2JMMA

Nmr solution structure of a minimal transmembrane beta-barrel platform protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
156
structure length
156
Chain Sequence
b'MPKDNTWYTGAKLGWSQYSRENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPRKAQGVQLTAKLGYPKLGTDDLDIYTRLGGMVWRADTSDKDGNGYISAAEASVSPVFAGGVEYVIRRRITPEIATRLEYQWTNNASDNGMLSLGVSYRFGQGEAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein A
publication title A minimal transmembrane beta-barrel platform protein studied by nuclear magnetic resonance
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 34
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01389 OmpA_membrane OmpA-like transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2jmmA00
1QJPA 1ORMA 1THQA 2MNHA 2F1VA 4PUXA 2N2MA 2ERVA 2GE4A 3QRCA 2X27X 1MM5A 1QJ9A 3G7GA 1MM4A 3GP6A 2M07A 1Q9FA 3C5OA 2LHFA 3QRAA 1G90A 1Q9GA 4RLCA 2MHLA 2F1TA 1BXWA 1P4TA 2M06A 2JMMA 2K0LA 1QJ8A 2N2LA
chains in the Genus database with same CATH superfamily
1QJPA 3BRYA 2K4TA 1THQA 3LK2A 3VE1A 2W81C 2MNHA 3VZWX 4E1SA 4FESA 4PUXA 2R4NA 3AAAA 4E1TA 3UPGA 1BT9A 2ZLDA 3A2SX 3HOEA 2OMFA 4O3XB 2R8AA 3A0BO 3KZIO 1MM4A 5PRNA 3SYSA 3AA6A 3AA0B 3DZMA 2M07A 3O0EA 3JCUO 4C4VA 1YS5A 6PRNA 3VZUX 1T1LA 5GTIO 3DWNA 2XE3A 4O3ZA 4BUMX 4FZMA 4UB6O 3HOLA 4AYEC 1GFOA 3LK3A 4AYMC 4UB8O 4FSOA 3AA1B 5AFUL 4C69X 2JMMA 2XMXA 4O4XA 2XE2A 3HW9A 4AKMA 3POXA 3LK2B 3WI5A 4D64A 4FRTA 1QJ8A 2N2LA 4GHBA 4G76A 4QQ1A 3NJTA 4IL6O 4AYNA 1ZHYA 4CTDA 1ORMA 3AAAB 3SZVA 1GFPA 4O3YA 4RL9A 3DA3A 4Z3TA 3EMNX 2XTQA 1BH3A 3PGUA 4O49A 1MPFA 4FZLA 5DL8A 2N2MA 1IZNA 1ZHWA 2JQYA 4JFBA 4O4UA 5EE2A 2KXPB 3LK42 2KZ7A 3PGSA 2XE5A 5TISO 3RBHA 2XTRA 3WI4A 4FUVA 2FGQX 3G7GA 4GF4A 2YNKA 5DL5A 2R89A 3PF1A 3SYBA 3LK41 4PR7A 5KAIO 4RJXA 2R88A 5GV0A 5B66O 3AAEB 3TZGA 3LK3B 5E79O 4KR4A 2LHFA 1GFQA 3QRAA 4AKRA 3A0HO 2J4UP 2Y0HA 1G90A 1ZHZA 2MHLA 1S5LO 5ADXL 1ZHXA 1HXXA 1P4TA 3T0SA 4GCQA 1E54A 3VZTX 2M06A 4G75A 1PRNA 2K0LA 2QTKA 3PQUA 2FGRA 5AFUK 2AXTO 4N58A 4LSHA 1PHOA 7PRNA 