B 2KMFA 5HWXA 3I9YA 3KV6A 2MTQA 2LSJA 3MK7C 5L2LA 4OFZA 2XHEB 2XAHB 3KBUA 4AKGA 3I1AA 3PU8A 2JPFA 3ZCJA 3HKBE 3E0ZA 3GN5B 2WWUA 4AQFA 4WNKA 3K3NA 2QA7A 5LOVE 5CB4E 3C4XA 2CLYB 3C64A 4K0UA 2V7MA 2IC6A 3SS1A 2IAKA 3N9PA 4XAXB 5HXSA 3FHNA 1HF8A 5J2TE 4CI2B 4DNDA 4PJMA 4F6RC 2NTYA 5CA0E 3EUHA 3UUNA 2ACXA 2CWYA 2C0SA 1ZKEA 3Q5WA 4MHCA 2DLRA 2DNXA 5HAXA 3KVBA 2X9YA 1QSDA 4UIGA 3AB3B 3L09A 4L9IA 3T8OA 4QHOA 4ISTA 3K3QC 3Q5XA 4YFSA 2QGSA 3HKCE 3AVRA 4IDZA 2CMRA 5JR9B 3CPZA 3MACA 4KUMB 4X1IE 3UUMA 4TZ4C 2H3RA 3DP7A 3JC6C 4KBMB 2V7KA 2LOSA 2A72A 5LGUB 1NAFA 2D0UA 2LJLA 3K8PC 4FI5A 4PFOA 4AQFC 3F57A 4NUUA 4ANJA 5JDGA 4CZZB 5LJNA 3O4XE 2E9XD 3S4UA 4EYYR 2JJ9A 4PAGA 3FXEB 3CWZB 3HKEE 2NTXA 2BVLA 3ANWA 2NW9A 4I55E 2VKDA 4CI1B 3AVSA 5JH7E 1HG2A 2LHRA 5LBMA 3PU3A 2HPLA 5BMVE 3KV4A 3SWHA 4CXWA 3I0OA 3IF8B 4O8SA 2X51A 4UVCB 1IAPA 1HG5A 1S94A 5JR9C 3B57A 4TUYE 2E9XC 2DWGA 2W0GA 3RRWA 4BA9A 3HA4A 4DVDA 3ZMSB 3N9QA 5KX5E 2K5BB 5JDQA 4P0AA 2D0TA 4O4JE 2C5JA 4H9SE 5JDNA 1IJ5A 4I4TE 2PJQA 4ZI3C 3N9OA 5JDFA 3RYFE 4ZHQE 4G63A 1BR4A 2UXNB 2L3LA 2ZM2A 4PW8A 3EDUA 1KNZA 4AKIA 4PK5A 4O4IE 2VL8A 3P8CD 2JQQA 3ZEFB 2WSSV 4MLKA 3KV9A 2K24A 2V7JA 3B13A 3CX6B 3LK42 3W15B 4X1YE 3WAKA 5KDMC 4WW0A 1WYCA 3WAJA 4MFRA 3M65A 3I9WA 5GONE 5JREA 2K9AA 3KINB 4XZCA 3P7IA 3C98B 4AKHA 1HX8A 3F31A 3KVAA 3N9LA 3C51A 2N9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K24 A;  2JMK A; 
#chains in the Genus database with same CATH topology
 2CCQ A;  2J62 A;  5HEH A;  3UQ7 A;  2UUB T;  1FIO A;  1J5W A;  1XDO A;  3N9M A;  1U4Q A;  2YKS A;  4U3C A;  3AAE B;  1J1J A;  3N2O A;  4DO0 A;  4JYA T;  4QX7 B;  4KHZ F;  5L3G B;  1US7 B;  4E7Z A;  4IE0 A;  5ABF A;  2L8K A;  2C5I T;  1O3X A;  4PJN A;  1Y01 A;  4P09 A;  1UK5 A;  3NRX A;  1IJ6 A;  2VL0 A;  3QC9 A;  4UF0 B;  4HTE A;  3EVY A;  3AEF A;  3AE7 A;  5AQI B;  3OTO T;  2WAU A;  3QUJ A;  5F5W A;  2XQY A;  5JDM A;  2LHN A;  4OK0 A;  2YIN A;  2WDV A;  4H9R C;  4O2B E;  4YJ3 E;  5JR9 B;  5LHG B;  4DUY T;  3LBX A;  4H9Q C;  5LCY A;  2HPJ A;  3RGL A;  3VR9 A;  4JI5 T;  1SA0 E;  2UXB T;  2V1D B;  4DV5 T;  3Q5D A;  5IYZ E;  1T8B A;  2BKN A;  4CN4 A;  5JRC B;  5FY7 A;  2XAF B;  4YT0 A;  1BR1 A;  4LF8 T;  2YDR A;  1U5P A;  4AXP A;  1JNZ A;  2CA5 A;  2V7L A;  3ESL A;  3UQ4 A;  4KMC A;  3ZPO A;  3CQC B;  1E7P A;  4TV9 E;  5HXE A;  2X68 A;  4EXT A;  3CK6 A;  3OVU A;  1D1A A;  5LMU T;  4X65 T;  4C91 A;  3J9X 1;  5TAO A;  3KFW X;  3PE0 A;  3UU4 A;  4NPP A;  2ZLY A;  3O1H A;  2PBI A;  2FJD A;  3IBP A;  5FP3 A;  4H9P C;  4AKH A;  4JEU B;  2X9W A;  3CX8 B;  1Z0P A;  2JRK A;  4UEL A;  4CI3 B;  4IHJ E;  4OHF A;  1HNZ T;  2I59 A;  3RYH