2JN0A

Solution nmr structure of the ygdr protein from escherichia coli. northeast structural genomics target er382a.
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
50
structure length
50
Chain Sequence
b'DYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQINRDDVSQIIER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical lipoprotein ygdR
publication title Solution NMR structure of the ygdR protein from Escherichia coli. Northeast Structural Genomics target ER382A.
rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 7
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2006-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2jn0A00
5GANj 5GAN4 4M7AG 3QHSA 3FIFA 4C8QA 1M5Q1 3PGGA 3JB9F 1KQ2A 4EMGA 5LJ3j 3JCMV 1HXDA 1X01A 3FJPA 3V8LA 4F7UA 2EAYA 4C8QF 5DY9A 2E10A 2DEQA 5GMKl 4M7DF 1U1SA 4OP0A 4XQ3A 4C92B 4A53A 4C8QC 3L2ZA 2DXTA 1N9RA 4C92D 3JCMb 4M7DC 4M7AA 4XTXA 2DZCA 1I5LA 2E64A 3JCMh 5LJ5d 1N9SA 3QUIA 3QO3A 1KQ1A 4M77B 3JCMf 4Y91A 4C92E 1Y96A 4M77D 3V7SA 1YCYA 2E65A 1I81A 2RB6A 5GANd 4C92G 4X9CA 4M77E 5GAOn 4M7AC 3M4GA 4RCCA 4PJOB 5GAMh 4PJOD 5GAN3 5GAMf 2E1HA 4EMKB 4XTUA 4J6WA 4XTZA 4M77G 1WPYA 4J6YA 4M75A 5GMKh 2EWNA 4PJOE 5GAOm 2I2LA 4XTVA 1B34B 2DZ9A 3EFSA 3HFNA 4QVCA 1H641 1BIBA 2QTXA 3V8KA 4M7DE 4PJOG 2CGHA 5LJ5h 4WF2A 2DTIA 4M75F 5CAIA 5GAN2 4M78A 3SWNA 4HT8A 1LNXA 5LJ5f 3FB9A 3JCMc 3JCMe 4M75C 1JBMA 1D3BB 4F7UF 2VC8A 4XU1A 3JCMg 5GMKi 2Y90A 3RIRA 4M78F 1WQWA 3JCMX 5GAOl 3BFMA 1I8FA 1WNLA 4HT9A 4JRIA 4M78C 3SWNC 5GAMe 3JCMJ 5I21A 3AHUA 4M7AF 1LJOA 5GAOr 2FB7A 4EMKA 3BDUA 3JB9D 2DXUA 5LJ3d 2DTHA 5GMKe 5GAMg 4XTWA 5GAN7 3HFOA 4C8QB 3JCMP 3V7RA 4C8QD 4M7DB 2EJFA 4M7DD 5LJ5e 4A54A 4JUVA 3JCMW 4X9DA 4F7UB 3JB9G 4C8QE 5GAN5 2EJ9A 5GAMj 3RERA 4C92A 4NOYA 2VXEA 4EMHA 5LJ5g 2RA2A 3JB9J 2DTOA 2DJZA 1LOJA 3INZA 3RKXA 4C8QG 4F7UE 5GMKj 5GAOq 5GAN8 4M7DG 5GANh 4M77A 4M7AD 3RESA 1M8VA 3L1AA 3VU3C 4C92F 1TH7A 5GANf 4JRKA 5LJ3h 3JB9I 4C92C 4NL3A 5LJ5j 2VXFA 4J5YA 5GAN6 4M7AE 4N0AA 5LJ3f 3JB9H 3V7CA 2YHTA 4J6XA 4M77F 4PJOA 2DKGA 4JLIA 4DQ2A 2DVEA 4M77C 2RD1A 4NL2A 1JRIA 4M7DA 3BW1A 4XTYA 5GAMd 4M75B 4PJOF 4MMLA 1B34A 4M75D 4MMKA 4N0AC 3HSBA 1I4K1 4PJOC 3RUXA 1BIAA 3BY7A 2HNIA 2FYKA 4EMKC 4M75E 4XU0A 1HK9A 1WQ7A 4M78B 3SWNB 1D3BA 4XU2A 5GANe 3JCMQ 4M78D 3RKWA 2JN0A 2YLCA 4M75G 4M7AB 5LJ3e 2EJGA 2RM4A 2ZGWA 4RCBA 4XU3A 3RKYA 5GANg 4M78E 3SB2A 1MGQA 2YLBA 5GAOp 4HA8A 2E41A 1Y96B 3V8JA 4PNOA 4F7UG 3JCMd 5LJ3g 3QSUA 2K57A 4M78G 4V2SA 5GMKm 4QVDA 3EFRA 1U1TA 3GIBA
chains in the Genus database with same CATH superfamily
5J39A 5HK0A 2QA4Q 1WHGA 1HXDA 4J7FA 1YJNT 2BZ8A 2O4XB 3VS7A 1QWEA 2KDSA 2L0AA 2DZCA 1IGUA 3OS5A 3M0UA 4IUVA 4X9CA 1M3BA 1M1KC 3CCUA 2JJ9A 3G4SA 4ZN3A 2I2LA 3HP9A 4XTVA 3OYEA 3NHNA 3QDRB 3X24B 4BDYA 3PMIA 4JS4A 4HT8A 3JCMe 1YJ9Q 1NEGA 3CCQQ 3QG1A 1LCKA 1P92A 2CSQA 3H0HA 1QVPA 4ZTJA 2H8HA 4B6MA 1VQ7A 1GXIE 1UDLA 4C8QB 1HJDA 1S1NA 2DXBA 4YTLA 1VQMA 3JB9G 1BYMA 3RERA 3OYNA 3X25B 2DJZA 2FRYA 1LOJA 5GAOq 2BTTA 2JS2A 5IH2A 2RJDA 5CK9A 4JRKA 4FCYA 3OW2A 3OW2P 1Y07A 3OSSC 3OYJA 2DF6A 1RAAB 2KRNA 4MMKA 3RDVA 3BY7A 2KT1A 5DM7R 4EMKC 2OTLA 6AT1B 4PJNA 4A4FA 4CC4B 1EX4A 3META 3OYGA 1Y57A 2DE0X 4XU3A 3T9NA 3CPWS 1D1CA 2YLBA 4ATOA 2VKNA 4CC7A 4M78G 2OTJA 4J9FA 1DJ7B 4HXJA 3JRZA 2XIDA 3TCJA 3OQ5A 2M9UA 1BI0A 1MV3A 1WFWA 3DB4A 4C92B 2DPPB 2LJ0A 1GCQA 4M7DC 5FU7C 4LDVA 3EGXA 3VS0A 4ORZA 2CP3A 2RQVA 1RACB 2HZYA 2F5KA 1TU0B 2V26A 2D6FA 1UG1A 2CZ1B 4AG1C 2DVJA 4M77G 2CT3A 4LDXA 2DD5A 3CXCS 4QVCA 3OW2S 3CC2T 2QQ9A 1GFDA 4QT7A 2X4XA 2V8KA 2ZPIB 1YCSB 5I2MA 5I2SA 1MNEA 4RG8A 5CKFA 1SEMA 9ATCB 4ZGEB 2ZPGB 3QJYA 1M1FA 4EMKA 1D0XA 4JRPA 3HFOA 2W10A 1Y7XA 4Y92A 1WI7A 1QKXA 2DXCA 2QQRA 1VQOQ 2HQHA 5HY6A 4NOYA 3A98A 4C5IA 1W4SA 1HSQA 4KGXB 1X2QA 1E6HA 3RESA 1YHQA 1RADB 2EYZA 4LXCA 2VGMA 2BKDN 4E7SA 3CMEQ 4E7KA 2M16A 2A7YA 1UUEA 2DYIA 4WCIA 4M7DA 1NPPA 2E5KA 1YJWT 4A4KA 1WXTA 2JTFA 3CCUQ 2HL3A 1RAGB 2FEIA 1UEBA 3G4SQ 