2JMKA

Solution structure of ta0956
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
110
Chain Sequence
b'MTLCAMYNISMAGSHPTTICVVMDRFLESFSELYDIIDENDTDVMMDFISRFARTDEIMPEDKTVGFVVVNADKKLMSVSFSDIDENMKKVIKATAEKFKNKGFKVETDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Ta0956
publication title Solution structure of the hypothetical novel-fold protein TA0956 from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Protein binding
total genus 25
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11513 TA0956 Thermoplasma acidophilum protein TA0956
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1010 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2jmkA00
2K24A 2JMKA
chains in the Genus database with same CATH superfamily
5FY7A 1MNDA 3MJXA 2JQHA 2XAFB 1ZKEA 2BG9B 3N5LA 4AQFC 1HTJF 1XNRT 1XNQT 4HEAA 3AE5A 2CWOA 4IDNA 2YEVC 5JDQA 3CKDA 2ODUA 3TLUA 5JR9B 1AJ3A 3ZT5A 2QA7A 3ZT6A 3HKEE 1N33T 3GWHA 4HWFA 2X0YA 1UX5A 2JQ9A 1YD8G 2Z6EA 4UEMA 3FZFB 2JMHA 3CK6A 3I9WA 3EDVA 2XHEB 3GMIA 3OVUA 3U78A 2UXNB 5JH7E 2WWUA 5DABA 5AQSB 3IF8B 3HKBE 2VWAA 4M1PA 4IT4A 2K48A 3FBZA 2PBIA 3Q5XA 1D0XA 5L3EB 5HYAA 3CIRA 5CA0E 3L8RA 2A3DA 4KP3C 4DV6T 2IW5B 2LSKA 3DTOA 1UGOA 3AA6B 5JTGA 3RHWA 4IDOA 4IE0A 1YKHB 2UU9T 4CXYA 3AXJB 3LJCA 5AQUB 5HCJA 3CQCB 5J2UE 2KWIB 2IC9A 5AQRB 4ZZCA 2X68A 3AE4A 3L3PA 4DR5T 4B3RT 3O9XA 1HFAA 2V7IA 3EAMA 3UFEA 3FXEB 2W4XA 1D0YA 5HXHA 4NUVA 5LJMA 5L3BB 4X1YE 3FZHB 5L2LA 4DVDA 3GN5A 2KLQA 2XUEA 4ZXLA 2Q9QC 2WB5A 1EZ3A 3RRCA 4JI4T 1IJ5A 2CHNA 5LMNT 2VKHA 4OHFA 3NKZA 2WDRA 2YDRA 1E2AA 4GKJT 4JEUB 3UU3A 2DHRA 3AA1B 2D0TA 2CEAA 4MHCA 2AXDS 3OKQA 2FJEA 1UK5A 4YY3T 2XASB 1H7CA 3EDUA 2Q9QD 4I4TE 4I55E 4X62T 2LLYA 2YU2A 2W66A 3CQGB 3B57A 1BR4A 3N9NA 2CWYA 2LHRA 1LRZA 2CRBA 4ZI3D 4AKGA 4IREA 2HPLA 3QNUA 3NRXA 2J62A 4JUYA 3CX8B 3MACA 3C4ZA 3W15B 5BR8T 5LA6E 3BQLA 4JLEA 1HG5A 4YXDA 2XQYA 1N34T 4LF5T 1HG2A 5HAXA 5JVDE 4U7IA 4ISTA 3KINB 3KVBA 3SWHA 4H9SE 2V7KA 3N9MA 2LM9A 2BKNA 3M65A 4JI0T 2ZM6T 4LF4T 1XDOA 3E08A 3C51A 4JV5T 5HCMA 1QSDA 3ZMZB 2K24A 4IDPA 4AQGA 5F5WA 2JRKA 3QUJA 4CQIA 5ABFB 2L3LA 2M6IA 1SUMB 2XSAA 4HTEA 2VB6A 3RX6A 4HFCA 2H7VC 5AQHB 5LYJE 2ZM2A 2LSYA 4WNKA 4CN6A 4YFSA 2NW9A 3ZEFB 3I1AA 3AA7B 3L09A 4UVBB 2ACZA 3R84B 4DR7T 2BKOA 2H3RA 2JPFA 2CMRA 4YSZA 5LHHB 1MNEA 5AQVB 1W09A 4GOUA 5JRCA 3PUSA 4PK4A 3RF1A 1D1AA 2PFVA 2NR4A 4KHZF 1V9DA 4ZS3A 4NUUA 4P09A 3J7Yq 3KV4A 1LVKA 2UXXB 4O8SA 4YSYA 2KMFA 1OWAA 1WYCA 4JI2T 4HWHA 5FVKA 5H6RB 3C4XA 2D5UA 5L4EA 1FMWA 5FXZA 5CGMA 3EVYA 2KT9A 2LSGA 5JDFA 5AQTB 4UR9A 2ODVA 4LMJA 4DBRA 4H9RC 2XAQB 3RKOA 3PE0A 2CBIA 4K0UA 3P4RA 4JBWF 2Y8DA 4CN4A 2VK9A 3HL6A 3MXZA 2X9WA 2WWVA 3E22E 2UUAT 3VKHA 2CCQA 2KZ7B 3UUMA 3EI0A 4X64T 2I0MA 4CN1A 1XWMA 3PJAJ 1KFYA 3OPCA 2X9XA 3PU8A 4NXNT 2Q9QB 4XAXB 1T98A 2M6BA 2LOSA 2KSRA 2XQ4A 3LK3B 2CXDA 1JNRA 5CJ5A 3AE7A 4WW0A 1XDPA 3ZN1B 3NVOA 2MTQA 5KX5E 3VR9A 3RYCE 2BKPA 4EYUA 3RIUC 3N9LA 3QOFA 2V6XA 4PK6A 3Q5WA 3RQUA 4CXWA 3PUZF 3AEEA 3K8PC 5ABGA 5EK3A 1J5ET 1MMNA 4TUYE 3HKDE 4I0UA 1IBMT 3RIAA 3F57A 2BS2A 2DWGA 4TWFA 2BS4A 4MLKA 3RH3A 3JADA 4IE6A 1IJ6A 4ILCA 3JC6C 5FXWA 3A5XA 1KK7A 3UUNA 2XAHB 2YKSA 5FY1A 3AAEB 3C50A 4J2CA 2VVNA 1G8XA 4HFDA 2W2UA 3KBTA 1QLBA 4AISA 5AQOB 3PUAA 2XAGB 2HHHT 5LJNA 2CXFA 5AQGB 3HI2A 2XZEA 1MIVA 4DR4T 2W62A 2L8KA 2YINA 3RGLA 3P4WA 4JI8T 2EHOA 1IZNB 3DP7A 3IBPA 2BVMA 5TAOA 3PDYA 3N2OA 4ILBA 2YDQA 3ZSSA 4UXNB 1OXZA 4H63H 3VR8A 3IHRA 3A8YC 3LK2B 2WZIA 4JI3T 2A2FX 4EB6E 5LGTB 2JMKA 2KINB 4WYVA 4DUZT 2WMOA 2LSJA 5FL1A 5IWAT 3OYXA 1ZV4X 3OBVE 3KFWX 3WI3A 3JAFA 4A97A 5AQKB 2LJLA 4XZCA 3PU3A 1SA0E 4UVCB 4DV3T 2AE9A 5CA1E 1E1HB 4WZXA 5LG4A 1NENA 3PJAA 5F8PA 1VOMA 1B7TA 2X9YA 5HXCA 5L4HA 5HXSA 3FBLA 4HFVA 3IEEA 2E8IA 5L47A 2E5VA 3ZMTB 3AEBA 4NPPA 4O4JE 2LM2A 1LKXA 5ABEA 4DMVA 2VQFT 2RA1A 2HN2A 3TKLB 2B1EA 3MA9A 3X1DA 2CPTA 1X9BA 1WRDA 2N1GA 4ZI2C 5IHYA 3P8CD 4L5GA 2IAKA 1CUNA 2NW7A 2DL1A 4ERRA 4TWHA 3AAIA 4LFBT 4EZHA 5JDNA 3SRZA 5KMGP 2LHNA 5AQLB 5C8YE 3LK42 2IC6A 4X1KE 3H3MA 3FZLB 3PUWF 4ZI2D 5HEGA 5KDMC 4TV8E 4O2AE 3PURA 3AE2A 2XQ9A 4IDZA 3LG7A 4Z91A 3UFGA 2MYSA 5J1GA 2V5CA 2FUPA 3ZLIA 4ADZA 4TNVA 3OTOT 4AI6A 4A98A 2V8SV 4HFEA 2XQ7A 4LMKA 3NZPA 5JRCB 3Q5DA 3ZN0B 4JYAT 4LF6T 4UF0A 1YKEB 1N36T 3V5SA 