E;  3PUA A;  4AKR B;  2VK9 A;  4PK4 A;  1ZV4 X;  1N32 T;  1DU2 A;  2LEH A;  4X5T A;  1JNR A;  2Q9Q D;  3ZMZ B;  5L47 A;  1WR6 A;  3ZC1 A;  2Y6X A;  1SHZ C;  3FB2 A;  4A5X A;  5AFU L;  4YSZ A;  4JLE A;  4DR7 T;  2NR4 A;  5ABF B;  3MXZ A;  4ZS3 A;  4MAL A;  4TWH A;  1D0Z A;  1MND A;  4YTN A;  4YY3 T;  4JI0 T;  3P4W A;  1ZOY A;  2PG8 A;  5DQV A;  3RKG A;  2Z6E A;  3N5L A;  1I6Z A;  4COF A;  1OED A;  2A9U A;  4LF4 T;  3P4R A;  4CXX A;  3GWH A;  3OYZ A;  4EGW A;  3A8Y C;  1M62 A;  2Q9Q A;  3P4S A;  5ABH A;  1WFD A;  2QYW A;  2WWV A;  3ZKR A;  2KND A;  4EV6 A;  4DR4 T;  3AEC A;  4EYU A;  1VCT A;  4QWN B;  5AQM B;  2W4X A;  2KT9 A;  3OJA A;  5HEU A;  3RYC E;  4CN6 A;  4ZI2 C;  3ZC0 A;  2C5K T;  2LSG A;  3GMI A;  3H37 A;  3MJX A;  3UUL A;  3NRY A;  2VB6 A;  1MNE A;  1YW0 A;  4UV8 B;  4GOU A;  3N9N A;  2VAS A;  3AEG A;  4Q25 A;  1ZP0 A;  5FL0 A;  3K3O A;  5A1L A;  4NXM T;  4ASK A;  2XAQ B;  4GYS A;  2XSA A;  5FY0 A;  3A5X A;  5JVD E;  4ILA A;  2WZI A;  4E7S A;  3JC6 D;  2UXX B;  1IZN B;  2MOZ A;  1UGO A;  1VRB A;  2DWK A;  3I0Q A;  4QXH B;  4O4H E;  2ACZ A;  5FYM A;  2WZH A;  2A3D A;  3O1J A;  3UT5 E;  4HWD A;  5IUX A;  2WM9 A;  2WCA A;  4DID B;  4BJM A;  3VRB A;  5AQV B;  2VKJ A;  2XM2 A;  1YXR A;  2LT3 A;  5LG3 A;  5DQW A;  3RC8 A;  1MIY A;  3AXJ A;  2DCF A;  1GQE A;  4HN9 A;  5KXJ A;  1HCI A;  1UX5 A;  3FZM B;  4UEM A;  3TLV A;  3BQL A;  2UUA T;  1SE7 A;  2LE8 A;  4TNV A;  3B5M A;  5AQK B;  4A98 A;  4HFH A;  3LK3 B;  3ZSS A;  2WMN A;  2YDS A;  3AE4 A;  3ZYL A;  3O9X A;  4ADZ A;  5JQG E;  1IBL T;  3UU8 A;  5C8Y E;  3EHZ A;  3ONX A;  4NUV A;  3RI5 A;  4A97 A;  2XY8 B;  2BG9 E;  1T72 A;  2JQK A;  1LVK A;  2V26 A;  2H88 A;  3AE8 A;  1ZHC A;  5CGM A;  2IC9 A;  3J7Y q;  2DL1 A;  3CKD A;  4Z8X A;  3RIF A;  4AQG A;  3PUV F;  4DR5 T;  4KI0 F;  4H63 H;  3LDQ B;  4TX5 A;  5JR9 A;  3GN5 A;  5EK3 A;  2M67 A;  2EHO D;  5LHI B;  2X66 A;  4ZOL E;  2WBL A;  3QK6 A;  3DTO A;  4HGA A;  1BR2 A;  3NZP A;  4YSX A;  2VUR A;  3TLU A;  5HXH A;  5AQH B;  4CQI A;  3AA0 B;  2XAJ B;  2WDR A;  4V1A v;  5L4H A;  2BKO A;  2N2N A;  3D0T A;  3FBZ A;  2D5U A;  2D9D A;  2RP4 A;  3ZJ1 A;  2JIW A;  3AEA A;  4TWF A;  5LXT E;  1IBM T;  2BVM A;  4JI8 T;  1MIV A;  3EAM A;  1Z8U A;  5ADX L;  1V9D A;  3ONL C;  1FEW A;  2XQ5 A;  3LG7 A;  2IUB A;  1XDP A;  5AQL B;  3JAD A;  4UVB B;  4F8H A;  4LMJ A;  4QKN A;  5FY1 A;  2N1G A;  3MKD A;  3PUR A;  4PJJ A;  4X64 T;  3AA7 B;  2KZ7 B;  5HXR A;  2CXF A;  3PUG A;  5ABE A;  5HYA A;  2EHO B;  5AQU B;  5LYJ E;  4DR6 T;  3AE1 A;  1CUN A;  2XQ6 A;  3ZT7 A;  3TLT A;  3KV5 A;  4ZXL A;  3E08 A;  1HX1 B;  2RPA A;  4IL4 A;  