3A8LB 1Y71A 2C06A 5D6YA 3M0TA 2PZ1A 4O5VA 3CCJA 1ZUUA 3A8OB 1VQNT 1JJ2P 1VQ7Q 3CPFA 2MCNA 2YRDA 3RR6A 4F7UA 4DOWA 5A2QE 5FW9A 1U1SA 2MIOA 4BY6B 2RF0A 2O88A 4QW2A 2RI2A 1WGSA 5EG2A 1UGSB 1G5VA 2KE9A 1H3ZA 4Z88A 4D6WA 1G3SA 2GFAA 1QWFA 1X75C 1WJRA 4FYWB 3KFVA 1WHHA 2DA9A 2X4JA 4HVUA 4QQGA 2HSPA 2RI5A 1VQ6A 1V76A 5GAOm 2DZ9A 3QZ9B 4II1A 3MP8A 3MP6A 1VQPT 4PJOG 5LJ5f 2LNVA 5CCAA 5GMKi 3C4SA 5KYXA 1I8FA 1KQSS 4LE9A 2YSQA 2E6NA 1SRMA 1S72T 3FRNA 2FB7A 1NG2A 5CR2A 5GMKe 1PRLC 1TXQA 1R77A 2DX1A 1AWXA 1ZSZB 4BD3A 3QKJA 4J9HA 3QXEB 4F16A 4BB7A 2E12A 1PWTA 3CCSA 1WDXA 2BIVA 2Y4YA 2YUPA 3H0IA 3M4YA 1UJYA 4B9WA 5LJ5g 1M2VA 2HQEA 1ZLMA 2DD4A 2LMJA 4Z8AA 1BCMA 4HCKA 3TEEA 1A0NB 3U23A 2ZPEB 5LJ3h 1MMNA 3OYDA 1OULA 4JZ3A 1KJWA 2CSIA 4RTZA 4XTYA 1IZ6A 3RBBB 3H9NA 2H3JA 3CCLA 1RLPC 3CCRQ 4MDXA 4XU0A 4QKUA 5AT1B 4CI0C 1IO6A 3M58A 2X3WD 2EVRA 2MF2A 2JS0A 3V8JA 3UDCA 1MV0B 3M54A 5GMKm 1VQ4T 1X6GA 2A0FB 2QASA 1KC8R 3LH0A 1KD1U 2MAMA 3I55Q 2P84A 4RKUE 3OB9A 3G71Q 2HBPA 2DXTA 4C0DC 5J26A 5FROA 2E64A 1TUGB 2E3IA 3ZEHA 2X9HA 3GBQA 4FSXA 4MDWA 1QCNA 2LQWA 2LQNA 2RB6A 1KFZA 2YWWA 2FPEA 2CDTA 2O31A 2RHZA 1R0BG 3GPLA 3E1SA 3PIPA 1PG5B 3ME9A 4CC2A 4WF2A 5GAN2 3PT9A 1WXBA 3QJ6A 3ULRB 1KD1C 3OYLA 1VQMT 1M90R 3NGPA 4M78C 5I21A 5I11A 2HD0A 1EFNA 5GAOr 5C6SA 4X34A 5IN1A 2M02A 3IQLA 1VQ5T 1NM7A 3JCMW 3CCJQ 3ZL7C 5GAN5 4RMOA 3VKIA 1E6GA 1G8XA 2J7IA 3EGXB 1WHKA 4LNPA 2OTLT 4PLLA 2EIFA 3V7CA 2YHTA 2ESWA 4DQ2A 4M77C 2GGRA 3WVDB 2JMAA 4FT2A 1I4K1 4L59A 2QQBA 2P0PA 4OMFB 2OTJT 3LW5E 2QGFB 3M0PA 2EFIA 1D3BA 2NUTA 4FW2A 3MEVA 1VQ6Q 4M75G 2QAZA 3OYIA 3SB2A 3EAEA 1MGQA 2XICA 2IIMA 1T0HA 1SHFA 5KYWA 3CMAT 1U1TA 1YJ9A 3MO8A 2QI2A 2RHXA 1W2BA 2P4RA 1W2BP 2CS7A 4M7DF 2LQ8A 3JCMb 1JO8A 3CCSQ 2KEAA 2VV5A 4RG2A 3EHQA 2F1LA 5AYFA 2QQSA 4E7IA 1VQ9Q 4XTUA 2SRCA 5KYYB 2JW4A 2LT1A 4JZ4A 3MKDA 1BIBA 2KMTA 4RUGA 3EG0A 2EGCA 3L2RA 4AG2C 2KNBB 3TQ7P 1SRLA 3KUFA 4F7UF 1UTIA 3VS3A 4JRQA 1EIFA 3CCLQ 1D0YA 3C0CA 2AHJB 5GAMe 3JCMJ 3OA6A 3WVEB 4XK8E 3VJPA 1YHQT 1PD1A 1ACMB 3SHWA 1PNJA 4ZNXA 1K0XA 4X9DA 1OI1A 1AWWA 1BB9A 3L42A 4F7UB 3M53A 2FPFA 1WJSA 3LYIA 2RA2A 3BDLA 3EG2A 5CIUA 5GMKj 4TVRA 1BU1A 2VUBA 2CZ6B 3G1JA 1M4ZA 2HAXA 3LWIA 3OYYA 3M0QA 3UPUA 3I56Q 2RQRA 3VS1A 4N0AC 2VWFA 4PJOC 4MZMA 2KVQG 5GANe 4C0FA 4KBMB 4LDWA 4ELZC 4LD9K 2YXYA 4M7AB 3RKYA 5KYXB 2DK3A 1M1KR 1ZUYA 2ATCB 2LZ6B 3OYFA 5M9OA 2ZZDA 2K2VA 1RL2A 2DBKA 2GF7A 3PE0A 4BI3A 1PRMC 1U5SA 3CCET 4DEXA 1M2VB 1QMCA 1QLYA 2DMOA 1N6AA 3CBOA 3QWXX 4OMPA 2W0ZA 1OPLA 3UWNA 2LRQA 1IRXA 2E1HA 2GBQA 1X27A 4IUUA 3VUBA 2EQUA 3V8KA 2COYA 2DL4A 4L6V5 4JLGA 3CMEA 1JBMA 5CO7A 2CH4W 5KCHA 2ENMA 4IUPA 1QVGA 1QVGP 2VC8A 4J7IA 2JXBA 2DNUA 2ZPBB 3SWNC 3FJ5A 2JM8A 1D1AA 1OEBA 4N4IA 4GLKA 1OV3A 1Q81U 1YITQ 4OB1B 1F1BB 1VQKQ 2PUOB 2FO0A 5A0LA 1SG5A 2GCXA 1TOVA 2LNHB 1IB8A 2L8DA 3TREA 4C8QG 1NE8A 5GAN8 2MI6A 2XG8D 1B3QA 5GAN6 2JT4A 5LJ3f 2KSSA 4MZPA 2CUDA 2EKOA 3VS6A 2ZPHB 2LJ3A 1K73U 2DL3A 1Q81C 2A37A 3RUXA 1FMKA 3MHXA 3CC4A 2RN8A 3QPHA 2QEXA 1YIJA 4M78E 3OYKA 1OZ3A 1K9AA 2E41A 5LJ3g 4FW1A 4D8DA 2DJQA 1XQHA 3EFRA 3PVLA 2E6ZA 2LQKA 2BE9B 5GAN4 4C5GA 1QVGS 1VYTA 3JB9F 1MHNA 1WJQA 3OMGA 2DAQA 1LPLA 5ECAA 4OGEA 1G83A 4J9BA 4BI8B 1K73C 3QBYA 4XTXA 4Z89A 4HCZA 1AOJA 1U3OA 3CQTA 1N9SA 4KRTA 3PVQA 4E6RA 2HKQB 3WXMB 3VUZA 1D1BA 1X6OA 4C92G 4A4EA 4M77E 5CKBA 2G3RA 2AK5A 4J6WA 3G6EQ 3UF4A 2KXDA 4J83A 3VRZA 2R5AA 3JV3A 5IHNA 2K5LA 1H3HA 2LP5A 2PVGB 2HSEB 5FU6B 1I1JA 2DTIA 4M75C 1D3BB 4EDUA 4HKEA 3L2VA 4M78F 1ARKA 4PFPA 2A08A 5D6XA 3OYAA 3GOXA 2C0TA 2O2OA 2FPDA 2GTOA 1Q82U 2K5IA 3CCRA 1O9SA 4JUVA 4F17A 2QA4T 5GAMj 2VXEA 4DBFA 3UA6A 5L23A 2L2PA 4BI4A 2LVMA 3E19A 3CC7Q 1WLPB 2WACA 2J6FA 5FLXE 1WHLA 2ED1A 4M77F 1TWBA 4JLIA 3I55A 3G71A 4PFOA 3I35A 3FC3A 1C0MA 1Q82C 2P0KA 1ZA2B 2IPOB 2FYKA 3HRUA 1V1CA 1WQ7A 4HVWA 3RKWA 4M4ZA 2YLCA 1YJ9T 2MWPA 3CCQT 1UGRB 3A8HB 2EJGA 2NUPA 3CCMQ 1M2OA 3J7AF 1BKBA 3H8ZA 1VQLA 1IGQA 3GIBA 1BBZA 5GANj 2DL8A 4RTYA 1W1FA 3HRSA 2J6KA 