4ZI3C 5LBQB 2WBLA 1HR0T 2LOPA 3VU7H 4QXHB 1SE7A 1OEDA 4PFOA 3BK9A 4OFZA 1HF8A 4YSXA 4TX5A 4IHJE 3UQ7A 4IIJE 5LHIB 2BG9A 3ONXA 1M62A 3TLVA 2VKOA 1J1JA 5DQVA 3HKCE 3TLTA 3ETUA 3ZJ2A 1ZEEA 1SHZC 3LBXA 3JAEA 2FBWA 1GQEA 1KNRA 5JDHA 2D9DA 3JCFA 1KEYA 2CHOA 1Y64B 3I0OA 3AE6A 2G0UA 4CI1B 5JR9A 4U7YA 4CZZB 2NW8A 3I0QA 3QC9A 3VRBA 1W0BA 3B5MA 1ZHCA 4C90A 2L9QA 3Q9DA 3AE8A 2A72A 1YQ3A 3K3NA 3ZSTA 3PTRB 4U74A 4MFRA 1T8BA 1NEKA 3CVRA 4ZOLE 1O3XA 4XBFB 3KV5A 4GK0E 4AXPA 2BDEA 4TWDA 4AKRB 1IBLT 3O1HA 4C91A 2X66A 4DBQA 4TV9E 4QHOA 1G73A 2NTYA 2Y6XA 2XSBA 4GIWA 2WMNA 2LRKA 4O4LE 4OYJA 4DO0A 3ONJA 2VL8A 1UX4A 4JEHB 2UUBT 2UUCT 3ZC0A 4E7SA 5C3JA 1ZOYA 2WDVA 4LFAT 4CI2B 5LBMA 4QXBB 3ZC1A 1MIWA 2K9AA 4EOZB 3NZQA 1OEDE 5JQGE 1M7KA 2IMLA 1UUSA 3FZMB 5AQPB 5A1LA 3C98B 1WFDA 2W63A 3P50A 2I59A 2BG9E 5FXXA 1HNXT 3K1SA 4YHJA 4P0AA 2B76A 2LE8A 2CLYB 5ABHA 1Z8UA 5FVLA 2FJDA 4OYKA 2QVAA 5AQNB 2LEHA 2RP4A 1Z0PA 4ZHQE 2UXCT 3KV9A 3TLSA 3QK6A 4LFCT 3Q2MA 3C4WA 4AKIA 2BZBA 3PUXF 5AQFB 1MMGA 5LB7B 2VVSA 3UULA 4YJ2E 4PW8A 4EEBA 4HWCA 4UV9B 4CXXA 1WCRA 2F4VT 3AECA 4HWIB 5EK2A 2WM9A 2E9XA 4X65T 4GKKT 4H9PC 3LDQB 2C5JA 2SPCA 3P7IA 2V26A 3L39A 4N78D 3KV6A 4JI7T 1CHUA 3O4XE 3PUQA 2JJ9A 4DV2T 4B3MT 5AQJB 4V1Av 3N9OA 4DR2T 4KMCA 1VCSA 3ZKRA 3AEGA 2V7MA 2HN1A 4L0RA 2V5DA 2LT3A 4WBNE 5J2TE 1HX8A 3WAKA 3SOLA 2IIUA 4NXMT 4B3ST 5HWYA 5JDGA 4AQFA 4COFA 2YDSA 4FJOA 4GYSA 3WAJA 4Z8XA 5FY0A 3T1YT 2BS3A 2PG8A 2WSSV 3AEFA 1BR2A 3T8OA 2FJAA 5ABFA 1MMAA 1W0AA 4EV6A 4BJMA 1JNZA 5EZYE 5LMUT 4BJNA 1MIYA 2P9BA 2MAWA 2JIWA 3AB3B 3UU8A 2QGSA 1KNZA 4I50E 3O1IA 4H9NC 1US7B 2RPAA 4X66T 1U4QA 1UCUA 3LFMA 3GN5B 1D1BA 2XTLA 4H9OC 5LG3A 1ZP0A 5LNKA 1DU2A 3P4QA 4HN9A 2CE7A 3ZCJA 4LF7T 2WAUA 3ZCIA 4BA9A 1LVFA 1W9RA 3UTKA 5HEUA 4F8HA 3ABVA 3ZMSB 5E0OA 4UF0B 1YXRA 4X20E 4YTNA 2E9XD 2XPKA 3EHZA 4QKNA 5JREA 2YK0A 5LP6E 2Y48B 3RC3A 5FNVE 2PTFA 1OEDB 2VQET 4DNDA 2D0UA 2XQ3A 3UU6A 5L3FB 3EUHA 2W67A 2ZLYA 1R8IA 4P1NA 4QX8B 3ZT7A 2J1DG 3ONLC 3G06A 4KHPT 3HA4A 3OJAA 3FHNA 5FXVA 3CWZB 3LBXB 5AQIB 3Q5EA 5FL0A 2WU5A 1IBKT 4I43B 4DMWA 2A9UA 3BQIA 3PUGA 1MMDA 2DI4A 2H7OA 2ZM0A 1L0VA 1S94A 5J0ZA 2V7JA 4O4HE 4NIQA 3N2KE 2Q9QA 3DJBA 2J4GA 3E0ZA 2WY2A 3IA3A 4HWDA 2LKGA 5IYZE 4KUMB 4PNIA 2WDQA 2EHOC 2CLYC 3UUBA 3OYZA 3KVAA 4UELA 4B6XA 3ZPOA 2VASA 4ILUA 2CBJA 4WBOA 3ZMUB 1XZYA 2YOEA 1HCIA 4OK0A 4AKLA 4IL4A 1Y01A 2EHOD 2NP9A 3PUVF 4QWNB 2MPKA 1U5PA 5HXRA 3C64A 2XAJB 3FZKB 4U2ZA 4AKHA 5HEJA 5GONE 2ACXA 4A56A 2V6YA 2XM1A 4DUYT 5FP3A 4U31A 3RYFE 2H89A 1BR1A 3ANWA 3AA0B 2OV9A 2HPJA 3RYHE 2I6HA 2XM2A 1XMQT 1I94T 2BVLA 1NAFA 4GK5E 1T72A 5FYMA 3F2EA 2XQ5A 4YJ3E 3KDSE 3P4SA 3P4PA 5LOVE 3S4UA 3AE9A 3RIFA 3ZYLA 4IGUA 2E5LT 3FXDB 5FMNA 3UU4A 3ZMVB 1X79A 4ZI7E 5H6QB 2NTXA 4P0BA 5M4YA 3U3IA 2W0GA 3AE3A 2CXLA 4EAHA 2W61A 5ETWA 3SFEA 2C5IT 1KNPA 4LF9T 1FMVA 3D0TA 2C5KT 5JDMA 3RPUA 1FIOA 3I9YA 5FKYA 1VRBA 2MOZA 4U3CA 3MKDA 5LHGB 2N9DA 3UUXB 4DV1T 4IL9A 4EXTA 5ADXL 4G2AA 4EGWA 5L3CB 2ES0A 3MZKB 5LGNB 2WS3A 2X9HA 2E9XB 4PJNA 1BR0A 4YTPA 3FB2A 4U2YA 4BAYB 3RI5A 2R6GF 1D0ZA 3T1HT 5IUXA 3NWIA 3HR0A 3SFDA 4YT0A 3A7MA 4DR3T 4PAGA 5LCYA 1E7PA 5LGUB 3VHLA 2OLTA 5DJQC 5AQQB 3CMLA 2KXPB 2WQYA 3N9QA 2QRXA 3KBUA 3F31A 5HXEA 4EZ4A 1HX1B 2YN6A 4JI6T 4ISSA 5L3GB 4DV4T 4DIDB 5LXTE 4ZZBA 2DCFA 5HEOA 1YQ4A 2VL0A 3K3QC 4QH1A 4EEDA 3AAAB 1HS7A 4X5TA 1D1CA 2CA5A 2ZMAA 3UQ4A 2WCAA 4PJLA 3CX6B 4IE7A 5AQMB 2LRLA 3NBXX 4PJMA 2XJ7A 1VCTA 2DWKA 1OEDC 2XQAA 3AXJA 4L9IA 4HGAA 2BG9C 3TLWA 3ZYMA 5F3JA 4IE5A 2DLRA 3AVRA 3AEDA 3ETVA 4UV8B 2WP9A 3H37A 3VKGA 2KNDA 3CQXC 2PJQA 3QB5K 5JR9C 1HNZT 2EHOB 4IDQA 5EK4A 4QH5A 2JQQA 3AEAA 4K0KT 5CB4E 1UURA 4IE4A 4LF8T 4JI5T 1WLXA 2K5BB 3RIUA 4DV5T 4ZEYA 4ASKA 2XY8B 3O1JA 4TNWA 4E7ZA 4LMLA 2NOXA 2W00A 5HEHA 5L3DB 2BBHA 3NRYA 2GK9A 1QUUA 4QH4A 4DV0T 3J9X1 2IHR1 3BQKA 2JQKA 2LSIA 1FEWA 4F6RC 2X51A 1J5WA 2D2SA 2M67A 4YLHA 3RQWA 4PJJA 2MBGA 4YHHT 2FJBA 2IDOB 2J47A 3MK7C 2HH7A 2YU1A 2BBJA 4G63A 4QXCB 3RKGA 4HFBA 4DV7T 2QYWA 3VRAA 2X67A 3RLFF 4X1IE 2WZHA 1N32T 3CX7B 4QX7B 4DR6T 3LSVA 2OA5A 1IAPA 4A5XA 2X0HA 1WR0A 4MBQA 1WR6A 3PV0F 1S35A 2UXDT 4UIGA 1I6ZA 1T7SA 3GA8A 3UU5A 3H3AA 5KXJA 4MALA 3RYIE 2NWBA 1WYBA 5AFUL 3N2GE 4Q25A 4U33A 1NWMX 4GYRA 1XMOT 5JDLA 2DNXA 3RRWA 1FJGT 3SS1A 3UT5E 2ZM8A 4YTMA 4HFHA 2VKDA 4OX9T 3N9PA 2VKJA 4Z90A 3QB5A 3CPZA 4HKAA 2KWHA 2C0SA 4FI5A 2V1DB 4KX6A 3B13A 4O4IE 2E2AA 4AQYT 3PUYF 2IUBA 2V6YB 1KF6A 3M3ZB 3RC8A 4ANJA 4EYYR 3K3OA 2V7LA 4B3TT 2K3WA 4H9QC 5CFBA 4UVAB 4HFIA 5HWXA 1YW0A 3ANWB 4PK5A 2E9XC 4CI3B 4KI0F 4ILAA 3V5UA 2LKHA 2VURA 3ESLA 3JC6D 2XQ8A 4O2BE 4U72A 4ZS2A 4HE8A 2CM0A 4PFPA 4AIUA 5BMVE 3AE1A 4TN7B 3ZJ1A 4TZ4C 5C2TA 5DQWA 3R6NA 2N2NA 2X0LB 4JI1T 2H88A 4H63V 2XQ6A 4EIWA 2WU2A 3AVSA 4KBMB 3ZYKA 3EABA 4DR1T 1HNWT 2UXBT