2XG6A 2KDYA 3FYXA 3KVDD 4FOZA 4D65A 2KZ7B 3PORA 4LSIA 3HWBA 4FRXA 3UU2A 3AA7A 2WJRA 4GCPA 3PRNA 2Y0LA 1ZHTA 2X27X 1OPFA 2PORA 5FVNA 3AA6B 3T20A 3SZDA 4RJWA 3POUA 3GP6A 4AYDC 4C4VB 4N74A 4GCSA 3AA0A 2W80C 4FQEA 4AKRB 2ZFGA 4O3WA 3SY7A 4D5UA 3NSGA 1Q9FA 3C5OA 3VY8X 3PQSA 4RLCA 4AFKA 5DL6A 3DA4A 5D5DA 3T24A 5G3AA 5GTHO 2KC0A 5G26A 1OSMA 4FMSA 3BRZA 2LFUA 4JCHA 1GFMA 5ADXK 4K3BA 2X9KA 5G38A 3V8UA 3SY9A 2O4VA 4B61A 2WVPA 3BS0A 2R4OA 4LSEA 5H2FO 5IYUA 5KAFO 2Y0KA 4PJ0O 4FT6A 3AA7B 2F1VA 2F1CX 3JTYA 1IZNB 2IWWA 2Y7SA 1HXUA 3WU2O 2ERVA 4AYID 4N59A 2GE4A 3QRCA 3DWOX 4KRAA 5T5FA 2YPVA 1MM5A 8PRNA 5JDPA 2KXPA 2XE1A 2IWVA 2J1NA 1HXTA 2ODJA 2Y2XA 4N75A 4RLBA 4U9CA 4XNKA 3VE2A 4AZLA 4AUIA 5DL7A 3POQA 4LSFA 1GFNA 3AAEA 4XNLA 4K3CA 5G39A 1T16A 1Q9GA 3K19A 3PGRA 4FZNA 4KR8A 2WJQA 5B5EO 1BXWA 2F1TA 1H6S1 4F4BA 4FSPA 3UAQA 3VY9X 2PRNA 3AA1A 1QJ9A 2R4PA 4C00A 2R4LA
chains in the Genus database with same CATH topology
1QJPA 3LK2A 2K4TA 1THQA 3VE1A 2W81C 2MNHA 3VZWX 4E1SA 4FESA 4PUXA 4E1TA 3AAAA 3UPGA 1BT9A 2ZLDA 3A2SX 3HOEA 2OMFA 4O3XB 1MM4A 5PRNA 3SYSA 3AA6A 3AA0B 2M07A 3O0EA 1YS5A 6PRNA 3VZUX 2XE3A 4O3ZA 4BUMX 4FZMA 3HOLA 4AYEC 1GFOA 3LK3A 4AYMC 4FSOA 3AA1B 5AFUL 4C69X 2JMMA 2XMXA 4O4XA 2XE2A 3HW9A 4AKMA 3POXA 3LK2B 3WI5A 4D64A 4FRTA 1QJ8A 2N2LA 4GHBA 4G76A 4QQ1A 4AYNA 1ZHYA 1ORMA 3AAAB 3SZVA 1GFPA 4O3YA 4RL9A 3DA3A 4Z3TA 3EMNX 2XTQA 1BH3A 4O49A 5DL8A 1MPFA 4FZLA 2N2MA 1IZNA 1ZHWA 4JFBA 4O4UA 5EE2A 4AFKA 2KXPB 3LK42 2KZ7A 3RBHA 2XE5A 2XTRA 3WI4A 4FUVA 2FGQX 3G7GA 4GF4A 2YNKA 5DL5A 3SYBA 4F4BA 3LK41 5GV0A 4RJXA 3AAEB 3TZGA 3LK3B 4KR4A 2LHFA 1GFQA 3QRAA 4AKRA 2J4UP 1G90A 2Y0HA 1ZHZA 2MHLA 5ADXL 1ZHXA 1HXXA 1P4TA 3T0SA 4GCQA 1E54A 3VZTX 2M06A 4G75A 1PRNA 2K0LA 2QTKA 3PQUA 2FGRA 5AFUK 4N58A 4LSHA 1PHOA 7PRNA 2XG6A 2KDYA 3FYXA 3KVDD 4FOZA 4D65A 2KZ7B 3PORA 4LSIA 3HWBA 4FRXA 3UU2A 3AA7A 4GCPA 3PRNA 2Y0LA 1ZHTA 2X27X 1OPFA 2PORA 5FVNA 3AA6B 3T20A 3SZDA 4RJWA 3POUA 3GP6A 4AYDC 4GCSA 3AA0A 2W80C 4AKRB 4D5UA 2ZFGA 4O3WA 3SY7A 3NSGA 1Q9FA 3C5OA 3VY8X 