1KHIA 3OYMA 5J3BA 4J9GA 1PSEA 1JEGA 4A53A 3KXTA 4LDUA 1I5LA 5LJ5d 3OMCA 5IHKA 1R0CB 1Y96A 1NJIU 1NYGA 1YCYA 2E65A 1Q95G 2F2XA 4L5GA 1G3WA 2RNAA 4M7AC 4RCCA 2CZ7B 3ZFJA 2L89A 3LGFA 2YRVA 2XHCA 3EHRA 4PJOE 3BE3A 1JJ2A 3HFNA 1WHMA 2PVDB 5CAIA 3OBYA 3FB9A 1ABOA 1ABQA 3NTIA 2PTKA 1GRIA 3C95A 4KULA 1YI2Q 3OBWA 3CBPA 1UGVA 5KYNA 2VVKA 3CC4Q 1UGPB 3M9QA 4Z02A 4EPCA 4JJBA 1NJIC 1WYXA 2QEXQ 1YIJQ 4KUDK 4XTWA 2K2MA 1C6VX 1R8OB 4HCCA 4M7DD 5LJ5e 3MEUA 3RMQA 2NWMA 4LUDA 1OOTA 3X28B 3RKXA 3VS4A 4DBRA 3SEMA 1TH7A 1K76A 2F2VA 1VQ8A 4BACA 4BUGA 1HD3A 5FRNA 1PC0A 2A36A 4LUEA 3X20B 3EG9A 4PJOF 2VGNA 2D0NA 4XAXB 1MMDA 1BIAA 3VYGA 1HK9A 1UFFA 2X3XD 1K8AU 2CZ0B 2VASA 2JZ2A 2GQVA 1WX6A 4OVAA 3I9QA 3EH1A 1JJ2S 1VQ9A 4HA8A 1YJNA 1Q86U 4V2SA 1J3TA 1FMWA 4QVDA 3OSVA 4KUIA 3PGGA 2GTJA 1KQ2A 3FJPA 1K9MU 4BDZA 1VQOT 4N4HA 3VS2A 2DEQA 1KD1R 3EFOA 4C8QC 5KE3A 3JCMh 4FSSA 2I0NA 1UHFA 5FWCA 3MP1A 1K8AC 4PJLA 3R6NA 3L2UA 3PMTA 4DBHA 3CMET 2DEUA 4GLMA 5GAN3 2EGAA 2DLPA 2M0YA 1Q86C 2RQWA 4KGZB 2CKKA 2FG0A 2K3XA 2J05A 2HQXA 2EYQA 1SPKA 3CCUT 1RI9A 3I5RA 2HMAA 3M55A 1K9MC 3G4ST 3I56A 3NFCA 1ZUKA 1IHWA 2RHUA 1O75A 4A54A 3MCAB 1SSHA 3DLLA 1AWJA 3OYCA 1VQ7T 1VQLQ 3O5ZA 2KYMA 2YT6A 1UGQB 5FWBA 3CD6Q 1W70A 1AHJB 2FVUA 1FX7A 2L3RA 2HL5C 4AFSC 4C92C 4K11A 2KRSA 2EQJA 4RTXA 2WSEE 2QEXT 5C0MA 3M56A 3LH5A 1Q7YU 2C0IA 2JNGA 3REAB 2J06A 3CBMA 4M75E 2B86A 8AT1B 1UB4A 3CCVQ 1PSFA 2RM4A 1C1AA 2JUFA 2D9TA 4E47A 1QP3A 3RMSA 2RH2A 4JJCA 3OS1A 4OGCA 2KI7A 3DLMA 3A8GB 2O9SA 4Y28E 2R57A 3VYHB 3HPWA 3PTAA 4N4GA 3LGLA 2LJ1A 5DY9A 1Q7YC 4OP0A 4PLIA 3FLGA 2PNIA 2OAWA 4KGVB 1QP2A 4Y91A 4OMMA 1YITA 3CC2A 4A4HA 1VQKA 4EMKB 5HK3A 3LX7A 4J6YA 4HCBA 1VQ8Q 1CSKA 2RO0A 1G3YA 2X35A 3HTRA 1H92A 1M9SA 3E9FA 1RAEB 4M75F 4M78A 1ZX6A 3CCRT 3HHTB 2D0QB 1VIEA 2NUPB 1WQWA 2IVWA 2KRMA 2HBWA 2ED0A 3JB9D 2DXUA 2XU8A 4OB3B 2RQTA 4WTOB 2V8IA 4FL6A 1YJNQ 4M7DB 5FU7B 2EJFA 2CP7A 1M30A 3QDFA 1YP5A 2BUDA 3E2UA 3I5SA 3I55T 4E7LA 3G71T 2FZCB 4PJMA 4M77A 5KH6A 5CQXA 2KT8A 3M0SA 2YUOA 2ECZA 5LJ5j 1NEBA 4BY6C 4M7AE 3UT1A 4J6XA 4FIBA 1GFCA 2COZA 2ABLA 4NL2A 1BCOA 2K3YA 1M1GA 2ZCFB 3HRTA 1GBQA 4EIKA 1TUCA 1B34A 3URGA 5I22A 1YN8A 1VA7A 3GF5A 1PKSA 3JCMQ 4PKCC 2OI3A 4M78D 1N8RU 2EYXA 3GP8A 1VQNA 3G6EA 1D09B 4RTVA 1W2BS 4DA4A 4M7AG 1MUZA 2XI9A 3Q1JA 1X01A 2JVVA 1FXXA 3D7SB 2G6FX 4OB2B 2EBPA 4IIOA 3CCJT 1GBRA 4ELYC 1ZSZC 3L2ZA 1IHVA 1WHJA 2RQUA 4M77D 2KBTA 1N8RC 1RLQC 2QXFA 2XDBA 2CUBA 1Z9ZA 4DBQA 1UE9A 5GMKh 1M3CA 1RABB 1CKAA 1X6BA 3EG9B 1MMGA 2CP0A 1CKBA 1IXDA 4J8OA 2QTXA 3M57A 1ZBJA 1Z9QA 5A0GA 1S72A 3A1PA 3CC7A 1NZ9A 2WSCE 1VQ6T 2QK0A 4FYXB 3RIRA 1SHGA 2EGEA 2ZAEA 3TSZA 4JRIA 3AHUA 1H8KA 5LJ3d 4FU6A 4ZN1A 5GAN7 2LT4A 1Q81R 2F69A 2PVOB 4PL6A 3HKSA 1TS9A 4C8QE 3OS0A 1TSFA 3P8DA 1MNDA 3EFOB 3JB9J 3CCMA 2MK5A 3SFMA 1D0ZA 4JDSA 4LN2A 1N27A 2RI3A 1XJWB 4QQDA 3H6ZA 3CCST 2V8JA 2CP5A 2VXFA 4N0AA 4PJOA 2K3BA 2A3LA 1ZSZA 2RD1A 1QKWA 1JRIA 1FWZA 3BW1A 1VQ9T 2XDPA 4AT1B 3CC2Q 1KG1A 3LWHA 1NBEB 1K73R 2HNIA 3TSWA 1SKUB 1OX9A 1VQ4A 1TUDA 5LJ3e 1UECA 4RCBA 2GNCA 3JSCA 3QSUA 3H0FA 3CCLT 3UATA 3C94A 3CPWA 3CPWP 2L3QA 2Z0WA 3V8LA 3UA7A 5IXBA 1YI2A 4C8QF 4IURA 1VOMA 1ZBXA 2E10A 3LLRA 1PD0A 1N9RA 4HVVA 2KXCA 3JCMf 4C92E 3MJXA 4NS5A 4KH1B 4RTUA 3KBGA 1GCQC 2PUKB 2LTOA 4PJOD 2GFUA 1TG0A 4JS5A 1KSWA 1YJWQ 2X51A 3NTHA 3I56T 2MWOA 3TVTA 2R58A 3EFSA 3M59A 3F70A 1BK2A 3SWNA 3ZBDA 2KYBA 2MMPA 2ROTA 2XK0A 1VQ5A 2LCLA 3JCMg 1QW1A 1EZZB 1V29B 2EYYA 3CXCA 3CXCP 4IUTA 4F14A 1AWOA 1YWPA 1LJOA 3GNGA 1NLOC 2FZKB 1VQNQ 1KHCA 4C0DB 3S3NA 2EQMA 1PM3A 2CREA 5LL6S 1Q82R 1X2KA 4JJDA 5CQYA 2EW3A 1JXMA 3SDZA 2NUTB 2JM9A 5KCOA 3L1AA 4C92F 3S6WA 1G2BA 2E3HA 5EC7A 3C12A 5KYWB 2FL7A 2P0QA 5CKDA 5HCKA 1VQPQ 3HSBA 4LDYA 4M78B 2LCCA 3CMAA 2A28A 4CRIA 2KR3A 4X1VA 2ZGWA 1S72Q 1NLPC 1FMVA 4AFUC 3M5AA 3QHSA 4EMGA 4OF1A 3JCMV 1YITT 1VQKT 4R0KA 1RAFB 2RPNA 3NMZC 2MOXA 4BE2A 2RJCA 1JB0E 2AKKA 2Y4XA 4M77B 1M8MA 2P4TA 1BI3A 2H3EB 1K1ZA 4F04B 3NPFA 1I81A 2RHYA 5L8RE 3RNJA 1I07A 5GAOn 1NJIR 5GAMh 1SSFA 3MEAA 2KK4A 4XTZA 2OAUA 4M75A 2HEQA 5IT9E 3MEWA 1AEYA 1B34B 5DLQE 3CD6A 1XTDA 1H641 1VUBA 3ASKA 4OMQA 1LNXA 1YWOA 4UC4A 5IHIA 4D8KA 1BI1A 5CKEA 3BFMA 1JQQA 2VB6A 4B9XA 1HYOA 2KQWA 1VQ4Q 1AT1B 1Y0MA 2IG0A 2XDDA 2WSFE 5KYYA 2HCKA 2EYWA 1KQSA 1KQSP 4R55A 3CCVA 2CYZB 2K7AA 4C5HA 3JAME 5D7UA 4RTTA 2DRMA 3INZA 3S3OA 3DB3A 5GANh 4P5NA 3VU3C 3A8MB 4E7HA 3REBB 2DILA 3JB9H 1RI0A 4RTWA 1YNZA 4AMCA 2XD0A 2M0OA 4GBQA 3G6ET 2EPDA 2DL5A 2ROLA 2AZVA 4M75D 2YRCA 4A63B 1VQMQ 2E5QA 1TTHB 1K8AR 2JMCA 3EG3A 2YDLA 2DIQA 2DRKA 2QDYB 1VQ5Q 3CCEA 2KROA 5KYUA 1Q86R 1XOVA 1M5Q1 3GLXA 2O01E 1YFNA 5LJ3j 2L3PA 1PCXA 1QCFA 3EGDA 2DFUA 3X26B 1OYXA 4PK4A 1K9MR 4BE0A 4M7AA 2PQWA 1NPRA 2FHDA 2M51A 3QUIA 3QO3A 2F2WA 2OTLQ 4AFQC 3V7SA 3PFSA 3CC7T 2CP2A 2RK1A 1I5OB 4PJOB 2E4HA 2BZYA 4CC3A 2QYZA 4ZGDB 2ZPFB 4OMNA 3QIIA 2OTJQ 2K4YA 3A5ZB 2LDMA 2DL7A 1VIFA 2DM1A 2Y90A 3CMAQ 3GNFB 2B8AA 3CCMT 1GL5A 2D1XA 4IKFA 2SEMA 3M0RA 3JCMP 3L2WA 2CP6A 1WZOA 2O4XA 4PJJA 4ME7A 2E70A 2EJ9A 2HDAA 4EMHA 2K9GA 2DTOA 3EG1A 1FYNA 4M7AD 5IXFA 3EH2A 1W6XA 2DERA 5DLOA 3DKMA 1RUWA 3MPUB 2AT1B 1WA7A 2K6DA 1T3LA 4FYVB 1Q7YR 3SWNB 2C0OA 1QQJA 4XU2A 1AZEA 5FU6C 1YI2T 2LX7A 3TU4K 4GY5A 4OMOA 3NTKA 2KY9A 4FM4B 1YBYA 1YHQQ 1KC8U 2JTEA 5IAYA 4E7ZA 3CC4T 4C8QA 3FIFA 1YIJT 2PU9B 4KT0E 3THKA 2RJFA 1K4US 1IREB 3FEOA 1QCOA 2QDLA 3FDRA 4ESRA 4BE1A 5KE2A 1X69A 2D8HA 1XNIA 2V1QA 1KK7A 1M27C 1MMAA 2DO3A 2XMFA 3M4GA 1OPKA 2COWA 2CT4A 3ER0A 2FRWA 1WIEA 5HKCA 3QWYA 2XKOC 4FYYB 1KC8C 2JOYA 2M1HA 5GJVB 4M7DE 2CGHA 3CEYA 1OU8A 3AT1B 1OZ2A 4ZTFA 1M90U 3P8HA 5GAOl 5CKHA 1WNLA 4HT9A 2QA4A 3O8VA 1K0SA 1VYUA 3BDUA 3G7ZA 4JPBW 2DTHA 2LCSA 4C0ZA 3J81E 1UJ0A 1AVZC 2OX7A 2X4WA 4C8QD 5FRMA 1AD5A 4ANJA 3R6OA 2RK2A 1N5ZA 2AKLA 2NYSA 3H41A 3CCEQ 4C92A 1M3AA 4E2FB 4AFZC 1ZSGA 2J6OA 2QGGA 4J9CA 4F7UE 4M7DG 1M8VA 2VYTA 4C0GA 4IUQA 4DEYA 3OYBA 1M90C 4NL3A 2L3SA 2GQIA 2DKGA 3HL8A 2DVEA 2MPXC 2YUNA 2RJEA 3CCQA 4IIMA 5GAMd 4M75B 2R5MA 4JJNK 4MMLA 3SD4A 2LX9A 1OX8A 1E7OA 2JN0A 2DIGA 4MZTA 2V1RA 2NUZA 1LVKA 3OY9A 1N8RR 3QYGB 5D6WA 1Y96B 4F7UG 1YJWA 2K57A 4VUBA 2YUQA 4KH0B 1VYVA 1X43A 1JXOA 3PNWC 8ATCB 2QTVA 3EGUA 4J9IA 1B07A 3VV0A 1QVFA 1QVFP 2EAYA 1U8RA 1ZHIA 1RAHB 5GMKl 2RHIA 4XQ3A 2OJ2A 5CVIA 2QG9B 1VQLT 2EQIA 4C92D 3VRYA 2BE7D 5A0DA 4PFZA 3N5BB 1KQ1A 2RMOA 1T3SA 4J9DA 3CD6T 1U06A 1ZQ1A 5GANd 2LC4A 2EQKA 5GJWB 2DBMA 3E9GA 1RAIB 4O6JA 2EKHA 2AIRB 2X4YA 2DYBA 5GAMf 1WPYA 3OS2A 2D8JA 2EWNA 4Q5WA 4C5EA 1ZA1B 5LJ5h 1T0JA 2K5FA 2CH4A 2KGTA 3QYHB 3JCMc 4E7JA 4XU1A 2KAFA 3JCMX 3CCVT 4QVZA 4M7AF 1VQPA 7AT1B 1UHCA 2DETA 5GAMg 2K79A 5KYUB 1OQKA 1PHTA 3V7RA 4A4GA 3PIOA 4QQ6A 1B7TA 3EGDB 4ZGJB 3J80E 3VS5A 5GANf 1JU5C 1QVFS 3JB9I 1WXUA 4J5YA 3P8BB 1GCPA 4R56A 3OYHA 2JTMA 2O9VA 2FZGB 4FT4A 3L2QA 2F5TX 2AZSA 1NYFA 2HKNA 2QQAA 3QZ5B 1VQ8T 4J9EA 1BI2A 1I0CA 1PKTA 3S3MA 4OMLA 2MYSA 4OB0B 1KIKA 4LD6A 2BZXA 5GANg 1M1KU 5GAOp 4DOVA 1SF9A 4PNOA 3JCMd 1AZGB 1VQOA 1G3TA 2NLUA 2L5QA 1OU9A
chains in the Genus database with same CATH topology
3OSVA 3M5AA 3QHSA 5J39A 4KUIA 3PGGA 1YJ9A 5HK0A 1KQ2A 3MO8A 4EMGA 4OF1A 2QI2A 3JCMV 1HXDA 2RHXA 3FJPA 1YITT 4J7FA 1YJNT 2O4XB 1W2BA 1K9MU 2KDSA 2CS7A 4BDZA 1VQOT 4N4HA 1VQKT 4M7DF 2DEQA 2LQ8A 4C8QC 3JCMb 5KE3A 2DZCA 3OS5A 2RJCA 4BE2A 3JCMh 1JB0E 2Y4XA 4M77B 2P4TA 1BI3A 2VV5A 3MP1A 4RG2A 1K8AC 5L8RE 1I81A 2RHYA 4IUVA 3L2UA 3PMTA 4X9CA 5AYFA 5GAOn 3CMET 5GAMh 1M1KC 1SSFA 2QQSA 3MEAA 2KK4A 5GAN3 3CCUA 4E7IA 4XTUA 4XTZA 2OAUA 4M75A 1Q86C 3G4SA 4ZN3A 5IT9E 2I2LA 3HP9A 2CKKA 2LT1A 3MEWA 4XTVA 1B34B 5DLQE 3OYEA 1XTDA 3CD6A 1H641 1BIBA 3QDRB 2K3XA 1VUBA 3X24B 2KMTA 3ASKA 3PMIA 4JS4A 4BDYA 4HT8A 1LNXA 2HQXA 3JCMe 3L2RA 2EYQA 3CCUT 4UC4A 3QG1A 3M55A 1K9MC 1BI1A 3KUFA 5CKEA 4F7UF 4JRQA 3G4ST 1P92A 1EIFA 3BFMA 1QVPA 4ZTJA 3I56A 2AHJB 4B9XA 5GAMe 2KQWA 3JCMJ 1VQ7A 2IG0A 2XDDA 3OA6A 3WVEB 1GXIE 2WSFE 3NFCA 4XK8E 3VJPA 1YHQT 2RHUA 4C8QB 4YTLA 2DXBA 1KQSA 1O75A 4A54A 4R55A 3MCAB 