1LVF A;  4JEH B;  2LSI A;  2V6Y B;  1HR0 T;  4IE5 A;  4GYR A;  3AXJ B;  1LRZ A;  3R6N A;  4LML A;  4OYK A;  4X20 E;  5F3J A;  2XQ7 A;  4UV9 B;  4J2C A;  5AQR B;  5C2T A;  5LHH B;  5BR8 T;  2AXD S;  3OYX A;  2GK9 A;  5EK2 A;  2AE9 A;  2FUP A;  4NIQ A;  4EZH A;  4ISS A;  4YHJ A;  3V5S A;  4U31 A;  4KP3 C;  1KNR A;  3ZN0 B;  4BAY B;  1HFA A;  2CPT A;  4QXB B;  3LBX B;  3UFE A;  3O1I A;  3CML A;  4UXN B;  2A2F X;  2NW7 A;  2VVS A;  2XTL A;  3ZT5 A;  4WBO A;  4C90 A;  3ABV A;  3AAA B;  4L0R A;  2JQH A;  3CVR A;  3N2K E;  5FXW A;  2BG9 A;  4PNI A;  4TNW A;  2UXD T;  5FXZ A;  2YK0 A;  3U3I A;  1UX4 A;  2CLY C;  4OYJ A;  5LP6 E;  2J1D G;  3K1S A;  2YEV C;  5H6R B;  4ZEY A;  2OA5 A;  4I50 E;  1G73 A;  4ILU A;  4ZZC A;  5AQP B;  1KK7 A;  2BBH A;  2ODV A;  3UU3 A;  5FVL A;  2W63 A;  4IGU A;  3KBT A;  5AQS B;  1OED C;  1OXZ A;  1YKH B;  2MYS A;  3ETU A;  5HXC A;  3TLW A;  3NVO A;  5ABG A;  4H9N C;  3PJA J;  3NWI A;  2ZM0 A;  5LMN T;  3UUB A;  2Y8D A;  3ZMT B;  4AIU A;  1WRD A;  3P4Q A;  1WYB A;  2KIN B;  2W67 A;  3P4P A;  3PUQ A;  2OLT A;  4Z90 A;  3IEE A;  4EZ4 A;  2WY2 A;  5LA6 E;  2CBJ A;  1T98 A;  2P9B A;  3V5U A;  1B7T A;  2BBJ A;  2VQF T;  3IHR A;  4LF9 T;  3LK2 B;  3MA9 A;  2WU2 A;  2Y48 B;  3JAF A;  1MMA A;  4IIJ E;  5FMN A;  3QB5 A;  4DV7 T;  5AQN B;  1D0Y A;  2H7V C;  3FXD B;  1KNP A;  2VVN A;  4IE7 A;  1UCU A;  4QX8 B;  1ZEE A;  4X1K E;  5F8P A;  2XUE A;  3LJC A;  5E0O A;  5LJM A;  3H3M A;  3C4Z A;  3LFM A;  5L3C B;  4G2A A;  3ZYK A;  5L3E B;  4B3R T;  4XBF B;  4JV5 T;  5DAB A;  4U74 A;  2NW8 A;  3OKQ A;  4LF7 T;  2BS2 A;  3FZK B;  1XMO T;  2YOE A;  4DBQ A;  4U2Y A;  1H7C A;  1E1H B;  2HN1 A;  3VKG A;  5DJQ C;  4ILC A;  2EHO A;  2CM0 A;  3AA6 B;  5JDL A;  3ZLI A;  4AKL A;  3RIU C;  4O2A E;  2HHH T;  4YTP A;  3ZYM A;  2KLQ A;  3AED A;  2DHR A;  5HEG A;  5L3D B;  2KWI B;  1D1B A;  2X0H A;  5LB7 B;  4A56 A;  3HKD E;  2LSY A;  4DR3 T;  4LFA T;  3BQI A;  3KDS E;  1KF6 A;  2WMO A;  5FXV A;  2XSB A;  4JBW F;  4IRE A;  5M4Y A;  4H9O C;  4JI2 T;  3WI3 A;  1EZ3 A;  2KXP B;  4EAH A;  4DV0 T;  5JRC A;  1D0X A;  2YU1 A;  4BJN A;  3PDY A;  4Z91 A;  5J2U E;  2WS3 A;  5JDH A;  4FJO A;  3RYI E;  1WLX A;  5CA1 E;  2CWO A;  3R84 B;  4B6X A;  4PJL A;  4NXN T;  1MMG A;  2VKO A;  5FNV E;  1HS7 A;  4AI6 A;  2RA1 A;  3RC3 A;  5L3F B;  4DV3 T;  3ZST A;  2ZMA A;  2ZM8 A;  3GA8 A;  5L4E A;  2LOP A;  2EHO C;  1OWA A;  3PUS A;  4HWF A;  2V7I A;  2UU9 T;  4JI4 T;  2MAW A;  5EK4 A;  4DV1 T;  4GKK T;  2K48 A;  1G8X A;  5EZY E;  3ANW B;  4GK0 E;  4HFE A;  4HKA A;  5AQT B;  4DBR A;  5LGN B;  1FMW A;  4IDO A;  3VKH A;  4LF6 T;  5ETW A;  4K0K