chains in the Genus database with same CATH topology
4GK5E 2Q9QB 5FY7A 1MNDA 5FYMA 3F2EA 4XAXB 1T98A 3MJXA 4GIWA 4YJ3E 2XAFB 3KDSE 2LOSA 5LOVE 1ZKEA 3S4UA 3LK3B 2CXDA 2WMNA 4O4LE 4OYJA 3N5LA 3ZYLA 4AQFC 4IGUA 4DO0A 3FXDB 2VL8A 4WW0A 5FMNA 1UX4A 3ZMVB 3ZN1B 1HTJF 4JEHB 1X79A 4ZI7E 5H6QB 2MTQA 2NTXA 4P0BA 4E7SA 5KX5E 3ZC0A 5M4YA 3U3IA 2W0GA 4HEAA 2CXLA 3RYCE 2CWOA 4EAHA 2YEVC 5JDQA 3CKDA 2ODUA 2W61A 5ETWA 4CI2B 2C5IT 5JR9B 5LBMA 4EYUA 1AJ3A 4QXBB 3ZC1A 1MIWA 2K9AA 3N9LA 4EOZB 1FMVA 2QA7A 3NZQA 3HKEE 5JQGE 3GWHA 4PK6A 3D0TA 3Q5WA 2C5KT 5JDMA 4CXWA 3RPUA 1UX5A 1FIOA 3K8PC 5A1LA 3I9YA 1VRBA 1YD8G 2MOZA 2Z6EA 3C98B 5EK3A 1MMNA 4UEMA 4TUYE 3HKDE 2W63A 3MKDA 5LHGB 2N9DA 3F57A 2I59A 2JMHA 3UUXB 2DWGA 5FXXA 4MLKA 3RH3A 3I9WA 4EXTA 4IE6A 1IJ6A 3EDVA 5ADXL 2XHEB 3GMIA 4YHJA 3JC6C 4G2AA 4P0AA 5FXWA 2LE8A 3A5XA 2CLYB 5L3CB 1KK7A 2ES0A 3MZKB 3UUNA 3U78A 2XAHB 4OYKA 2UXNB 5JH7E 2WWUA 5FY1A 5LGNB 2LEHA 5DABA 3IF8B 3AAEB 3C50A 3HKBE 2VWAA 2RP4A 1Z0PA 4M1PA 4J2CA 2X9HA 4ZHQE 1G8XA 3KV9A 2K48A 2E9XB 4PJNA 1BR0A 3FBZA 3FB2A 2PBIA 3Q5XA 4BAYB 3KBTA 3QK6A 1D0XA 3Q2MA 1D0ZA 5L3EB 5HYAA 3PUAA 2XAGB 5CA0E 3C4WA 4AKIA 2BZBA 3HR0A 5LJNA 2CXFA 1MMGA 2A3DA 4PAGA 4KP3C 5LCYA 3UULA 5LGUB 4YJ2E 3HI2A 3VHLA 2IW5B 1MIVA 4PW8A 2LSKA 3DTOA 5DJQC 2W62A 2L8KA 3CMLA 2YINA 4UV9B 3AA6B 4CXXA 2EHOA 1IZNB 2KXPB 4IE0A 1YKHB 4CXYA 3DP7A 3IBPA 3N9QA 2BVMA 3KBUA 3F31A 5EK2A 5HXEA 4EZ4A 3LJCA 3CQCB 2WM9A 1G73A 5TAOA 5J2UE 2E9XA 2KWIB 4H9PC 3PDYA 4ISSA 2C5JA 3N2OA 2IC9A 5L3GB 2SPCA 3P7IA 2X68A 4UXNB 3L3PA 5LXTE 1OXZA 2DCFA 4H63H 3K3QC 2V26A 3IHRA 4N78D 3O9XA 3AAAB 3KV6A 1HFAA 2V7IA 1HS7A 1D1CA 3UFEA 2CA5A 3LK2B 2ZMAA 3FXEB 3O4XE 4PJLA 3CX6B 2A2FX 4EB6E 5LGTB 1D0YA 4IE7A 2JMKA 2KINB 3PUQA 5HXHA 2JJ9A 3NBXX 4NUVA 2WMOA 2LSJA 4PJMA 4X1YE 5L3BB 5LJMA 2DWKA 5L2LA 4DVDA 3GN5A 3OYXA 2KLQA 1ZV4X 2XUEA 3OBVE 3KFWX 2Q9QC 4V1Av 3WI3A 3N9OA 1EZ3A 4L9IA 3RRCA 4KMCA 1IJ5A 2LJLA 2VKHA 4HGAA 4OHFA 4XZCA 3ZYMA 3PU3A 1SA0E 4UVCB 2V7MA 4JEUB 4L0RA 1E1HB 5CA1E 5F3JA 2LT3A 2DHRA 4WBNE 4IE5A 2DLRA 3AA1B 3AVRA 5J2TE 5LG4A 1HX8A 3WAKA 5F8PA 3SOLA 3ETVA 2D0TA 4UV8B 2CEAA 4MHCA 1VOMA 3OKQA 3H37A 3VKGA 2KNDA 1B7TA 5HWYA 5JDGA 2X9YA 3CQXC 2PJQA 4AQFA 3WAJA 4FJOA 4GYSA 5HXCA 2XASB 4Z8XA 5HXSA 1H7CA 3EDUA 2Q9QD 4I4TE 5FY0A 3FBLA 2PG8A 2WSSV 4I55E 1BR2A 5JR9C 4HFVA 3T8OA 3IEEA 2E8IA 2EHOB 1MMAA 5EK4A 2JQQA 3ZMTB 2YU2A 3CQGB 5CB4E 3B57A 4IE4A 1BR4A 4O4JE 3N9NA 1LKXA 2CWYA 1WLXA 4BJMA 2LHRA 2K5BB 1LRZA 4ZI3D 4AKGA 4DMVA 5EZYE 2HPLA 3NRXA 2RA1A 3TKLB 4ASKA 4JUYA 4BJNA 2B1EA 1MIYA 3MA9A 2P9BA 3O1JA 4E7ZA 3CX8B 3MACA 3AB3B 2NOXA 1WRDA 2W00A 2N1GA 3C4ZA 5L3DB 3W15B 4ZI2C 2QGSA 3NRYA 5IHYA 1KNZA 2GK9A 1QUUA 3P8CD 4L5GA 5LA6E 2IAKA 3J9X1 3BQLA 4JLEA 1HG5A 1CUNA 4I50E 3BQKA 2NW7A 2XQYA 3O1IA 4H9NC 1HG2A 5HAXA 4ERRA 1US7B 5JVDE 1U4QA 1UCUA 3AAIA 4EZHA 2LSIA 3LFMA 5JDNA 3GN5B 1D1BA 3SRZA 4ISTA 2XTLA 4H9OC 3KINB 1FEWA 4F6RC 5KMGP 3KVBA 2X51A 2LHNA 3SWHA 4H9SE 5LNKA 2D2SA 2V7KA 5C8YE 2M67A 3LK42 3N9MA 4YLHA 4HN9A 2CE7A 2LM9A 2IC6A 4PJJA 3ZCJA 2WAUA 3ZCIA 4BA9A 1LVFA 4X1KE 2MBGA 3M65A 3UTKA 3MK7C 2HH7A 3ZMSB 4ZI2D 2YU1A 5E0OA 4UF0B 5KDMC 4G63A 4QXCB 4TV8E 4O2AE 4X20E 2E9XD 3E08A 3PURA 3C51A 4QKNA 4IDZA 3LG7A 5JREA 1QSDA 2X67A 2YK0A 3ZMZB 5LP6E 3PU8A 2MYSA 4X1IE 5J1GA 2K24A 3ZLIA 2Y48B 4ADZA 3RC3A 3CX7B 4AQGA 2JRKA 5FNVE 3QUJA 4QX7B 4CQIA 4AI6A 2L3LA 2OA5A 1IAPA 4HTEA 4DNDA 2D0UA 3NZPA 2VB6A 3RX6A 5JRCB 2H7VC 4MBQA 5L3FB 5LYJE 1WR6A 3EUHA 2ZM2A 2ZLYA 3ZN0B 2LSYA 4WNKA 1S35A 4UIGA 4QX8B 2J1DG 3GA8A 4YFSA 3HA4A 2NW9A 4UF0A 3OJAA 3H3AA 3ZEFB 3I1AA 1YKEB 3FHNA 3AA7B 3L09A 3CWZB 4MALA 5FXVA 3LBXB 3RYIE 3V5SA 4ZI3C 2NWBA 5LBQB 2WBLA 1WYBA 5AFUL 4I43B 3N2GE 1NWMX 4DMWA 3BQIA 4GYRA 2LOPA 3PUGA 4UVBB 1MMDA 3VU7H 2DI4A 3R84B 4QXHB 2H7OA 