1OI1A 4X9DA 1VQMA 3DLLA 3L42A 4F7UB 3CCVA 2CYZB 3M53A 4C5HA 3OYCA 3JB9G 3JAME 1VQ7T 3OYNA 3RERA 1BYMA 1WJSA 3LYIA 2RA2A 1UGQB 3X25B 2DJZA 3BDLA 1LOJA 3INZA 3S3OA 5CIUA 5GMKj 3DB3A 4TVRA 5GAOq 5GANh 2RJDA 4P5NA 3VU3C 1AHJB 2VUBA 3A8MB 2CZ6B 2FVUA 4JRKA 1FX7A 2L3RA 5CK9A 4E7HA 4C92C 1M4ZA 3OW2A 2HAXA 3LWIA 3JB9H 3OYYA 1Y07A 1RI0A 3OSSC 2EQJA 3OYJA 2WSEE 2QEXT 5C0MA 3UPUA 3M56A 2XD0A 2M0OA 3G6ET 1Q7YU 4M75D 4MMKA 4N0AC 2JNGA 4PJOC 3BY7A 5DM7R 4EMKC 2OTLA 3CBMA 4M75E 4MZMA 4A4FA 2KVQG 5GANe 3META 4C0FA 3OYGA 1UB4A 4KBMB 4LDWA 4ELZC 4LD9K 4M7AB 2E5QA 1PSFA 2RM4A 4XU3A 3RKYA 3T9NA 3CPWS 2YLBA 2JUFA 2D9TA 4E47A 4ATOA 1QP3A 3RMSA 2RH2A 2DK3A 4M78G 3OS1A 2DIQA 4OGCA 2OTJA 2QDYB 3DLMA 3OYFA 5M9OA 3CCEA 3A8GB 2ZZDA 1XOVA 2K2VA 4Y28E 1M5Q1 2R57A 1RL2A 3GLXA 3VYHB 2O01E 3HPWA 1DJ7B 4N4GA 5LJ3j 3PTAA 3LGLA 3JRZA 2XIDA 2GF7A 3OQ5A 3TCJA 3X26B 2M9UA 1BI0A 1OYXA 5DY9A 3DB4A 1Q7YC 4OP0A 4PLIA 2DPPB 4BI3A 4C92B 3FLGA 3CCET 4M7DC 4BE0A 5FU7C 4M7AA 4LDVA 2PQWA 1NPRA 2FHDA 1N6AA 3QUIA 3QO3A 1QP2A 4Y91A 3CBOA 2F5KA 3V7SA 2D6FA 3UWNA 3PFSA 1YITA 2CZ1B 3CC2A 2LRQA 2RK1A 4A4HA 3CC7T 4PJOB 1VQKA 2E1HA 4EMKB 5HK3A 4ZGDB 4IUUA 3LX7A 4J6YA 4M77G 2ZPFB 4HCBA 4LDXA 3VUBA 2DD5A 2EQUA 3QIIA 2RO0A 3CXCS 1G3YA 2K4YA 2X35A 3V8KA 4QVCA 3OW2S 3CC2T 1M9SA 2QQ9A 3E9FA 4M75F 4M78A 4L6V5 4JLGA 3A5ZB 2LDMA 3CMEA 3CCRT 1JBMA 5CO7A 5KCHA 1VIFA 2X4XA 4IUPA 3HHTB 2V8KA 2ZPIB 5I2MA 5I2SA 2VC8A 1QVGA 4J7IA 2D0QB 1VIEA 2Y90A 1WQWA 2IVWA 4RG8A 5CKFA 4ZGEB 2ZPBB 2ZPGB 3SWNC 3GNFB 3QJYA 2B8AA 3CCMT 1M1FA 4N4IA 4EMKA 3JB9D 4GLKA 2DXUA 1Q81U 2XU8A 4OB3B 4IKFA 4JRPA 3HFOA 1Y7XA 2V8IA 4FL6A 4OB1B 2DXCA 3JCMP 4M7DB 3L2WA 5FU7B 2EJFA 2QQRA 2O4XA 2PUOB 4ME7A 5A0LA 2BUDA 5HY6A 2E70A 2EJ9A 4NOYA 3I55T 2GCXA 4EMHA 4E7LA 3G71T 4C5IA 2DTOA 1W4SA 2L8DA 3TREA 4C8QG 1NE8A 5GAN8 4M77A 2MI6A 4M7AD 3RESA 5KH6A 5CQXA 2XG8D 1YHQA 2VGMA 2BKDN 5LJ5j 4M7AE 4BY6C 5GAN6 5LJ3f 4E7KA 3UT1A 2KSSA 5DLOA 3DKMA 4J6XA 4MZPA 4FIBA 2M16A 2A7YA 4NL2A 2K3YA 2EKOA 4M7DA 1M1GA 2ZCFB 2ZPHB 3HRTA 1NPPA 1K73U 1B34A 1Q81C 1YJWT 3URGA 4A4KA 3RUXA 5GAN2 2JTFA 3GF5A 3MHXA 3SWNB 4XU2A 4PKCC 3JCMQ 1U8RA 1UEBA 4M78D 1N8RU 3CC4A 3A8LB 3GP8A 1Y71A 3QPHA 2QEXA 5FU6C 1YIJA 2C06A 4M78E 3OYKA 1VQNA 1OZ3A 5D6YA 3G6EA 1YI2T 2E41A 3TU4K 4GY5A 4O5VA 3NTKA 2KY9A 5LJ3g 4FM4B 1W2BS 4DA4A 3CCJA 1XQHA 1YBYA 3EFRA 1KC8U 5IAYA 3CC4T 2E6ZA 2LQKA 5GAN4 4M7AG 4C5GA 4C8QA 3FIFA 1QVGS 3A8OB 2XI9A 1YIJT 2PU9B 3JB9F 3Q1JA 1MHNA 1WJQA 3OMGA 1VQNT 1X01A 4KT0E 2DAQA 1FXXA 2JVVA 3CPFA 4F7UA 2RJFA 4OGEA 4DOWA 4OB2B 4BI8B 5A2QE 3CCJT 1K73C 1U1SA 4ELYC 1IREB 4BY6B 3L2ZA 3FEOA 4QW2A 3QBYA 4XTXA 3FDRA 4HCZA 2RI2A 1WGSA 1N9SA 5EG2A 4BE1A 1UGSB 5KE2A 1G5VA 4M77D 3WXMB 3VUZA 1H3ZA 1XNIA 1N8RC 4D6WA 1G3SA 2QXFA 2XDBA 2DO3A 1X6OA 2GFAA 4C92G 4A4EA 4M77E 5CKBA 1X75C 3M4GA 1WJRA 2G3RA 3ER0A 2X4JA 4J6WA 4QQGA 4J83A 2RI5A 2R5AA 5GMKh 5HKCA 1VQ6A 2XKOC 5GAOm 1KC8C 2K5LA 2JOYA 2PVGB 2DZ9A 2M1HA 3QZ9B 4II1A 4J8OA 2QTXA 3M57A 3MP8A 5FU6B 3MP6A 1VQPT 4M7DE 4PJOG 2CGHA 5A0GA 1S72A 2DTIA 3CC7A 3CEYA 1NZ9A 5LJ5f 1OZ2A 4M75C 1D3BB 2LNVA 4ZTFA 2WSCE 1M90U 5CCAA 4EDUA 3P8HA 4HKEA 1VQ6T 5GMKi 3L2VA 5GAOl 3C4SA 4M78F 3RIRA 1I8FA 5CKHA 1WNLA 1KQSS 4HT9A 4JRIA 2QA4A 2E6NA 3O8VA 3AHUA 1S72T 5D6XA 3OYAA 3GOXA 3FRNA 2FB7A 3BDUA 3G7ZA 5LJ3d 2DTHA 4FU6A 5GMKe 5CR2A 1Q82U 4ZN1A 5GAN7 2K5IA 4C0ZA 3CCRA 1O9SA 3J81E 4BD3A 2LT4A 3QKJA 2X4WA 3QXEB 4C8QD 5FRMA 4BB7A 2E12A 4JUVA 2F69A 2PVOB 3R6OA 3CCSA 2RK2A 4PL6A 3HKSA 2QA4T 2BIVA 4C8QE 5GAMj 2Y4YA 3OS0A 4C92A 2VXEA 3M4YA 5LJ5g 3P8DA 4B9WA 3JB9J 3CCMA 2HQEA 4F7UE 3SFMA 4JDSA 4M7DG 4BI4A 1N27A 2DD4A 2LVMA 2RI3A 3TEEA 2VYTA 3E19A 4C0GA 1M8VA 4QQDA 4IUQA 3H6ZA 2ZPEB 3OYBA 2V8JA 5LJ3h 3CCST 2WACA 4NL3A 1M90C 2VXFA 4N0AA 5FLXE 3OYDA 4M77F 4PJOA 2DKGA 2A3LA 3HL8A 4JLIA 3I55A 2DVEA 2RD1A 3G71A 1JRIA 1FWZA 3BW1A 2RJEA 3CCQA 4XTYA 2XDPA 5GAMd 1VQ9T 4M75B 1IZ6A 2R5MA 4JJNK 4MMLA 3SD4A 3FC3A 1KG1A 2LX9A 2P0KA 3LWHA 1Q82C 2H3JA 3CCLA 2HNIA 