T;  2B1E A;  2M6B A;  3BK9 A;  3RX6 A;  3AE9 A;  2LSK A;  3PUX F;  2LM9 A;  2XAS B;  2SPC A;  5LNK A;  4CXY A;  5J0Z A;  1NEK A;  4IL9 A;  2CRB A;  3ETV A;  4HFV A;  4HWI B;  4I43 B;  2CEA A;  3G06 A;  1J5E T;  2NWB A;  2BZB A;  2WDQ A;  4B3T T;  3U78 A;  1OED E;  3FBL A;  4OX9 T;  2VKH A;  1BR0 A;  4O4L E;  4DV4 T;  2CE7 A;  2HN2 A;  3FZF B;  3AE3 A;  3ZMV B;  4JUY A;  5LBQ B;  4DMW A;  4IE4 A;  3DJB A;  4HFI A;  3AAI A;  1MMN A;  1QUU A;  4QH4 A;  2E5L T;  3AE6 A;  1E2A A;  2V5D A;  4HEA A;  2JQ9 A;  2ZM6 T;  3ZMU B;  4DUZ T;  1N36 T;  3L39 A;  3TKL B;  2E9X B;  3ZN1 B;  3AA1 B;  2LRL A;  2E5V A;  4IT4 A;  2VWA A;  3PUZ F;  5J1G A;  3T1H T;  4GIW A;  4H63 V;  3C4W A;  5LG4 A;  4HE8 A;  2UUC T;  2JMH A;  1KEY A;  2NP9 A;  4KX6 A;  4YXD A;  2YDQ A;  2BDE A;  1W0B A;  2JMK A;  3AEE A;  3F2E A;  3HL6 A;  4ZI2 D;  4HFB A;  3VU7 H;  2IDO B;  3CQX C;  5C3J A;  5LGT B;  2K3W A;  4X62 T;  2X67 A;  2CHO A;  4ZI3 D;  2G0U A;  4HWC A;  4JI1 T;  4HFD A;  3SRZ A;  4JI7 T;  3L8R A;  5L3B B;  1NWM X;  2X9X A;  2ES0 A;  3CQG B;  2XZE A;  2Q9Q B;  3CX7 B;  2BG9 C;  2D2S A;  2XQ8 A;  4QXC B;  4WBN E;  4DV6 T;  2L9Q A;  2XQ4 A;  3RPU A;  2I6H A;  2LKG A;  2V6Y A;  4ILB A;  4U7Y A;  3RRC A;  1I94 T;  3Q2M A;  4ERR A;  3NZQ A;  4X66 T;  2DI4 A;  4EB6 E;  1Y64 B;  3ZJ2 A;  2PFV A;  4M1P A;  4U2Z A;  2FBW A;  2Q9Q C;  2FJB A;  3EAB A;  2ODU A;  2WP9 A;  4N78 D;  5AQF B;  1UUS A;  3EI0 A;  1X79 A;  3FZH B;  3PTR B;  3PUY F;  4PFP A;  4U72 A;  1VOM A;  2H7O A;  4PK6 A;  3UUX B;  3NBX X;  4EEB A;  3OBV E;  4B3S T;  1FMV A;  1S35 A;  3BQK A;  1OED B;  3SOL A;  4DR2 T;  1W9R A;  2BS3 A;  2W61 A;  3L3P A;  3OPC A;  4UF0 A;  4UVA B;  3AE2 A;  4DMV A;  4EIW A;  4GK5 E;  2H89 A;  3HI2 A;  4AIS A;  1SUM B;  4L5G A;  3X1D A;  2X0Y A;  5KMG P;  1XWM A;  2W00 A;  4TWD A;  2KWH A;  2W62 A;  5FXX A;  1NEN A;  3Q9D A;  4IE6 A;  4YJ2 E;  4YLH A;  1XNQ T;  3RF1 A;  4WYV A;  4ZS2 A;  2E9X A;  3TLS A;  3ZCI A;  2X0L B;  4U33 A;  2HH7 A;  4ZI7 E;  3T1Y T;  2PTF A;  2OV9 A;  1D1C A;  1MMD A;  3EDV A;  4MBQ A;  2E8I A;  5IHY A;  2IHR 1;  3N2G E;  4P0B A;  4P1N A;  3H3A A;  5FVK A;  2XAG B;  5CFB A;  5CJ5 A;  2YU2 A;  1N33 T;  4TN7 B;  1N34 T;  3JAE A;  2J47 A;  3RKO A;  2NOX A;  2MBG A;  4TV8 E;  1XZY A;  3C50 A;  2CXL A;  1M7K A;  3E22 E;  5HCM A;  3SFD A;  4EOZ B;  5HEJ A;  4LFC T;  1AJ3 A;  2CXD A;  2CBI A;  2KSR A;  2W66 A;  1W09 A;  3MZK B;  3VHL A;  1YD8 G;  2R6G F;  5HWY A;  3RH3 A;  5H6Q B;  1HTJ F;  1YKE B;  3HR0 A;  2E2A A;  2X9H A;  1LKX A;  4UR9 A;  2BS4 A;  1MIW A;  2IW5 B;  2KMF A;  5HWX A;  1VCS A;  3I9Y A;  3KV6 A;  4DV2 T;  2MTQ A;  1X9B A;  2LSJ A;  3MK7 C;  5FKY A;  2XQA A;  3RIA A;  5L2L A;  4OFZ A;  4QH5 A;  2M6I A;  4EED A;  2XHE B;  2XAH B;  3KBU A;  3ONJ A;  4AKG A;  3I1A A;  3PU8 A;  2JPF A;  4LMK A;  2VQE T;  3ZCJ A;  3FZL B;  3E0Z A;  3HKB E;  3GN5 B;  2WWU A;  4AQF A;  2WB5 A;  4WNK A;  3K3N A;  2QA7 A;  5LOV E;  5CB4 E;  3C4X A;  2CLY B;  3C64 A;  4K0U A;  2V7M A;  2IC6 A;  3QB5 K;  3SS1 A;  2IML A;  1XMQ T;  2QRX A;  2IAK A;  2LRK A;  3N9P A;  4XAX B;  2WU5 A;  1HF8 A;  3FHN A;  5HXS A;  2BG9 B;  5J2T E;  4CI2 B;  4DND A;  2B76 A;  4PJM A;  2W2U A;  4F6R C;  2NTY A;  2LKH A;  3CIR A;  5CA0 E;  3EUH A;  4DR1 T;  3UUN A;  4YHH T;  4LF5 T;  2ACX A;  3UTK A;  2CWY A;  2C0S A;  1ZKE A;  3Q5W A;  4MHC A;  2DLR A;  2DNX A;  5HAX A;  3KVB A;  2X9Y A;  2F4V T;  1QSD A;  4UIG A;  3AB3 B;  3AE5 A;  3L09 A;  4L9I A;  2FJA A;  3T8O A;  3NKZ A;  4QHO A;  5AQJ B;  4HWH A;  3ZT6 A;  4IST A;  3K3Q C;  3Q5X A;  5JTG A;  4YFS A;  2QGS A;  3HKC E;  3AVR A;  2FJE A;  4IDZ A;  2CMR A;  1WR0 A;  3CPZ A;  1QLB A;  3MAC A;  4KUM B;  4X1I E;  5AQO B;  4TZ4 C;  3UUM A;  2H3R A;  3DP7 A;  3JC6 C;  4KBM B;  2V7K A;  2LOS A;  2A72 A;  5LGU B;  5IWA T;  1NAF A;  3LSV A;  3PUW F;  3RQU A;  2D0U A;  2LJL A;  3K8P C;  4FI5 A;  4PFO A;  3RLF F;  3F57 A;  4NUU A;  3PJA A;  4AQF C;  4ANJ A;  4CZZ B;  5LJN A;  2YN6 A;  3O4X E;  5HCJ A;  2E9X D;  3P50 A;  4HFC A;  3S4U A;  4KHP T;  4EYY R;  3RQW A;  3PV0 F;  4IDP A;  2JJ9 A;  2XQ9 A;  3IA3 A;  4PAG A;  3SFE A;  3VRA A;  3FXE B;  3CWZ B;  1T7S A;  3HKE E;  2NTX A;  2BVL A;  3ANW A;  1HNX T;  2V8S V;  1UUR A;  1WCR A;  2NW9 A;  3RIU A;  1XNR T;  4I55 E;  2XM1 A;  2BKP A;  2UXC T;  2J4G A;  2VKD A;  4CI1 B;  3AVS A;  5JH7 E;  1HG2 A;  2LHR A;  2V6X A;  5LBM A;  3PU3 A;  2HPL A;  5HEO A;  5BMV E;  1R8I A;  4IDQ A;  3KV4 A;  3SWH A;  3RHW A;  4CXW A;  3I0O A;  4YTM A;  3IF8 B;  4QH1 A;  5FL1 A;  4O8S A;  3UFG A;  4JI6 T;  2X51 A;  4UVC B;  1IAP A;  1HG5 A;  3Q5E A;  1S94 A;  4ZZB A;  5JR9 C;  2XJ7 A;  3B57 A;  4TUY E;  1YQ3 A;  3VR8 A;  2E9X C;  2XPK A;  4I0U A;  2DWG A;  2W0G A;  3QNU A;  5JDG A;  3QOF A;  3RRW A;  4BA9 A;  3HA4 A;  2IIU A;  4B3M T;  1HNW T;  4AQY T;  1CHU A;  2WQY A;  1IBK T;  4DVD A;  1W0A A;  2XQ3 A;  3ZMS B;  3N9Q A;  5KX5 E;  2K5B B;  2LLY A;  5JDQ A;  4IDN A;  4P0A A;  1YQ4 A;  2D0T A;  4O4J E;  2C5J A;  4H9S E;  2LM2 A;  4CN1 A;  1IJ5 A;  5JDN A;  4I4T E;  5AQG B;  4WZX A;  2PJQ A;  4ZI3 C;  3N9O A;  5JDF A;  3RYF E;  3UU5 A;  4ZHQ E;  2I0M A;  4JI3 T;  4G63 A;  2CHN A;  1BR4 A;  2UXN B;  4GKJ T;  2L3L A;  2ZM2 A;  4PW8 A;  3EDU A;  3JCF A;  2V5C A;  3AEB A;  1KNZ A;  4LFB T;  4AKI A;  