2ZM0A 5JDLA 2DNXA 3RRWA 1S94A 2H3RA 2JPFA 2V7JA 3SS1A 3UT5E 2CMRA 4O4HE 4PFOA 5LHHB 3BK9A 2ZM8A 4OFZA 3N2KE 2Q9QA 1MNEA 1HF8A 2VKDA 3DJBA 4TX5A 4IHJE 4GOUA 3N9PA 5JRCA 2VKJA 3PUSA 4IIJE 4PK4A 5LHIB 1D1AA 3ONXA 2PFVA 3E0ZA 3CPZA 4HKAA 2KWHA 2C0SA 4FI5A 2V1DB 2VKOA 1V9DA 3B13A 4O4IE 5IYZE 5DQVA 3HKCE 4KUMB 4PNIA 4ZS3A 4NUUA 4P09A 3ETUA 3J7Yq 3ZJ2A 1ZEEA 2EHOC 1SHZC 3RC8A 3LBXA 2CLYC 3KV4A 4ANJA 4EYYR 3K3OA 1LVKA 2UXXB 2V7LA 4H9QC 4O8SA 4UVAB 5JDHA 5HWXA 1YW0A 2KMFA 3KVAA 3OYZA 1Y64B 3ANWB 3I0OA 1OWAA 4PK5A 1WYCA 2G0UA 4UELA 4CI1B 4B6XA 5JR9A 3ZPOA 2VASA 5H6RB 2E9XC 3C4XA 4ILUA 4CI3B 2D5UA 4WBOA 2NW8A 3ZMUB 3I0QA 4CZZB 3QC9A 1FMWA 3V5UA 5FXZA 1HCIA 4OK0A 4AKLA 1ZHCA 4C90A 3EVYA 2KT9A 2LSGA 3ESLA 2L9QA 3JC6D 5JDFA 4O2BE 3Q9DA 4U72A 4ZS2A 2A72A 4HE8A 2EHOD 2NP9A 4QWNB 2CM0A 2ODVA 4PFPA 1U5PA 5HXRA 4DBRA 3K3NA 4H9RC 3C64A 2XAJB 3PTRB 5BMVE 4U74A 2XAQB 3RKOA 4TN7B 4AKHA 5GONE 2ACXA 3PE0A 4A56A 4K0UA 4MFRA 3ZJ1A 4TZ4C 5DQWA 3R6NA 2N2NA 2Y8DA 3CVRA 2X0LB 4ZOLE 2VK9A 1O3XA 4H63V 5FP3A 3HL6A 3RYFE 3MXZA 2X9WA 4XBFB 3KV5A 1BR1A 3E22E 4EIWA 4GK0E 4AXPA 3AVSA 4KBMB 3ANWA 3VKHA 3ZYKA 3AA0B 2BDEA 2CCQA 2KZ7B 3UUMA 4AKRB 2HPJA 3O1HA 3RYHE 4C91A 2X66A 4DBQA 4TV9E 4QHOA 2NTYA 2X9XA 2BVLA 2Y6XA 1NAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K24 A;  2JMK A; 
#chains in the Genus database with same CATH topology
 5FY7 A;  1MND A;  3MJX A;  2JQH A;  2XAF B;  1ZKE A;  2BG9 B;  3N5L A;  4AQF C;  1HTJ F;  1XNR T;  1XNQ T;  4HEA A;  3AE5 A;  2CWO A;  4IDN A;  2YEV C;  5JDQ A;  3CKD A;  2ODU A;  3TLU A;  5JR9 B;  1AJ3 A;  3ZT5 A;  2QA7 A;  3ZT6 A;  3HKE E;  1N33 T;  3GWH A;  4HWF A;  2X0Y A;  1UX5 A;  2JQ9 A;  1YD8 G;  2Z6E A;  4UEM A;  3FZF B;  2JMH A;  3CK6 A;  3I9W A;  3EDV A;  2XHE B;  3GMI A;  3OVU A;  3U78 A;  2UXN B;  5JH7 E;  2WWU A;  5DAB A;  5AQS B;  3IF8 B;  3HKB E;  2VWA A;  4M1P A;  4IT4 A;  2K48 A;  3FBZ A;  2PBI A;  3Q5X A;  1D0X A;  5L3E B;  5HYA A;  3CIR A;  5CA0 E;  3L8R A;  2A3D A;  4KP3 C;  4DV6 T;  2IW5 B;  2LSK A;  3DTO A;  1UGO A;  3AA6 B;  5JTG A;  3RHW A;  4IDO A;  4IE0 A;  1YKH B;  2UU9 T;  4CXY A;  3AXJ B;  3LJC A;  5AQU B;  5HCJ A;  3CQC B;  5J2U E;  2KWI B;  2IC9 A;  5AQR B;  4ZZC A;  2X68 A;  3AE4 A;  3L3P A;  4DR5 T;  4B3R T;  3O9X A;  1HFA A;  2V7I A;  3EAM A;  3UFE A;  3FXE B;  2W4X A;  1D0Y A;  5HXH A;  4NUV A;  5LJM A;  5L3B B;  4X1Y E;  3FZH B;  5L2L A;  4DVD A;  3GN5 A;  2KLQ A;  2XUE A;  4ZXL A;  2Q9Q C;  2WB5 A;  1EZ3 A;  3RRC A;  4JI4 T;  1IJ5 A;  2CHN A;  5LMN T;  2VKH A;  4OHF A;  3NKZ A;  2WDR A;  2YDR A;  1E2A A;  4GKJ T;  4JEU B;  3UU3 A;  2DHR A;  3AA1 B;  2D0T A;  2CEA A;  4MHC A;  2AXD S;  3OKQ A;  2FJE A;  1UK5 A;  4YY3 T;  2XAS B;  1H7C A;  3EDU A;  2Q9Q D;  4I4T E;  4I55 E;  4X62 T;  2LLY A;  2YU2 A;  2W66 A;  3CQG B;  3B57 A;  1BR4 A;  3N9N A;  2CWY A;  2LHR A;  1LRZ A;  2CRB A;  4ZI3 D;  4AKG A;  4IRE A;  2HPL A;  3QNU A;  3NRX A;  2J62 A;  4JUY A;  3CX8 B;  3MAC A;  3C4Z A;  3W15 B;  5BR8 T;  5LA6 E;  3BQL A;  4JLE A;  1HG5 A;  4YXD A;  2XQY A;  1N34 T;  4LF5 T;  1HG2 A;  5HAX A;  5JVD E;  4U7I A;  4IST A;  3KIN B;  3KVB A;  3SWH A;  4H9S E;  2V7K A;  3N9M A;  2LM9 A;  2BKN A;  3M65 A;  4JI0 T;  2ZM6 T;  4LF4 T;  1XDO A;  3E08 A;  3C51 A;  4JV5 T;  5HCM A;  1QSD A;  3ZMZ B;  2K24 A;  4IDP A;  4AQG A;  5F5W A;  2JRK A;  3QUJ A;  4CQI A;  5ABF B;  2L3L A;  2M6I A;  1SUM B;  2XSA A;  4HTE A;  2VB6 A;  3RX6 A;  4HFC A;  2H7V C;  5AQH B;  5LYJ E;  2ZM2 A;  2LSY A;  4WNK A;  4CN6 A;  4YFS A;  2NW9 A;  3ZEF B;  3I1A A;  3AA7 B;  3L09 A;  4UVB B;  2ACZ A;  3R84 B;  4DR7 T;  2BKO A;  2H3R A;  2JPF A;  2CMR A;  4YSZ A;  5LHH B;  1MNE A;  5AQV B;  1W09 A;  4GOU A;  5JRC A;  3PUS A;  4PK4 A;  3RF1 A;  1D1A A;  2PFV A;  2NR4 A;  4KHZ F;  1V9D A;  4ZS3 A;  4NUU A;  4P09 A;  3J7Y q;  3KV4 A;  1LVK A;  2UXX B;  4O8S A;  4YSY A;  2KMF A;  1OWA A;  1WYC A;  4JI2 T;  4HWH A;  5FVK A;  5H6R B;  3C4X A;  2D5U A;  5L4E A;  1FMW A;  5FXZ A;  5CGM A;  3EVY A;  2KT9 A;  2LSG A;  5JDF A;  5AQT B;  4UR9 A;  2ODV A;  4LMJ A;  4DBR A;  4H9R C;  2XAQ B;  3RKO A;  3PE0 A;  2CBI A;  4K0U A;  3P4R A;  4JBW F;  2Y8D A;  4CN4 A;  2VK9 A;  3HL6 A;  3MXZ A;  2X9W A;  2WWV A;  3E22 E;  2UUA