2FYKA 4MDXA 4XU0A 3HRUA 1WQ7A 4CI0C 1VQ4A 3RKWA 3M58A 2JN0A 2YLCA 1YJ9T 2MWPA 2DIGA 3CCQT 1UGRB 3A8HB 4MZTA 5LJ3e 2EJGA 4RCBA 3OY9A 2MF2A 3JSCA 3QYGB 5D6WA 1Y96B 3UDCA 3V8JA 4F7UG 3QSUA 3CCLT 1YJWA 3J7AF 1BKBA 2K57A 4VUBA 3H8ZA 3M54A 5GMKm 1VQ4T 1VQLA 3GIBA 5GANj 3PNWC 3HRSA 3C94A 1KHIA 3OYMA 3LH0A 3CPWA 3V8LA 3VV0A 1KD1U 1QVFA 5J3BA 2MAMA 1YI2A 2EAYA 3OB9A 4RKUE 1ZHIA 4IURA 4C8QF 1ZBXA 2E10A 2HBPA 3LLRA 5GMKl 2RHIA 4XQ3A 1PSEA 5CVIA 4A53A 1VQLT 3KXTA 2DXTA 1N9RA 4LDUA 4C0DC 4C92D 5J26A 5FROA 1I5LA 2E64A 5A0DA 3N5BB 5LJ5d 3OMCA 3ZEHA 1KQ1A 3JCMf 4FSXA 4MDWA 4C92E 1Y96A 3CD6T 1NJIU 4NS5A 2RB6A 1YCYA 1ZQ1A 2E65A 2LC4A 5GANd 2EQKA 3E9GA 3KBGA 4L5GA 1G3WA 4M7AC 4O6JA 4RCCA 2CZ7B 3ZFJA 2PUKB 2LTOA 2X4YA 4PJOD 2L89A 5GAMf 3LGFA 2RHZA 2GFUA 1WPYA 2YRVA 3OS2A 2XHCA 3GPLA 4JS5A 2EWNA 3E1SA 4PJOE 3NTHA 3I56T 2MWOA 4Q5WA 4C5EA 3PIPA 1JJ2A 2R58A 3EFSA 3M59A 3HFNA 3ME9A 5LJ5h 2PVDB 4WF2A 2K5FA 3F70A 3PT9A 3OBYA 3SWNA 5CAIA 3QJ6A 3ZBDA 3FB9A 3QYHB 3JCMc 1KD1C 2MMPA 3NTIA 3C95A 2XK0A 4E7JA 1VQ5A 2LCLA 4XU1A 4KULA 1QW1A 2KAFA 3OBWA 3JCMg 3JCMX 3OYLA 1VQMT 1V29B 3CCVT 3CXCA 4QVZA 3CBPA 4M78C 4IUTA 5I21A 4M7AF 2HD0A 1LJOA 5GAOr 1VQPA 1UGPB 3GNGA 3M9QA 4X34A 4Z02A 4EPCA 5IN1A 5C6SA 1NJIC 5GAMg 4KUDK 4XTWA 1VQ5T 1KHCA 1R8OB 4HCCA 3V7RA 4A4GA 4C0DB 3S3NA 2EQMA 5LL6S 3PIOA 4M7DD 5LJ5e 3JCMW 4QQ6A 3MEUA 5CQYA 3RMQA 5GAN5 4ZGJB 3X28B 4RMOA 3VKIA 3SDZA 3RKXA 3J80E 5KCOA 3L1AA 4C92F 1TH7A 5GANf 3S6WA 1QVFS 1VQ8A 3JB9I 2OTLT 4J5YA 3P8BB 2EIFA 4PLLA 3V7CA 4R56A 3OYHA 2YHTA 2JTMA 4BACA 4DQ2A 4FT4A 4M77C 3C12A 4BUGA 2F5TX 3L2QA 2FL7A 2QQAA 2P0QA 5CKDA 5FRNA 3WVDB 3X20B 3QZ5B 4PJOF 2VGNA 4XAXB 1VQ8T 3HSBA 4FT2A 1I4K1 4L59A 1BI2A 1BIAA 2QQBA 3VYGA 2P0PA 4LDYA 4OMFB 2OTJT 3LW5E 1HK9A 4M78B 2EFIA 1D3BA 2LCCA 3CMAA 3S3MA 1K8AU 2CZ0B 3MEVA 4CRIA 4OB0B 4M75G 2JZ2A 2GQVA 4LD6A 4OVAA 2ZGWA 5GANg 3OYIA 3SB2A 1JJ2S 3EAEA 1M1KU 1MGQA 2XICA 5GAOp 4DOVA 1VQ9A 4HA8A 1YJNA 4PNOA 3JCMd 1VQOA 1Q86U 4V2SA 1G3TA 4QVDA 3CMAT 2NLUA 1U1TA 2L5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN j;  5GAN 4;  4M7A G;  3QHS A;  3FIF A;  4C8Q A;  1M5Q 1;  3PGG A;  3JB9 F;  1KQ2 A;  4EMG A;  5LJ3 j;  3JCM V;  1HXD A;  1X01 A;  3FJP A;  3V8L A;  4F7U A;  2EAY A;  4C8Q F;  5DY9 A;  2E10 A;  2DEQ A;  5GMK l;  4M7D F;  1U1S A;  4OP0 A;  4XQ3 A;  4C92 B;  4A53 A;  4C8Q C;  3L2Z A;  2DXT A;  1N9R A;  4C92 D;  3JCM b;  4M7D C;  4M7A A;  4XTX A;  2DZC A;  1I5L A;  2E64 A;  3JCM h;  5LJ5 d;  1N9S A;  3QUI A;  3QO3 A;  1KQ1 A;  4M77 B;  3JCM f;  4Y91 A;  4C92 E;  1Y96 A;  4M77 D;  3V7S A;  1YCY A;  2E65 A;  1I81 A;  2RB6 A;  5GAN d;  4C92 G;  4X9C A;  4M77 E;  5GAO n;  4M7A C;  3M4G A;  4RCC A;  4PJO B;  5GAM h;  4PJO D;  5GAN 3;  5GAM f;  2E1H A;  4EMK B;  4XTU A;  4J6W A;  4XTZ A;  4M77 G;  1WPY A;  4J6Y A;  4M75 A;  5GMK h;  2EWN A;  4PJO E;  5GAO m;  2I2L A;  4XTV A;  1B34 B;  2DZ9 A;  3EFS A;  3HFN A;  4QVC A;  1H64 1;  1BIB A;  2QTX A;  3V8K A;  4M7D E;  4PJO G;  2CGH A;  5LJ5 h;  4WF2 A;  2DTI A;  4M75 F;  5CAI A;  5GAN 2;  4M78 A;  3SWN A;  4HT8 A;  1LNX A;  5LJ5 f;  3FB9 A;  3JCM c;  3JCM e;  4M75 C;  1JBM A;  1D3B B;  4F7U F;  2VC8 A;  4XU1 A;  3JCM g;  5GMK i;  2Y90 A;  3RIR A;  4M78 F;  1WQW A;  3JCM X;  5GAO l;  3BFM A;  1I8F A;  1WNL A;  4HT9 A;  4JRI A;  4M78 C;  3SWN C;  5GAM e;  3JCM J;  5I21 A;  3AHU A;  4M7A F;  1LJO A;  5GAO r;  2FB7 A;  4EMK A;  3BDU A;  3JB9 D;  2DXU A;  5LJ3 d;  2DTH A;  5GMK e;  5GAM g;  4XTW A;  5GAN 7;  3HFO A;  4C8Q B;  3JCM P;  3V7R A;  4C8Q D;  4M7D B;  2EJF A;  4M7D D;  5LJ5 e;  4A54 A;  4JUV A;  3JCM W;  4X9D A;  4F7U B;  3JB9 G;  4C8Q E;  5GAN 5;  2EJ9 A;  5GAM j;  3RER A;  4C92 A;  4NOY A;  2VXE A;  4EMH A;  5LJ5 g;  2RA2 A;  3JB9 J;  2DTO A;  2DJZ A;  1LOJ A;  3INZ A;  3RKX A;  4C8Q G;  4F7U E;  5GMK j;  5GAO q;  5GAN 8;  4M7D G;  5GAN h;  4M77 A;  4M7A D;  3RES A;  1M8V A;  3L1A A;  3VU3 C;  4C92 F;  1TH7 A;  5GAN f;  4JRK