4PK5 A;  4O4I E;  2VL8 A;  3P8C D;  2JQQ A;  3ZEF B;  2WSS V;  4MLK A;  2QVA A;  3KV9 A;  4YSY A;  1KFY A;  2K24 A;  2V7J A;  3B13 A;  3CX6 B;  3LK4 2;  1L0V A;  4X1Y E;  3UU6 A;  3W15 B;  3WAK A;  5KDM C;  4WW0 A;  1WYC A;  3WAJ A;  4MFR A;  3M65 A;  3I9W A;  5GON E;  2MPK A;  2K9A A;  3KIN B;  4XZC A;  5JRE A;  3P7I A;  1FJG T;  3C98 B;  5AQQ B;  3M3Z B;  3A7M A;  1HX8 A;  3F31 A;  4U7I A;  3KVA A;  3N9L A;  3C51 A;  2N9D A; 
#chains in the Genus database with same CATH homology
 2CCQ A;  1FIO A;  3N9M A;  1U4Q A;  3AAE B;  3N2O A;  4DO0 A;  4QX7 B;  5L3G B;  1US7 B;  4E7Z A;  4IE0 A;  2L8K A;  2C5I T;  1O3X A;  4PJN A;  4P09 A;  3NRX A;  1IJ6 A;  3QC9 A;  4UF0 B;  4HTE A;  3EVY A;  2WAU A;  3QUJ A;  2XQY A;  5JDM A;  2LHN A;  4OK0 A;  2YIN A;  4H9R C;  4O2B E;  4YJ3 E;  5LHG B;  3LBX A;  4H9Q C;  5LCY A;  2HPJ A;  1SA0 E;  2V1D B;  5IYZ E;  5JRC B;  5FY7 A;  2XAF B;  1BR1 A;  1U5P A;  4AXP A;  2CA5 A;  2V7L A;  3ESL A;  3ZPO A;  4KMC A;  3CQC B;  4TV9 E;  5HXE A;  2X68 A;  4EXT A;  1D1A A;  4C91 A;  3J9X 1;  5TAO A;  3KFW X;  3PE0 A;  2ZLY A;  3O1H A;  2PBI A;  3IBP A;  5FP3 A;  4H9P C;  4JEU B;  2X9W A;  3CX8 B;  1Z0P A;  2JRK A;  4UEL A;  4CI3 B;  4IHJ E;  4OHF A;  2I59 A;  3RYH E;  3PUA A;  4AKR B;  2VK9 A;  4PK4 A;  1ZV4 X;  2LEH A;  2Q9Q D;  3ZMZ B;  1WR6 A;  3ZC1 A;  2Y6X A;  1SHZ C;  3FB2 A;  5AFU L;  4JLE A;  3MXZ A;  4ZS3 A;  4MAL A;  1D0Z A;  1MND A;  2PG8 A;  5DQV A;  2Z6E A;  3N5L A;  4CXX A;  3GWH A;  3OYZ A;  2Q9Q A;  2KND A;  4EYU A;  4QWN B;  3RYC E;  3OJA A;  2KT9 A;  4ZI2 C;  3ZC0 A;  2C5K T;  2LSG A;  3GMI A;  3H37 A;  3MJX A;  3UUL A;  3NRY A;  2VB6 A;  1MNE A;  1YW0 A;  4UV8 B;  4GOU A;  3N9N A;  2VAS A;  3K3O A;  5A1L A;  4ASK A;  2XAQ B;  4GYS A;  5FY0 A;  3A5X A;  5JVD E;  4E7S A;  3JC6 D;  1IZN B;  2MOZ A;  1VRB A;  2UXX B;  2DWK A;  3I0Q A;  4QXH B;  4O4H E;  5FYM A;  3UT5 E;  2A3D A;  3O1J A;  2WM9 A;  4BJM A;  2VKJ A;  2LT3 A;  5DQW A;  3RC8 A;  1MIY A;  2DCF A;  4HN9 A;  1HCI A;  1UX5 A;  4UEM A;  3BQL A;  2LE8 A;  3LK3 B;  2WMN A;  3ZYL A;  3O9X A;  4ADZ A;  5JQG E;  5C8Y E;  3ONX A;  4NUV A;  1LVK A;  2V26 A;  3J7Y q;  1ZHC A;  2IC9 A;  3CKD A;  4Z8X A;  4AQG A;  4H63 H;  4TX5 A;  5JR9 A;  3GN5 A;  5EK3 A;  2M67 A;  2EHO D;  5LHI B;  2X66 A;  4ZOL E;  2WBL A;  3QK6 A;  3DTO A;  4HGA A;  1BR2 A;  3NZP A;  5HXH A;  4CQI A;  3AA0 B;  2XAJ B;  4V1A v;  3ZJ1 A;  2N2N A;  3D0T A;  3FBZ A;  2D5U A;  5LXT E;  2RP4 A;  2BVM A;  1MIV A;  5ADX L;  1V9D A;  1FEW A;  3LG7 A;  4UVB B;  4QKN A;  5FY1 A;  2N1G A;  3MKD A;  3PUR A;  4PJJ A;  3AA7 B;  2KZ7 B;  5HXR A;  2CXF A;  3PUG A;  5HYA