T;  3VKH A;  2CCQ A;  2KZ7 B;  3UUM A;  3EI0 A;  4X64 T;  2I0M A;  4CN1 A;  1XWM A;  3PJA J;  1KFY A;  3OPC A;  2X9X A;  3PU8 A;  4NXN T;  2Q9Q B;  4XAX B;  1T98 A;  2M6B A;  2LOS A;  2KSR A;  2XQ4 A;  3LK3 B;  2CXD A;  1JNR A;  5CJ5 A;  3AE7 A;  4WW0 A;  1XDP A;  3ZN1 B;  3NVO A;  2MTQ A;  5KX5 E;  3VR9 A;  3RYC E;  2BKP A;  4EYU A;  3RIU C;  3N9L A;  3QOF A;  2V6X A;  4PK6 A;  3Q5W A;  3RQU A;  4CXW A;  3PUZ F;  3AEE A;  3K8P C;  5ABG A;  5EK3 A;  1J5E T;  1MMN A;  4TUY E;  3HKD E;  4I0U A;  1IBM T;  3RIA A;  3F57 A;  2BS2 A;  2DWG A;  4TWF A;  2BS4 A;  4MLK A;  3RH3 A;  3JAD A;  4IE6 A;  1IJ6 A;  4ILC A;  3JC6 C;  5FXW A;  3A5X A;  1KK7 A;  3UUN A;  2XAH B;  2YKS A;  5FY1 A;  3AAE B;  3C50 A;  4J2C A;  2VVN A;  1G8X A;  4HFD A;  2W2U A;  3KBT A;  1QLB A;  4AIS A;  5AQO B;  3PUA A;  2XAG B;  2HHH T;  5LJN A;  2CXF A;  5AQG B;  3HI2 A;  2XZE A;  1MIV A;  4DR4 T;  2W62 A;  2L8K A;  2YIN A;  3RGL A;  3P4W A;  4JI8 T;  2EHO A;  1IZN B;  3DP7 A;  3IBP A;  2BVM A;  5TAO A;  3PDY A;  3N2O A;  4ILB A;  2YDQ A;  3ZSS A;  4UXN B;  1OXZ A;  4H63 H;  3VR8 A;  3IHR A;  3A8Y C;  3LK2 B;  2WZI A;  4JI3 T;  2A2F X;  4EB6 E;  5LGT B;  2JMK A;  2KIN B;  4WYV A;  4DUZ T;  2WMO A;  2LSJ A;  5FL1 A;  5IWA T;  3OYX A;  1ZV4 X;  3OBV E;  3KFW X;  3WI3 A;  3JAF A;  4A97 A;  5AQK B;  2LJL A;  4XZC A;  3PU3 A;  1SA0 E;  4UVC B;  4DV3 T;  2AE9 A;  5CA1 E;  1E1H B;  4WZX A;  5LG4 A;  1NEN A;  3PJA A;  5F8P A;  1VOM A;  1B7T A;  2X9Y A;  5HXC A;  5L4H A;  5HXS A;  3FBL A;  4HFV A;  3IEE A;  2E8I A;  5L47 A;  2E5V A;  3ZMT B;  3AEB A;  4NPP A;  4O4J E;  2LM2 A;  1LKX A;  5ABE A;  4DMV A;  2VQF T;  2RA1 A;  2HN2 A;  3TKL B;  2B1E A;  3MA9 A;  3X1D A;  2CPT A;  1X9B A;  1WRD A;  2N1G A;  4ZI2 C;  5IHY A;  3P8C D;  4L5G A;  2IAK A;  1CUN A;  2NW7 A;  2DL1 A;  4ERR A;  4TWH A;  3AAI A;  4LFB T;  4EZH A;  5JDN A;  3SRZ A;  5KMG P;  2LHN A;  5AQL B;  5C8Y E;  3LK4 2;  2IC6 A;  4X1K E;  3H3M A;  3FZL B;  3PUW F;  4ZI2 D;  5HEG A;  5KDM C;  4TV8 E;  4O2A E;  3PUR A;  3AE2 A;  2XQ9 A;  4IDZ A;  3LG7 A;  4Z91 A;  3UFG A;  2MYS A;  5J1G A;  2V5C A;  2FUP A;  3ZLI A;  4ADZ A;  4TNV A;  3OTO T;  4AI6 A;  4A98 A;  2V8S V;  4HFE A;  2XQ7 A;  4LMK A;  3NZP A;  5JRC B;  3Q5D A;  3ZN0 B;  4JYA T;  4LF6 T;  4UF0 A;  1YKE B;  1N36 T;  3V5S A;  4ZI3 C;  5LBQ B;  2WBL A;  1HR0 T;  2LOP A;  3VU7 H;  4QXH B;  1SE7 A;  1OED A;  4PFO A;  3BK9 A;  4OFZ A;  1HF8 A;  4YSX A;  4TX5 A;  4IHJ E;  3UQ7 A;  4IIJ E;  5LHI B;  2BG9 A;  3ONX A;  1M62 A;  3TLV A;  2VKO A;  1J1J A;  5DQV A;  3HKC E;  3TLT A;  3ETU A;  3ZJ2 A;  1ZEE A;  1SHZ C;  3LBX A;  3JAE A;  2FBW A;  1GQE A;  1KNR A;  5JDH A;  2D9D A;  3JCF A;  1KEY A;  2CHO A;  1Y64 B;  3I0O A;  3AE6 A;  2G0U A;  4CI1 B;  5JR9 A;  4U7Y A;  4CZZ B;  2NW8 A;  3I0Q A;  3QC9 A;  3VRB A;  1W0B A;  3B5M A;  1ZHC A;  4C90 A;  2L9Q A;  3Q9D A;  3AE8 A;  2A72 A;  1YQ3 A;  3K3N A;  3ZST A;  3PTR B;  4U74 A;  4MFR A;  1T8B A;  1NEK A;  3CVR A;  4ZOL E;  1O3X A;  4XBF B;  3KV5 A;  4GK0 E;  4AXP A;  2BDE A;  4TWD A;  4AKR B;  1IBL T;  3O1H A;  4C91 A;  2X66 A;  4DBQ A;  4TV9 E;  4QHO A;  1G73 A;  2NTY A;  2Y6X A;  2XSB A;  4GIW A;  2WMN A;  2LRK A;  4O4L E;  4OYJ A;  4DO0 A;  3ONJ A;  2VL8 A;  1UX4 A;  4JEH B;  2UUB T;  2UUC T;  3ZC0 A;  4E7S A;  5C3J A;  1ZOY A;  2WDV A;  4LFA T;  4CI2 B;  5LBM A;  4QXB B;  3ZC1 A;  1MIW A;  2K9A A;  4EOZ B;  3NZQ A;  1OED E;  5JQG E;  1M7K A;  2IML A;  1UUS A;  3FZM B;  5AQP B;  5A1L A;  3C98 B;  1WFD A;  2W63 A;  3P50 A;  2I59 A;  2BG9 E;  5FXX A;  1HNX T;  3K1S A;  4YHJ A;  4P0A A;  2B76 A;  2LE8 A;  2CLY B;  5ABH A;  1Z8U A;  5FVL A;  2FJD A;  4OYK A;  2QVA A;  5AQN B;  2LEH A;  2RP4 A;  1Z0P A;  4ZHQ E;  2UXC T;  3KV9 A;  3TLS A;  3QK6 A;  4LFC T;  3Q2M A;  3C4W A;  4AKI A;  2BZB A;  3PUX F;  5AQF B;  1MMG A;  5LB7 B;  2VVS A;  3UUL A;  4YJ2 E;  4PW8 A;  4EEB A;  4HWC A;  4UV9 B;  4CXX A;  1WCR A;  2F4V T;  3AEC A;  4HWI B;  5EK2 A;  2WM9 A;  2E9X A;  4X65 T;  4GKK T;  4H9P C;  3LDQ B;  2C5J A;  2SPC A;  3P7I A;  2V26 A;  3L39 A;  4N78 D;  3KV6 A;  4JI7 T;  1CHU A;  3O4X E;  3PUQ A;  2JJ9 A;  4DV2 T;  4B3M T;  5AQJ B;  4V1A v;  3N9O A;  4DR2 T;  4KMC A;  1VCS A;  3ZKR A;  