A;  5LJ3 h;  3JB9 I;  4C92 C;  4NL3 A;  5LJ5 j;  2VXF A;  4J5Y A;  5GAN 6;  4M7A E;  4N0A A;  5LJ3 f;  3JB9 H;  3V7C A;  2YHT A;  4J6X A;  4M77 F;  4PJO A;  2DKG A;  4JLI A;  4DQ2 A;  2DVE A;  4M77 C;  2RD1 A;  4NL2 A;  1JRI A;  4M7D A;  3BW1 A;  4XTY A;  5GAM d;  4M75 B;  4PJO F;  4MML A;  1B34 A;  4M75 D;  4MMK A;  4N0A C;  3HSB A;  1I4K 1;  4PJO C;  3RUX A;  1BIA A;  3BY7 A;  2HNI A;  2FYK A;  4EMK C;  4M75 E;  4XU0 A;  1HK9 A;  1WQ7 A;  4M78 B;  3SWN B;  1D3B A;  4XU2 A;  5GAN e;  3JCM Q;  4M78 D;  3RKW A;  2JN0 A;  2YLC A;  4M75 G;  4M7A B;  5LJ3 e;  2EJG A;  2RM4 A;  2ZGW A;  4RCB A;  4XU3 A;  3RKY A;  5GAN g;  4M78 E;  3SB2 A;  1MGQ A;  2YLB A;  5GAO p;  4HA8 A;  2E41 A;  1Y96 B;  3V8J A;  4PNO A;  4F7U G;  3JCM d;  5LJ3 g;  3QSU A;  2K57 A;  4M78 G;  4V2S A;  5GMK m;  4QVD A;  3EFR A;  1U1T A;  3GIB A; 
#chains in the Genus database with same CATH topology
 5J39 A;  5HK0 A;  2QA4 Q;  1WHG A;  1HXD A;  4J7F A;  1YJN T;  2BZ8 A;  2O4X B;  3VS7 A;  1QWE A;  2KDS A;  2L0A A;  2DZC A;  1IGU A;  3OS5 A;  3M0U A;  4IUV A;  4X9C A;  1M3B A;  1M1K C;  3CCU A;  2JJ9 A;  3G4S A;  4ZN3 A;  2I2L A;  3HP9 A;  4XTV A;  3OYE A;  3NHN A;  3QDR B;  3X24 B;  4BDY A;  3PMI A;  4JS4 A;  4HT8 A;  3JCM e;  1YJ9 Q;  1NEG A;  3CCQ Q;  3QG1 A;  1LCK A;  1P92 A;  2CSQ A;  3H0H A;  1QVP A;  4ZTJ A;  2H8H A;  4B6M A;  1VQ7 A;  1GXI E;  1UDL A;  4C8Q B;  1HJD A;  1S1N A;  2DXB A;  4YTL A;  1VQM A;  3JB9 G;  1BYM A;  3RER A;  3OYN A;  3X25 B;  2DJZ A;  2FRY A;  1LOJ A;  5GAO q;  2BTT A;  2JS2 A;  5IH2 A;  2RJD A;  5CK9 A;  4JRK A;  4FCY A;  3OW2 A;  3OW2 P;  1Y07 A;  3OSS C;  3OYJ A;  2DF6 A;  1RAA B;  2KRN A;  4MMK A;  3RDV A;  3BY7 A;  2KT1 A;  5DM7 R;  4EMK C;  2OTL A;  6AT1 B;  4PJN A;  4A4F A;  4CC4 B;  1EX4 A;  3MET A;  3OYG A;  1Y57 A;  2DE0 X;  4XU3 A;  3T9N A;  3CPW S;  1D1C A;  2YLB A;  4ATO A;  2VKN A;  4CC7 A;  4M78 G;  2OTJ A;  4J9F A;  1DJ7 B;  4HXJ A;  3JRZ A;  2XID A;  3TCJ A;  3OQ5 A;  2M9U A;  1BI0 A;  1MV3 A;  1WFW A;  3DB4 A;  4C92 B;  2DPP B;  2LJ0 A;  1GCQ A;  4M7D C;  5FU7 C;  4LDV A;  3EGX A;  3VS0 A;  4ORZ A;  2CP3 A;  2RQV A;  1RAC B;  2HZY A;  2F5K A;  1TU0 B;  2V26 A;  2D6F A;  1UG1 A;  2CZ1 B;  4AG1 C;  2DVJ A;  4M77 G;  2CT3 A;  4LDX A;  2DD5 A;  3CXC S;  4QVC A;  3OW2 S;  3CC2 T;  2QQ9 A;  1GFD A;  4QT7 A;  2X4X A;  2V8K A;  2ZPI B;  1YCS B;  5I2M A;  5I2S A;  1MNE A;  4RG8 A;  5CKF A;  1SEM A;  9ATC B;  4ZGE B;  2ZPG B;  3QJY A;  1M1F A;  4EMK A;  1D0X A;  4JRP A;  3HFO A;  2W10 A;  1Y7X A;  4Y92 A;  1WI7 A;  1QKX A;  2DXC A;  2QQR A;  1VQO Q;  2HQH A;  5HY6 A;  4NOY A;  3A98 A;  4C5I A;  1W4S A;  1HSQ A;  4KGX B;  1X2Q A;  1E6H A;  3RES A;  1YHQ A;  1RAD B;  2EYZ A;  4LXC A;  2VGM A;  2BKD N;  4E7S A;  3CME Q;  4E7K A;  2M16 A;  2A7Y A;  1UUE A;  2DYI A;  4WCI A;  4M7D A;  1NPP A;  2E5K A;  1YJW T;  4A4K A;  1WXT A;  2JTF A;  3CCU Q;  2HL3 A;  1RAG B;  2FEI A;  1UEB A;  3G4S Q;  3A8L B;  1Y71 A;  2C06 A;  5D6Y A;  3M0T A;  2PZ1 A;  4O5V A;  3CCJ A;  1ZUU A;  3A8O B;  1VQN T;  1JJ2 P;  1VQ7 Q;  3CPF A;  2MCN A;  2YRD A;  3RR6 A;  4F7U A;  4DOW A;  5A2Q E;  5FW9 A;  1U1S A;  2MIO A;  4BY6 B;  2RF0 A;  2O88 A;  4QW2 A;  2RI2 A;  1WGS A;  5EG2 A;  1UGS B;  1G5V A;  2KE9 A;  1H3Z A;  4Z88 A;  4D6W A;  1G3S A;  2GFA A;  1QWF A;  1X75 C;  1WJR A;  4FYW B;  3KFV A;  1WHH A;  2DA9 A;  2X4J A;  4HVU A;  4QQG A;  2HSP A;  2RI5 A;  1VQ6 A;  1V76 A;  5GAO m;  2DZ9 A;  3QZ9 B;  4II1 A;  3MP8 A;  3MP6 A;  1VQP T;  4PJO G;  5LJ5 f;  2LNV A;  5CCA A;  5GMK i;  3C4S A;  5KYX A;  1I8F A;  1KQS S;  4LE9 A;  2YSQ A;  2E6N A;  1SRM A;  1S72 T;  3FRN A;  2FB7 A;  1NG2 A;  5CR2 A;  5GMK e;  1PRL C;  1TXQ A;  1R77 A;  2DX1 A;  1AWX A;  1ZSZ B;  4BD3 A;  3QKJ A;  4J9H A;  3QXE B;  4F16 A;  4BB7 A;  2E12 A;  1PWT A;  3CCS A;  1WDX A;  2BIV A;  2Y4Y A;  2YUP A;  3H0I A;  3M4Y A;  1UJY A;  4B9W A;  5LJ5 g;  1M2V A;  2HQE A;  1ZLM