A;  2EHO B;  5LYJ E;  1CUN A;  3KV5 A;  3E08 A;  1LVF A;  4JEH B;  2LSI A;  4IE5 A;  4GYR A;  1LRZ A;  3R6N A;  4OYK A;  4X20 E;  5F3J A;  4UV9 B;  4J2C A;  5LHH B;  3OYX A;  2GK9 A;  5EK2 A;  4EZH A;  4ISS A;  4YHJ A;  3V5S A;  3ZN0 B;  4KP3 C;  4BAY B;  1HFA A;  4QXB B;  3LBX B;  3UFE A;  3O1I A;  3CML A;  4UXN B;  2A2F X;  2NW7 A;  2XTL A;  4WBO A;  4C90 A;  3AAA B;  4L0R A;  3CVR A;  3N2K E;  5FXW A;  4PNI A;  5FXZ A;  2YK0 A;  3U3I A;  1UX4 A;  2CLY C;  4OYJ A;  5LP6 E;  2J1D G;  2YEV C;  5H6R B;  2OA5 A;  4I50 E;  1G73 A;  4ILU A;  1KK7 A;  2ODV A;  3UTK A;  2W63 A;  4IGU A;  3KBT A;  5HXC A;  1YKH B;  1OXZ A;  2MYS A;  3ETU A;  4H9N C;  2ZM0 A;  2Y8D A;  3ZMT B;  1WRD A;  1WYB A;  2KIN B;  3PUQ A;  4EZ4 A;  3IEE A;  5LA6 E;  1T98 A;  2P9B A;  3V5U A;  1B7T A;  3IHR A;  3LK2 B;  3MA9 A;  2Y48 B;  1MMA A;  4IIJ E;  5FMN A;  1D0Y A;  2H7V C;  3FXD B;  4IE7 A;  4QX8 B;  1UCU A;  1ZEE A;  4X1K E;  5F8P A;  2XUE A;  3LJC A;  5E0O A;  5LJM A;  3C4Z A;  3LFM A;  5L3C B;  4G2A A;  3ZYK A;  5L3E B;  4XBF B;  5DAB A;  4U74 A;  2NW8 A;  3OKQ A;  4DBQ A;  1H7C A;  1E1H B;  5DJQ C;  2EHO A;  2CM0 A;  3AA6 B;  5JDL A;  3ZLI A;  4AKL A;  4O2A E;  3ZYM A;  2KLQ A;  2DHR A;  5L3D B;  1D1B A;  2KWI B;  4A56 A;  3HKD E;  2LSY A;  1AJ3 A;  3BQI A;  3KDS E;  2WMO A;  5FXV A;  5M4Y A;  4H9O C;  3WI3 A;  1EZ3 A;  2KXP B;  4EAH A;  5JRC A;  1D0X A;  2YU1 A;  4BJN A;  3PDY A;  5J2U E;  5JDH A;  4FJO A;  3RYI E;  1WLX A;  5CA1 E;  2CWO A;  3R84 B;  4B6X A;  4PJL A;  1MMG A;  2VKO A;  5FNV E;  1HS7 A;  4AI6 A;  2RA1 A;  3RC3 A;  5L3F B;  2ZMA A;  2ZM8 A;  3GA8 A;  2LOP A;  2EHO C;  1OWA A;  3PUS A;  2V7I A;  5EK4 A;  2K48 A;  1G8X A;  5EZY E;  3ANW B;  4GK0 E;  4HKA A;  4DBR A;  5LGN B;  1FMW A;  3VKH A;  5ETW A;  2B1E A;  3BK9 A;  3RX6 A;  5LNK A;  2LSK A;  2LM9 A;  2XAS B;  2SPC A;  4CXY A;  4HFV A;  3ETV A;  4I43 B;  2CEA A;  3VKG A;  2NWB A;  2BZB A;  3U78 A;  3FBL A;  1BR0 A;  2VKH A;  4O4L E;  2CE7 A;  4DMW A;  3ZMV B;  4JUY A;  5LBQ B;  4IE4 A;  3DJB A;  3AAI A;  1MMN A;  1QUU A;  4HEA A;  3ZMU B;  3TKL B;  2E9X B;  3ZN1 B;  3AA1 B;  2VWA A;  5J1G A;  4GIW A;  4H63 V;  3C4W A;  5LG4 A;  4HE8 A;  2JMH A;  2NP9 A;  2BDE A;  2JMK A;  4ZI2 D;  3F2E A;  3HL6 A;  5LGT B;  3VU7 H;  3CQX C;  2X67 A;  4ZI3 D;  2G0U A;  3SRZ A;  5L3B B;  1NWM X;  2X9X A;  2ES0 A;  3CQG B;  2Q9Q B;  3CX7 B;  2D2S A;  4QXC B;  4WBN E;  2L9Q A;  3RPU A;  3RRC A;  3Q2M A;  4ERR A;  3NZQ A;  2DI4 A;  4EB6 E;  1Y64 B;  3ZJ2 A;  2PFV A;  4M1P A;  2Q9Q C;  2ODU A;  4N78 D;  1X79 A;  4U72 A;  3PTR B;  4PFP A;  3UUX B;  1VOM A;  2H7O A;  4PK6 A;  3NBX X;  