3PQSA 4RLCA 5DL6A 3DA4A 5D5DA 3T24A 2KC0A 5G26A 1OSMA 4FMSA 4JCHA 2LFUA 1GFMA 5ADXK 3V8UA 3SY9A 2O4VA 4B61A 4LSEA 5IYUA 2Y0KA 4FT6A 3AA7B 2F1VA 3JTYA 1IZNB 2Y7SA 1HXUA 4AYID 2ERVA 4N59A 2GE4A 3QRCA 4KRAA 5T5FA 2YPVA 1MM5A 8PRNA 5JDPA 2KXPA 2XE1A 2J1NA 4U9CA 1HXTA 2ODJA 2Y2XA 4RLBA 3VE2A 4XNKA 4AZLA 4AUIA 5DL7A 3POQA 4LSFA 1GFNA 3AAEA 4XNLA 1Q9GA 3K19A 4FZNA 4KR8A 1BXWA 2F1TA 1H6S1 4FSPA 3UAQA 3VY9X 2PRNA 3AA1A 1QJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QJP A;  1ORM A;  1THQ A;  2MNH A;  2F1V A;  4PUX A;  2N2M A;  2ERV A;  2GE4 A;  3QRC A;  2X27 X;  1MM5 A;  1QJ9 A;  3G7G A;  1MM4 A;  3GP6 A;  2M07 A;  1Q9F A;  3C5O A;  2LHF A;  3QRA A;  1G90 A;  1Q9G A;  4RLC A;  2MHL A;  2F1T A;  1BXW A;  1P4T A;  2M06 A;  2JMM A;  2K0L A;  1QJ8 A;  2N2L A; 
#chains in the Genus database with same CATH topology
 1QJP A;  3BRY A;  2K4T A;  1THQ A;  3LK2 A;  3VE1 A;  2W81 C;  2MNH A;  3VZW X;  4E1S A;  4FES A;  4PUX A;  2R4N A;  3AAA A;  4E1T A;  3UPG A;  1BT9 A;  2ZLD A;  3A2S X;  3HOE A;  2OMF A;  4O3X B;  2R8A A;  3A0B O;  3KZI O;  1MM4 A;  5PRN A;  3SYS A;  3AA6 A;  3AA0 B;  3DZM A;  2M07 A;  3O0E A;  3JCU O;  4C4V A;  1YS5 A;  6PRN A;  3VZU X;  1T1L A;  5GTI O;  3DWN A;  2XE3 A;  4O3Z A;  4BUM X;  4FZM A;  4UB6 O;  3HOL A;  4AYE C;  1GFO A;  3LK3 A;  4AYM C;  4UB8 O;  4FSO A;  3AA1 B;  5AFU L;  4C69 X;  2JMM A;  2XMX A;  4O4X A;  2XE2 A;  3HW9 A;  4AKM A;  3POX A;  3LK2 B;  3WI5 A;  4D64 A;  4FRT A;  1QJ8 A;  2N2L A;  4GHB A;  4G76 A;  4QQ1 A;  3NJT A;  4IL6 O;  4AYN A;  1ZHY A;  4CTD A;  1ORM A;  3AAA B;  3SZV A;  1GFP A;  4O3Y A;  4RL9 A;  3DA3 A;  4Z3T A;  3EMN X;  2XTQ A;  1BH3 A;  3PGU A;  4O49 A;  1MPF A;  4FZL A;  5DL8 A;  2N2M A;  1IZN A;  1ZHW A;  2JQY A;  4JFB A;  4O4U A;  5EE2 A;  2KXP B;  3LK4 2;  2KZ7 A;  3PGS A;  2XE5 A;  5TIS O;  3RBH A;  2XTR A;  3WI4 A;  4FUV A;  2FGQ X;  3G7G A;  4GF4 A;  2YNK A;  5DL5 A;  2R89 A;  3PF1 A;  3SYB A;  3LK4 1;  4PR7 A;  5KAI O;  4RJX A;  2R88 A;  5GV0 A;  5B66 O;  3AAE B;  