3AEG A;  2V7M A;  2HN1 A;  4L0R A;  2V5D A;  2LT3 A;  4WBN E;  5J2T E;  1HX8 A;  3WAK A;  3SOL A;  2IIU A;  4NXM T;  4B3S T;  5HWY A;  5JDG A;  4AQF A;  4COF A;  2YDS A;  4FJO A;  4GYS A;  3WAJ A;  4Z8X A;  5FY0 A;  3T1Y T;  2BS3 A;  2PG8 A;  2WSS V;  3AEF A;  1BR2 A;  3T8O A;  2FJA A;  5ABF A;  1MMA A;  1W0A A;  4EV6 A;  4BJM A;  1JNZ A;  5EZY E;  5LMU T;  4BJN A;  1MIY A;  2P9B A;  2MAW A;  2JIW A;  3AB3 B;  3UU8 A;  2QGS A;  1KNZ A;  4I50 E;  3O1I A;  4H9N C;  1US7 B;  2RPA A;  4X66 T;  1U4Q A;  1UCU A;  3LFM A;  3GN5 B;  1D1B A;  2XTL A;  4H9O C;  5LG3 A;  1ZP0 A;  5LNK A;  1DU2 A;  3P4Q A;  4HN9 A;  2CE7 A;  3ZCJ A;  4LF7 T;  2WAU A;  3ZCI A;  4BA9 A;  1LVF A;  1W9R A;  3UTK A;  5HEU A;  4F8H A;  3ABV A;  3ZMS B;  5E0O A;  4UF0 B;  1YXR A;  4X20 E;  4YTN A;  2E9X D;  2XPK A;  3EHZ A;  4QKN A;  5JRE A;  2YK0 A;  5LP6 E;  2Y48 B;  3RC3 A;  5FNV E;  2PTF A;  1OED B;  2VQE T;  4DND A;  2D0U A;  2XQ3 A;  3UU6 A;  5L3F B;  3EUH A;  2W67 A;  2ZLY A;  1R8I A;  4P1N A;  4QX8 B;  3ZT7 A;  2J1D G;  3ONL C;  3G06 A;  4KHP T;  3HA4 A;  3OJA A;  3FHN A;  5FXV A;  3CWZ B;  3LBX B;  5AQI B;  3Q5E A;  5FL0 A;  2WU5 A;  1IBK T;  4I43 B;  4DMW A;  2A9U A;  3BQI A;  3PUG A;  1MMD A;  2DI4 A;  2H7O A;  2ZM0 A;  1L0V A;  1S94 A;  5J0Z A;  2V7J A;  4O4H E;  4NIQ A;  3N2K E;  2Q9Q A;  3DJB A;  2J4G A;  3E0Z A;  2WY2 A;  3IA3 A;  4HWD A;  2LKG A;  5IYZ E;  4KUM B;  4PNI A;  2WDQ A;  2EHO C;  2CLY C;  3UUB A;  3OYZ A;  3KVA A;  4UEL A;  4B6X A;  3ZPO A;  2VAS A;  4ILU A;  2CBJ A;  4WBO A;  3ZMU B;  1XZY A;  2YOE A;  1HCI A;  4OK0 A;  4AKL A;  4IL4 A;  1Y01 A;  2EHO D;  2NP9 A;  3PUV F;  4QWN B;  2MPK A;  1U5P A;  5HXR A;  3C64 A;  2XAJ B;  3FZK B;  4U2Z A;  4AKH A;  5HEJ A;  5GON E;  2ACX A;  4A56 A;  2V6Y A;  2XM1 A;  4DUY T;  5FP3 A;  4U31 A;  3RYF E;  2H89 A;  1BR1 A;  3ANW A;  3AA0 B;  2OV9 A;  2HPJ A;  3RYH E;  2I6H A;  2XM2 A;  1XMQ T;  1I94 T;  2BVL A;  1NAF A;  4GK5 E;  1T72 A;  5FYM A;  3F2E A;  2XQ5 A;  4YJ3 E;  3KDS E;  3P4S A;  3P4P A;  5LOV E;  3S4U A;  3AE9 A;  3RIF A;  3ZYL A;  4IGU A;  2E5L T;  3FXD B;  5FMN A;  3UU4 A;  3ZMV B;  1X79 A;  4ZI7 E;  5H6Q B;  2NTX A;  4P0B A;  5M4Y A;  3U3I A;  2W0G A;  3AE3 A;  2CXL A;  4EAH A;  2W61 A;  5ETW A;  3SFE A;  2C5I T;  1KNP A;  4LF9 T;  1FMV A;  3D0T A;  2C5K T;  5JDM A;  3RPU A;  1FIO A;  3I9Y A;  5FKY A;  1VRB A;  2MOZ A;  4U3C A;  3MKD A;  5LHG B;  2N9D A;  3UUX B;  4DV1 T;  4IL9 A;  4EXT A;  5ADX L;  4G2A A;  4EGW A;  5L3C B;  2ES0 A;  3MZK B;  5LGN B;  2WS3 A;  2X9H A;  2E9X B;  4PJN A;  1BR0 A;  4YTP A;  3FB2 A;  4U2Y A;  4BAY B;  3RI5 A;  2R6G F;  1D0Z A;  3T1H T;  5IUX A;  3NWI A;  3HR0 A;  3SFD A;  4YT0 A;  3A7M A;  4DR3 T;  4PAG A;  5LCY A;  1E7P A;  5LGU B;  3VHL A;  2OLT A;  5DJQ C;  5AQQ B;  3CML A;  2KXP B;  2WQY A;  3N9Q A;  2QRX A;  3KBU A;  3F31 A;  5HXE A;  4EZ4 A;  1HX1 B;  2YN6 A;  4JI6 T;  4ISS A;  5L3G B;  4DV4 T;  4DID B;  5LXT E;  4ZZB A;  2DCF A;  5HEO A;  1YQ4 A;  2VL0 A;  3K3Q C;  4QH1 A;  4EED A;  3AAA B;  1HS7 A;  4X5T A;  1D1C A;  2CA5 A;  2ZMA A;  3UQ4 A;  2WCA A;  4PJL A;  3CX6 B;  4IE7 A;  5AQM B;  2LRL A;  3NBX X;  4PJM A;  2XJ7 A;  1VCT A;  2DWK A;  1OED C;  2XQA A;  3AXJ A;  4L9I A;  4HGA A;  2BG9 C;  3TLW A;  3ZYM A;  5F3J A;  4IE5 A;  2DLR A;  3AVR A;  3AED A;  3ETV A;  4UV8 B;  2WP9 A;  3H37 A;  3VKG A;  2KND A;  3CQX C;  2PJQ A;  3QB5 K;  5JR9 C;  1HNZ T;  2EHO B;  4IDQ A;  5EK4 A;  4QH5 A;  2JQQ A;  3AEA A;  4K0K T;  5CB4 E;  1UUR A;  4IE4 A;  4LF8 T;  4JI5 T;  1WLX A;  2K5B B;  3RIU A;  4DV5 T;  4ZEY A;  4ASK A;  2XY8 B;  3O1J A;  4TNW A;  4E7Z A;  4LML A;  2NOX A;  2W00 A;  5HEH A;  5L3D B;  2BBH A;  3NRY A;  2GK9 A;  1QUU A;  4QH4 A;  4DV0 T;  3J9X 1;  2IHR 1;  3BQK A;  2JQK A;  2LSI A;  1FEW A;  4F6R C;  2X51 A;  1J5W A;  2D2S A;  2M67 A;  4YLH A;  3RQW A;  4PJJ A;  2MBG A;  4YHH T;  2FJB A;  2IDO B;  2J47 A;  3MK7 C;  2HH7 A;  2YU1 A;  2BBJ A;  4G63 A;  4QXC B;  3RKG A;  4HFB A;  4DV7 T;  2QYW A;  3VRA A;  2X67 A;  3RLF F;  4X1I E;  2WZH A;  1N32 T;  3CX7 B;  4QX7 B;  4DR6 T;  3LSV A;  2OA5 A;  1IAP A;  4A5X A;  2X0H A;  1WR0 A;  4MBQ A;  1WR6 A;  3PV0 F;  1S35 A;  2UXD T;  4UIG A;  1I6Z A;  1T7S A;  3GA8 