3OBV E;  1FMV A;  1S35 A;  3BQK A;  3SOL A;  3L3P A;  2W61 A;  4UF0 A;  4UVA B;  4DMV A;  4EIW A;  4GK5 E;  3HI2 A;  4L5G A;  5KMG P;  2W00 A;  2KWH A;  2W62 A;  5FXX A;  3Q9D A;  4IE6 A;  4YJ2 E;  4YLH A;  4ZS2 A;  2E9X A;  3ZCI A;  2X0L B;  2HH7 A;  4ZI7 E;  1D1C A;  1MMD A;  3EDV A;  4MBQ A;  2E8I A;  5IHY A;  3N2G E;  4P0B A;  3H3A A;  2XAG B;  2YU2 A;  4TN7 B;  3RKO A;  2NOX A;  2MBG A;  4TV8 E;  3C50 A;  3E22 E;  2CXL A;  4EOZ B;  2CXD A;  3MZK B;  3VHL A;  1YD8 G;  5HWY A;  3RH3 A;  5H6Q B;  1HTJ F;  1YKE B;  3HR0 A;  2X9H A;  1LKX A;  1MIW A;  2IW5 B;  2KMF A;  5HWX A;  3I9Y A;  3KV6 A;  2MTQ A;  2LSJ A;  3MK7 C;  5L2L A;  4OFZ A;  2XHE B;  2XAH B;  3KBU A;  4AKG A;  3I1A A;  3PU8 A;  2JPF A;  3ZCJ A;  3HKB E;  3E0Z A;  3GN5 B;  2WWU A;  4AQF A;  4WNK A;  3K3N A;  2QA7 A;  5LOV E;  5CB4 E;  3C4X A;  2CLY B;  3C64 A;  4K0U A;  2V7M A;  2IC6 A;  3SS1 A;  2IAK A;  3N9P A;  4XAX B;  5HXS A;  3FHN A;  1HF8 A;  5J2T E;  4CI2 B;  4DND A;  4PJM A;  4F6R C;  2NTY A;  5CA0 E;  3EUH A;  3UUN A;  2ACX A;  2CWY A;  2C0S A;  1ZKE A;  3Q5W A;  4MHC A;  2DLR A;  2DNX A;  5HAX A;  3KVB A;  2X9Y A;  1QSD A;  4UIG A;  3AB3 B;  3L09 A;  4L9I A;  3T8O A;  4QHO A;  4IST A;  3K3Q C;  3Q5X A;  4YFS A;  2QGS A;  3HKC E;  3AVR A;  4IDZ A;  2CMR A;  5JR9 B;  3CPZ A;  3MAC A;  4KUM B;  4X1I E;  3UUM A;  4TZ4 C;  2H3R A;  3DP7 A;  3JC6 C;  4KBM B;  2V7K A;  2LOS A;  2A72 A;  5LGU B;  1NAF A;  2D0U A;  2LJL A;  3K8P C;  4FI5 A;  4PFO A;  4AQF C;  3F57 A;  4NUU A;  4ANJ A;  5JDG A;  4CZZ B;  5LJN A;  3O4X E;  2E9X D;  3S4U A;  4EYY R;  2JJ9 A;  4PAG A;  3FXE B;  3CWZ B;  3HKE E;  2NTX A;  2BVL A;  3ANW A;  2NW9 A;  4I55 E;  2VKD A;  4CI1 B;  3AVS A;  5JH7 E;  1HG2 A;  2LHR A;  5LBM A;  3PU3 A;  2HPL A;  5BMV E;  3KV4 A;  3SWH A;  4CXW A;  3I0O A;  3IF8 B;  4O8S A;  2X51 A;  4UVC B;  1IAP A;  1HG5 A;  1S94 A;  5JR9 C;  3B57 A;  4TUY E;  2E9X C;  2DWG A;  2W0G A;  3RRW A;  4BA9 A;  3HA4 A;  4DVD A;  3ZMS B;  3N9Q A;  5KX5 E;  2K5B B;  5JDQ A;  4P0A A;  2D0T A;  4O4J E;  2C5J A;  4H9S E;  5JDN A;  1IJ5 A;  4I4T E;  2PJQ A;  4ZI3 C;  3N9O A;  5JDF A;  3RYF E;  4ZHQ E;  4G63 A;  1BR4 A;  2UXN B;  2L3L A;  2ZM2 A;  4PW8 A;  3EDU A;  1KNZ A;  4AKI A;  4PK5 A;  4O4I E;  2VL8 A;  3P8C D;  2JQQ A;  3ZEF B;  2WSS V;  4MLK A;  3KV9 A;  2K24 A;  2V7J A;  3B13 A;  3CX6 B;  3LK4 2;  3W15 B;  4X1Y E;  3WAK A;  5KDM C;  4WW0 A;  1WYC A;  3WAJ A;  4MFR A;  3M65 A;  3I9W A;  5GON E;  5JRE A;  2K9A A;  3KIN B;  4XZC A;  3P7I A;  3C98 B;  4AKH A;  1HX8 A;  3F31 A;  3KVA A;  3N9L A;  3C51 A;  2N9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...