3TZG A;  3LK3 B;  5E79 O;  4KR4 A;  2LHF A;  1GFQ A;  3QRA A;  4AKR A;  3A0H O;  2J4U P;  2Y0H A;  1G90 A;  1ZHZ A;  2MHL A;  1S5L O;  5ADX L;  1ZHX A;  1HXX A;  1P4T A;  3T0S A;  4GCQ A;  1E54 A;  3VZT X;  2M06 A;  4G75 A;  1PRN A;  2K0L A;  2QTK A;  3PQU A;  2FGR A;  5AFU K;  2AXT O;  4N58 A;  4LSH A;  1PHO A;  7PRN A;  2XG6 A;  2KDY A;  3FYX A;  3KVD D;  4FOZ A;  4D65 A;  2KZ7 B;  3POR A;  4LSI A;  3HWB A;  4FRX A;  3UU2 A;  3AA7 A;  2WJR A;  4GCP A;  3PRN A;  2Y0L A;  1ZHT A;  2X27 X;  1OPF A;  2POR A;  5FVN A;  3AA6 B;  3T20 A;  3SZD A;  4RJW A;  3POU A;  3GP6 A;  4AYD C;  4C4V B;  4N74 A;  4GCS A;  3AA0 A;  2W80 C;  4FQE A;  4AKR B;  2ZFG A;  4O3W A;  3SY7 A;  4D5U A;  3NSG A;  1Q9F A;  3C5O A;  3VY8 X;  3PQS A;  4RLC A;  4AFK A;  5DL6 A;  3DA4 A;  5D5D A;  3T24 A;  5G3A A;  5GTH O;  2KC0 A;  5G26 A;  1OSM A;  4FMS A;  3BRZ A;  2LFU A;  4JCH A;  1GFM A;  5ADX K;  4K3B A;  2X9K A;  5G38 A;  3V8U A;  3SY9 A;  2O4V A;  4B61 A;  2WVP A;  3BS0 A;  2R4O A;  4LSE A;  5H2F O;  5IYU A;  5KAF O;  2Y0K A;  4PJ0 O;  4FT6 A;  3AA7 B;  2F1V A;  2F1C X;  3JTY A;  1IZN B;  2IWW A;  2Y7S A;  1HXU A;  3WU2 O;  2ERV A;  4AYI D;  4N59 A;  2GE4 A;  3QRC A;  3DWO X;  4KRA A;  5T5F A;  2YPV A;  1MM5 A;  8PRN A;  5JDP A;  2KXP A;  2XE1 A;  2IWV A;  2J1N A;  1HXT A;  2ODJ A;  2Y2X A;  4N75 A;  4RLB A;  4U9C A;  4XNK A;  3VE2 A;  4AZL A;  4AUI A;  5DL7 A;  3POQ A;  4LSF A;  1GFN A;  3AAE A;  4XNL A;  4K3C A;  5G39 A;  1T16 A;  1Q9G A;  3K19 A;  3PGR A;  4FZN A;  4KR8 A;  2WJQ A;  5B5E O;  1BXW A;  2F1T A;  1H6S 1;  4F4B A;  4FSP A;  3UAQ A;  3VY9 X;  2PRN A;  3AA1 A;  1QJ9 A;  2R4P A;  4C00 A;  2R4L A; 
#chains in the Genus database with same CATH homology