A;  3UU5 A;  3H3A A;  5KXJ A;  4MAL A;  3RYI E;  2NWB A;  1WYB A;  5AFU L;  3N2G E;  4Q25 A;  4U33 A;  1NWM X;  4GYR A;  1XMO T;  5JDL A;  2DNX A;  3RRW A;  1FJG T;  3SS1 A;  3UT5 E;  2ZM8 A;  4YTM A;  4HFH A;  2VKD A;  4OX9 T;  3N9P A;  2VKJ A;  4Z90 A;  3QB5 A;  3CPZ A;  4HKA A;  2KWH A;  2C0S A;  4FI5 A;  2V1D B;  4KX6 A;  3B13 A;  4O4I E;  2E2A A;  4AQY T;  3PUY F;  2IUB A;  2V6Y B;  1KF6 A;  3M3Z B;  3RC8 A;  4ANJ A;  4EYY R;  3K3O A;  2V7L A;  4B3T T;  2K3W A;  4H9Q C;  5CFB A;  4UVA B;  4HFI A;  5HWX A;  1YW0 A;  3ANW B;  4PK5 A;  2E9X C;  4CI3 B;  4KI0 F;  4ILA A;  3V5U A;  2LKH A;  2VUR A;  3ESL A;  3JC6 D;  2XQ8 A;  4O2B E;  4U72 A;  4ZS2 A;  4HE8 A;  2CM0 A;  4PFP A;  4AIU A;  5BMV E;  3AE1 A;  4TN7 B;  3ZJ1 A;  4TZ4 C;  5C2T A;  5DQW A;  3R6N A;  2N2N A;  2X0L B;  4JI1 T;  2H88 A;  4H63 V;  2XQ6 A;  4EIW A;  2WU2 A;  3AVS A;  4KBM B;  3ZYK A;  3EAB A;  4DR1 T;  1HNW T;  2UXB T; 
#chains in the Genus database with same CATH homology
 4GK5 E;  2Q9Q B;  5FY7 A;  1MND A;  5FYM A;  3F2E A;  4XAX B;  1T98 A;  3MJX A;  4GIW A;  4YJ3 E;  2XAF B;  3KDS E;  2LOS A;  5LOV E;  1ZKE A;  3S4U A;  3LK3 B;  2CXD A;  2WMN A;  4O4L E;  4OYJ A;  3N5L A;  3ZYL A;  4AQF C;  4IGU A;  4DO0 A;  3FXD B;  2VL8 A;  4WW0 A;  5FMN A;  1UX4 A;  3ZMV B;  3ZN1 B;  1HTJ F;  4JEH B;  1X79 A;  4ZI7 E;  5H6Q B;  2MTQ A;  2NTX A;  4P0B A;  4E7S A;  5KX5 E;  3ZC0 A;  5M4Y A;  3U3I A;  2W0G A;  4HEA A;  2CXL A;  3RYC E;  2CWO A;  4EAH A;  2YEV C;  5JDQ A;  3CKD A;  2ODU A;  2W61 A;  5ETW A;  4CI2 B;  2C5I T;  5JR9 B;  5LBM A;  4EYU A;  1AJ3 A;  4QXB B;  3ZC1 A;  1MIW A;  2K9A A;  3N9L A;  4EOZ B;  1FMV A;  2QA7 A;  3NZQ A;  3HKE E;  5JQG E;  3GWH A;  4PK6 A;  3D0T A;  3Q5W A;  2C5K T;  5JDM A;  4CXW A;  3RPU A;  1UX5 A;  1FIO A;  3K8P C;  5A1L A;  3I9Y A;  1VRB A;  1YD8 G;  2MOZ A;  2Z6E A;  3C98 B;  5EK3 A;  1MMN A;  4UEM A;  4TUY E;  3HKD E;  2W63 A;  3MKD A;  5LHG B;  2N9D A;  3F57 A;  2I59 A;  2JMH A;  3UUX B;  2DWG A;  5FXX A;  4MLK A;  3RH3 A;  3I9W A;  4EXT A;  4IE6 A;  1IJ6 A;  3EDV A;  5ADX L;  2XHE B;  3GMI A;  4YHJ A;  3JC6 C;  4G2A A;  4P0A A;  5FXW A;  2LE8 A;  3A5X A;  2CLY B;  5L3C B;  1KK7 A;  2ES0 A;  3MZK B;  3UUN A;  3U78 A;  2XAH B;  4OYK A;  2UXN B;  5JH7 E;  2WWU A;  5FY1 A;  5LGN B;  2LEH A;  5DAB A;  3IF8 B;  3AAE B;  3C50 A;  3HKB E;  2VWA A;  2RP4 A;  1Z0P A;  4M1P A;  4J2C A;  2X9H A;  4ZHQ E;  1G8X A;  3KV9 A;  2K48 A;  2E9X B;  4PJN A;  1BR0 A;  3FBZ A;  3FB2 A;  2PBI A;  3Q5X A;  4BAY B;  3KBT A;  3QK6 A;  1D0X A;  3Q2M A;  1D0Z A;  5L3E B;  5HYA A;  3PUA A;  2XAG B;  5CA0 E;  3C4W A;  4AKI A;  2BZB A;  3HR0 A;  5LJN A;  2CXF A;  1MMG A;  2A3D A;  4PAG A;  4KP3 C;  5LCY A;  3UUL A;  5LGU B;  4YJ2 E;  3HI2 A;  3VHL A;  2IW5 B;  1MIV A;  4PW8 A;  2LSK A;  3DTO A;  5DJQ C;  2W62 A;  2L8K A;  3CML A;  2YIN A;  4UV9 B;  3AA6 B;  4CXX A;  2EHO A;  1IZN B;  2KXP B;  4IE0 A;  1YKH B;  4CXY A;  3DP7 A;  3IBP A;  3N9Q A;  2BVM A;  3KBU A;  3F31 A;  5EK2 A;  5HXE A;  4EZ4 A;  3LJC A;  3CQC B;  2WM9 A;  1G73 A;  5TAO A;  5J2U E;  2E9X A;  2KWI B;  4H9P C;  3PDY A;  4ISS A;  2C5J A;  3N2O A;  2IC9 A;  5L3G B;  2SPC A;  3P7I A;  2X68 A;  4UXN B;  3L3P A;  5LXT E;  1OXZ A;  2DCF A;  4H63 H;  3K3Q C;  2V26 A;  3IHR A;  4N78 D;  3O9X A;  3AAA B;  3KV6 A;  1HFA A;  2V7I A;  1HS7 A;  1D1C A;  3UFE A;  2CA5 A;  3LK2 B;  2ZMA A;  3FXE B;  3O4X E;  4PJL A;  3CX6 B;  2A2F X;  4EB6 E;  5LGT B;  1D0Y A;  4IE7 A;  2JMK A;  2KIN B;  3PUQ A;  5HXH A;  2JJ9 A;  3NBX X;  4NUV A;  2WMO A;  2LSJ A;  4PJM A;  4X1Y E;  5L3B B;  5LJM A;  2DWK A;  5L2L A;  4DVD A;  3GN5 A;  3OYX A;  2KLQ A;  1ZV4 X;  2XUE A;  3OBV E;  3KFW X;  2Q9Q C;  4V1A v;  3WI3 A;  3N9O A;  1EZ3 A;  4L9I A;  3RRC A;  4KMC A;  1IJ5 A;  2LJL A;  2VKH A;  4HGA A;  4OHF A;  4XZC A;  3ZYM A;  3PU3 A;  1SA0 E;  4UVC B;  2V7M A;  4JEU B;  4L0R A;  1E1H B;  5CA1 E;  5F3J A;  2LT3 A;  2DHR A;  4WBN E;  4IE5 A;  2DLR A;  3AA1 B;  3AVR A;  5J2T E;  5LG4 A;  1HX8 A;  3WAK A;  5F8P A;  3SOL A;  3ETV A;  2D0T A;  4UV8 B;  2CEA A;  4MHC A;  1VOM A;  3OKQ A;  3H37 A;  3VKG A;  2KND A;  1B7T A;  5HWY A;  5JDG A;  2X9Y A;  3CQX C;  2PJQ A;  4AQF A;  3WAJ A;  4FJO A;  