2JMSA

Nmr structure of en-6 pheromone from the antarctic ciliate euplotes nobilii
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
TDPEEHFDPNTNCDYTNSQDAWDYCTNYIVNSSCGEICCNDCFDETGTGACRAQAFGNSCLNW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone En-6
publication title Cold-adaptation in Sea-water-borne Signal Proteins: Sequence and NMR Structure of the Pheromone En-6 from the Antarctic Ciliate Euplotes nobilii
pubmed doi rcsb
molecule tags Signaling protein
total genus 14
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2006-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.50.40 Mainly Alpha Up-down Bundle Pheromone ER-1 Pheromone ER-1 2jmsA01
2NSWA 2KC6A 2KK2A 2JMSA 2NSVA
chains in the Genus database with same CATH superfamily
4EDRA 4EE1A 4EDGA 2LMKA 4EDTA 3B39A 1DDEA 2NSWA 1EQNA 1DD9A 2KK2A 2B39A 4EDVA 3KXRA 2ERLA 3KLSA 2NSVA 2KC6A 2AU3A 2JMSA 3CU7A 4E2KA 1ERCA 4EDKA
chains in the Genus database with same CATH topology
4EDRA 4EE1A 4EDGA 2LMKA 4EDTA 3B39A 1DDEA 2NSWA 1EQNA 1DD9A 2KK2A 2B39A 4EDVA 3KXRA 2ERLA 3KLSA 2NSVA 2KC6A 2AU3A 2JMSA 3CU7A 4E2KA 1ERCA 4EDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NSW A;  2KC6 A;  2KK2 A;  2JMS A;  2NSV A; 
#chains in the Genus database with same CATH topology
 4EDR A;  4EE1 A;  4EDG A;  2LMK A;  4EDT A;  3B39 A;  1DDE A;  2NSW A;  1EQN A;  1DD9 A;  2KK2 A;  2B39 A;  4EDV A;  3KXR A;  2ERL A;  3KLS A;  2NSV A;  2KC6 A;  2AU3 A;  2JMS A;  3CU7 A;  4E2K A;  1ERC A;  4EDK A; 
#chains in the Genus database with same CATH homology
 4EDR A;  4EE1 A;  4EDG A;  2LMK A;  4EDT A;  3B39 A;  1DDE A;  2NSW A;  1EQN A;  1DD9 A;  2KK2 A;  2B39 A;  4EDV A;  3KXR A;  2ERL A;  3KLS A;  2NSV A;  2KC6 A;  2AU3 A;  2JMS A;  3CU7 A;  4E2K A;  1ERC A;  4EDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...