 1QJP A;  3LK2 A;  2K4T A;  1THQ A;  3VE1 A;  2W81 C;  2MNH A;  3VZW X;  4E1S A;  4FES A;  4PUX A;  4E1T A;  3AAA A;  3UPG A;  1BT9 A;  2ZLD A;  3A2S X;  3HOE A;  2OMF A;  4O3X B;  1MM4 A;  5PRN A;  3SYS A;  3AA6 A;  3AA0 B;  2M07 A;  3O0E A;  1YS5 A;  6PRN A;  3VZU X;  2XE3 A;  4O3Z A;  4BUM X;  4FZM A;  3HOL A;  4AYE C;  1GFO A;  3LK3 A;  4AYM C;  4FSO A;  3AA1 B;  5AFU L;  4C69 X;  2JMM A;  2XMX A;  4O4X A;  2XE2 A;  3HW9 A;  4AKM A;  3POX A;  3LK2 B;  3WI5 A;  4D64 A;  4FRT A;  1QJ8 A;  2N2L A;  4GHB A;  4G76 A;  4QQ1 A;  4AYN A;  1ZHY A;  1ORM A;  3AAA B;  3SZV A;  1GFP A;  4O3Y A;  4RL9 A;  3DA3 A;  4Z3T A;  3EMN X;  2XTQ A;  1BH3 A;  4O49 A;  5DL8 A;  1MPF A;  4FZL A;  2N2M A;  1IZN A;  1ZHW A;  4JFB A;  4O4U A;  5EE2 A;  4AFK A;  2KXP B;  3LK4 2;  2KZ7 A;  3RBH A;  2XE5 A;  2XTR A;  3WI4 A;  4FUV A;  2FGQ X;  3G7G A;  4GF4 A;  2YNK A;  5DL5 A;  3SYB A;  4F4B A;  3LK4 1;  5GV0 A;  4RJX A;  3AAE B;  3TZG A;  3LK3 B;  4KR4 A;  2LHF A;  1GFQ A;  3QRA A;  4AKR A;  2J4U P;  1G90 A;  2Y0H A;  1ZHZ A;  2MHL A;  5ADX L;  1ZHX A;  1HXX A;  1P4T A;  3T0S A;  4GCQ A;  1E54 A;  3VZT X;  2M06 A;  4G75 A;  1PRN A;  2K0L A;  2QTK A;  3PQU A;  2FGR A;  5AFU K;  4N58 A;  4LSH A;  1PHO A;  7PRN A;  2XG6 A;  2KDY A;  3FYX A;  3KVD D;  4FOZ A;  4D65 A;  2KZ7 B;  3POR A;  4LSI A;  3HWB A;  4FRX A;  3UU2 A;  3AA7 A;  4GCP A;  3PRN A;  2Y0L A;  1ZHT A;  2X27 X;  1OPF A;  2POR A;  5FVN A;  3AA6 B;  3T20 A;  3SZD A;  4RJW A;  3POU A;  3GP6 A;  4AYD C;  4GCS A;  3AA0 A;  2W80 C;  4AKR B;  4D5U A;  2ZFG A;  4O3W A;  3SY7 A;  3NSG A;  1Q9F A;  3C5O A;  3VY8 X;  3PQS A;  4RLC A;  5DL6 A;  3DA4 A;  5D5D A;  3T24 A;  2KC0 A;  5G26 A;  1OSM A;  4FMS A;  4JCH A;  2LFU A;  1GFM A;  5ADX K;  3V8U A;  3SY9 A;  2O4V A;  4B61 A;  4LSE A;  5IYU A;  2Y0K A;  4FT6 A;  3AA7 B;  2F1V A;  3JTY A;  1IZN B;  2Y7S A;  1HXU A;  4AYI D;  2ERV A;  4N59 A;  2GE4 A;  3QRC A;  4KRA A;  5T5F A;  2YPV A;  1MM5 A;  8PRN A;  5JDP A;  2KXP A;  2XE1 A;  2J1N A;  4U9C A;  1HXT A;  2ODJ A;  2Y2X A;  4RLB A;  3VE2 A;  4XNK A;  4AZL A;  4AUI A;  5DL7 A;  3POQ A;  4LSF A;  1GFN A;  3AAE A;  4XNL A;  1Q9G A;  3K19 A;  4FZN A;  4KR8 A;  1BXW A;  2F1T A;  1H6S 1;  4FSP A;  3UAQ A;  3VY9 X;  2PRN A;  3AA1 A;  1QJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...