4GYS A;  5HXC A;  2XAS B;  4Z8X A;  5HXS A;  1H7C A;  3EDU A;  2Q9Q D;  4I4T E;  5FY0 A;  3FBL A;  2PG8 A;  2WSS V;  4I55 E;  1BR2 A;  5JR9 C;  4HFV A;  3T8O A;  3IEE A;  2E8I A;  2EHO B;  1MMA A;  5EK4 A;  2JQQ A;  3ZMT B;  2YU2 A;  3CQG B;  5CB4 E;  3B57 A;  4IE4 A;  1BR4 A;  4O4J E;  3N9N A;  1LKX A;  2CWY A;  1WLX A;  4BJM A;  2LHR A;  2K5B B;  1LRZ A;  4ZI3 D;  4AKG A;  4DMV A;  5EZY E;  2HPL A;  3NRX A;  2RA1 A;  3TKL B;  4ASK A;  4JUY A;  4BJN A;  2B1E A;  1MIY A;  3MA9 A;  2P9B A;  3O1J A;  4E7Z A;  3CX8 B;  3MAC A;  3AB3 B;  2NOX A;  1WRD A;  2W00 A;  2N1G A;  3C4Z A;  5L3D B;  3W15 B;  4ZI2 C;  2QGS A;  3NRY A;  5IHY A;  1KNZ A;  2GK9 A;  1QUU A;  3P8C D;  4L5G A;  5LA6 E;  2IAK A;  3J9X 1;  3BQL A;  4JLE A;  1HG5 A;  1CUN A;  4I50 E;  3BQK A;  2NW7 A;  2XQY A;  3O1I A;  4H9N C;  1HG2 A;  5HAX A;  4ERR A;  1US7 B;  5JVD E;  1U4Q A;  1UCU A;  3AAI A;  4EZH A;  2LSI A;  3LFM A;  5JDN A;  3GN5 B;  1D1B A;  3SRZ A;  4IST A;  2XTL A;  4H9O C;  3KIN B;  1FEW A;  4F6R C;  5KMG P;  3KVB A;  2X51 A;  2LHN A;  3SWH A;  4H9S E;  5LNK A;  2D2S A;  2V7K A;  5C8Y E;  2M67 A;  3LK4 2;  3N9M A;  4YLH A;  4HN9 A;  2CE7 A;  2LM9 A;  2IC6 A;  4PJJ A;  3ZCJ A;  2WAU A;  3ZCI A;  4BA9 A;  1LVF A;  4X1K E;  2MBG A;  3M65 A;  3UTK A;  3MK7 C;  2HH7 A;  3ZMS B;  4ZI2 D;  2YU1 A;  5E0O A;  4UF0 B;  5KDM C;  4G63 A;  4QXC B;  4TV8 E;  4O2A E;  4X20 E;  2E9X D;  3E08 A;  3PUR A;  3C51 A;  4QKN A;  4IDZ A;  3LG7 A;  5JRE A;  1QSD A;  2X67 A;  2YK0 A;  3ZMZ B;  5LP6 E;  3PU8 A;  2MYS A;  4X1I E;  5J1G A;  2K24 A;  3ZLI A;  2Y48 B;  4ADZ A;  3RC3 A;  3CX7 B;  4AQG A;  2JRK A;  5FNV E;  3QUJ A;  4QX7 B;  4CQI A;  4AI6 A;  2L3L A;  2OA5 A;  1IAP A;  4HTE A;  4DND A;  2D0U A;  3NZP A;  2VB6 A;  3RX6 A;  5JRC B;  2H7V C;  4MBQ A;  5L3F B;  5LYJ E;  1WR6 A;  3EUH A;  2ZM2 A;  2ZLY A;  3ZN0 B;  2LSY A;  4WNK A;  1S35 A;  4UIG A;  4QX8 B;  2J1D G;  3GA8 A;  4YFS A;  3HA4 A;  2NW9 A;  4UF0 A;  3OJA A;  3H3A A;  3ZEF B;  3I1A A;  1YKE B;  3FHN A;  3AA7 B;  3L09 A;  3CWZ B;  4MAL A;  5FXV A;  3LBX B;  3RYI E;  3V5S A;  4ZI3 C;  2NWB A;  5LBQ B;  2WBL A;  1WYB A;  5AFU L;  4I43 B;  3N2G E;  1NWM X;  4DMW A;  3BQI A;  4GYR A;  2LOP A;  3PUG A;  4UVB B;  1MMD A;  3VU7 H;  2DI4 A;  3R84 B;  4QXH B;  2H7O A;  2ZM0 A;  5JDL A;  2DNX A;  3RRW A;  1S94 A;  2H3R A;  2JPF A;  2V7J A;  3SS1 A;  3UT5 E;  2CMR A;  4O4H E;  4PFO A;  5LHH B;  3BK9 A;  2ZM8 A;  4OFZ A;  3N2K E;  2Q9Q A;  1MNE A;  1HF8 A;  2VKD A;  3DJB A;  4TX5 A;  4IHJ E;  4GOU A;  3N9P A;  5JRC A;  2VKJ A;  3PUS A;  4IIJ E;  4PK4 A;  5LHI B;  1D1A A;  3ONX A;  2PFV A;  3E0Z A;  3CPZ A;  4HKA A;  2KWH A;  2C0S A;  4FI5 A;  2V1D B;  2VKO A;  1V9D A;  3B13 A;  4O4I E;  5IYZ E;  5DQV A;  3HKC E;  4KUM B;  4PNI A;  4ZS3 A;  4NUU A;  4P09 A;  3ETU A;  3J7Y q;  3ZJ2 A;  1ZEE A;  2EHO C;  1SHZ C;  3RC8 A;  3LBX A;  2CLY C;  3KV4 A;  4ANJ A;  4EYY R;  3K3O A;  1LVK A;  2UXX B;  2V7L A;  4H9Q C;  4O8S A;  4UVA B;  5JDH A;  5HWX A;  1YW0 A;  2KMF A;  3KVA A;  3OYZ A;  1Y64 B;  3ANW B;  3I0O A;  1OWA A;  4PK5 A;  1WYC A;  2G0U A;  4UEL A;  4CI1 B;  4B6X A;  5JR9 A;  3ZPO A;  2VAS A;  5H6R B;  2E9X C;  3C4X A;  4ILU A;  4CI3 B;  2D5U A;  4WBO A;  2NW8 A;  3ZMU B;  3I0Q A;  4CZZ B;  3QC9 A;  1FMW A;  3V5U A;  5FXZ A;  1HCI A;  4OK0 A;  4AKL A;  1ZHC A;  4C90 A;  3EVY A;  2KT9 A;  2LSG A;  3ESL A;  2L9Q A;  3JC6 D;  5JDF A;  4O2B E;  3Q9D A;  4U72 A;  4ZS2 A;  2A72 A;  4HE8 A;  2EHO D;  2NP9 A;  4QWN B;  2CM0 A;  2ODV A;  4PFP A;  1U5P A;  5HXR A;  4DBR A;  3K3N A;  4H9R C;  3C64 A;  2XAJ B;  3PTR B;  5BMV E;  4U74 A;  2XAQ B;  3RKO A;  4TN7 B;  4AKH A;  5GON E;  2ACX A;  3PE0 A;  4A56 A;  4K0U A;  4MFR A;  3ZJ1 A;  4TZ4 C;  5DQW A;  3R6N A;  2N2N A;  2Y8D A;  3CVR A;  2X0L B;  4ZOL E;  2VK9 A;  1O3X A;  4H63 V;  5FP3 A;  3HL6 A;  3RYF E;  3MXZ A;  2X9W A;  4XBF B;  3KV5 A;  1BR1 A;  3E22 E;  4EIW A;  4GK0 E;  4AXP A;  3AVS A;  4KBM B;  3ANW A;  3VKH A;  3ZYK A;  3AA0 B;  2BDE A;  2CCQ A;  2KZ7 B;  3UUM A;  4AKR B;  2HPJ A;  3O1H A;  3RYH E;  4C91 A;  2X66 A;  4DBQ A;  4TV9 E;  4QHO A;  2NTY A;  2X9X A;  2BVL A;  2Y6X A;  1NAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...