A;  2DD4 A;  2LMJ A;  4Z8A A;  1BCM A;  4HCK A;  3TEE A;  1A0N B;  3U23 A;  2ZPE B;  5LJ3 h;  1MMN A;  3OYD A;  1OUL A;  4JZ3 A;  1KJW A;  2CSI A;  4RTZ A;  4XTY A;  1IZ6 A;  3RBB B;  3H9N A;  2H3J A;  3CCL A;  1RLP C;  3CCR Q;  4MDX A;  4XU0 A;  4QKU A;  5AT1 B;  4CI0 C;  1IO6 A;  3M58 A;  2X3W D;  2EVR A;  2MF2 A;  2JS0 A;  3V8J A;  3UDC A;  1MV0 B;  3M54 A;  5GMK m;  1VQ4 T;  1X6G A;  2A0F B;  2QAS A;  1KC8 R;  3LH0 A;  1KD1 U;  2MAM A;  3I55 Q;  2P84 A;  4RKU E;  3OB9 A;  3G71 Q;  2HBP A;  2DXT A;  4C0D C;  5J26 A;  5FRO A;  2E64 A;  1TUG B;  2E3I A;  3ZEH A;  2X9H A;  3GBQ A;  4FSX A;  4MDW A;  1QCN A;  2LQW A;  2LQN A;  2RB6 A;  1KFZ A;  2YWW A;  2FPE A;  2CDT A;  2O31 A;  2RHZ A;  1R0B G;  3GPL A;  3E1S A;  3PIP A;  1PG5 B;  3ME9 A;  4CC2 A;  4WF2 A;  5GAN 2;  3PT9 A;  1WXB A;  3QJ6 A;  3ULR B;  1KD1 C;  3OYL A;  1VQM T;  1M90 R;  3NGP A;  4M78 C;  5I21 A;  5I11 A;  2HD0 A;  1EFN A;  5GAO r;  5C6S A;  4X34 A;  5IN1 A;  2M02 A;  3IQL A;  1VQ5 T;  1NM7 A;  3JCM W;  3CCJ Q;  3ZL7 C;  5GAN 5;  4RMO A;  3VKI A;  1E6G A;  1G8X A;  2J7I A;  3EGX B;  1WHK A;  4LNP A;  2OTL T;  4PLL A;  2EIF A;  3V7C A;  2YHT A;  2ESW A;  4DQ2 A;  4M77 C;  2GGR A;  3WVD B;  2JMA A;  4FT2 A;  1I4K 1;  4L59 A;  2QQB A;  2P0P A;  4OMF B;  2OTJ T;  3LW5 E;  2QGF B;  3M0P A;  2EFI A;  1D3B A;  2NUT A;  4FW2 A;  3MEV A;  1VQ6 Q;  4M75 G;  2QAZ A;  3OYI A;  3SB2 A;  3EAE A;  1MGQ A;  2XIC A;  2IIM A;  1T0H A;  1SHF A;  5KYW A;  3CMA T;  1U1T A;  1YJ9 A;  3MO8 A;  2QI2 A;  2RHX A;  1W2B A;  2P4R A;  1W2B P;  2CS7 A;  4M7D F;  2LQ8 A;  3JCM b;  1JO8 A;  3CCS Q;  2KEA A;  2VV5 A;  4RG2 A;  3EHQ A;  2F1L A;  5AYF A;  2QQS A;  4E7I A;  1VQ9 Q;  4XTU A;  2SRC A;  5KYY B;  2JW4 A;  2LT1 A;  4JZ4 A;  3MKD A;  1BIB A;  2KMT A;  4RUG A;  3EG0 A;  2EGC A;  3L2R A;  4AG2 C;  2KNB B;  3TQ7 P;  1SRL A;  3KUF A;  4F7U F;  1UTI A;  3VS3 A;  4JRQ A;  1EIF A;  3CCL Q;  1D0Y A;  3C0C A;  2AHJ B;  5GAM e;  3JCM J;  3OA6 A;  3WVE B;  4XK8 E;  3VJP A;  1YHQ T;  1PD1 A;  1ACM B;  3SHW A;  1PNJ A;  4ZNX A;  1K0X A;  4X9D A;  1OI1 A;  1AWW A;  1BB9 A;  3L42 A;  4F7U B;  3M53 A;  2FPF A;  1WJS A;  3LYI A;  2RA2 A;  3BDL A;  3EG2 A;  5CIU A;  5GMK j;  4TVR A;  1BU1 A;  2VUB A;  2CZ6 B;  3G1J A;  1M4Z A;  2HAX A;  3LWI A;  3OYY A;  3M0Q A;  3UPU A;  3I56 Q;  2RQR A;  3VS1 A;  4N0A C;  2VWF A;  4PJO C;  4MZM A;  2KVQ G;  5GAN e;  4C0F A;  4KBM B;  4LDW A;  4ELZ C;  4LD9 K;  2YXY A;  4M7A B;  3RKY A;  5KYX B;  2DK3 A;  1M1K R;  1ZUY A;  2ATC B;  2LZ6 B;  3OYF A;  5M9O A;  2ZZD A;  2K2V A;  1RL2 A;  2DBK A;  2GF7 A;  3PE0 A;  4BI3 A;  1PRM C;  1U5S A;  3CCE T;  4DEX A;  1M2V B;  1QMC A;  1QLY A;  2DMO A;  1N6A A;  3CBO A;  3QWX X;  4OMP A;  2W0Z A;  1OPL A;  3UWN A;  2LRQ A;  1IRX A;  2E1H A;  2GBQ A;  1X27 A;  4IUU A;  3VUB A;  2EQU A;  3V8K A;  2COY A;  2DL4 A;  4L6V 5;  4JLG A;  3CME A;  1JBM A;  5CO7 A;  2CH4 W;  5KCH A;  2ENM A;  4IUP A;  1QVG A;  1QVG P;  2VC8 A;  4J7I A;  2JXB A;  2DNU A;  2ZPB B;  3SWN C;  3FJ5 A;  2JM8 A;  1D1A A;  1OEB A;  4N4I A;  4GLK A;  1OV3 A;  1Q81 U;  1YIT Q;  4OB1 B;  1F1B B;  1VQK Q;  2PUO B;  2FO0 A;  5A0L A;  1SG5 A;  2GCX A;  1TOV A;  2LNH B;  1IB8 A;  2L8D A;  3TRE A;  4C8Q G;  1NE8 A;  5GAN 8;  2MI6 A;  2XG8 D;  1B3Q A;  5GAN 6;  2JT4 A;  5LJ3 f;  2KSS A;  4MZP A;  2CUD A;  2EKO A;  3VS6 A;  2ZPH B;  2LJ3 A;  1K73 U;  2DL3 A;  1Q81 C;  2A37 A;  3RUX A;  1FMK A;  3MHX A;  3CC4 A;  2RN8 A;  3QPH A;  2QEX A;  1YIJ A;  4M78 E;  3OYK A;  1OZ3 A;  1K9A A;  2E41 A;  5LJ3 g;  4FW1 A;  4D8D A;  2DJQ A;  1XQH A;  3EFR A;  3PVL A;  2E6Z A;  2LQK A;  2BE9 B;  5GAN 4;  4C5G A;  1QVG S;  1VYT A;  3JB9 F;  1MHN A;  1WJQ A;  3OMG A;  2DAQ A;  1LPL A;  5ECA A;  4OGE A;  1G83 A;  4J9B A;  4BI8 B;  1K73 C;  3QBY A;  4XTX A;  4Z89 A;  4HCZ A;  1AOJ A;  1U3O A;  3CQT A;  1N9S A;  4KRT A;  3PVQ A;  4E6R A;  2HKQ B;  3WXM B;  3VUZ A;  1D1B A;  1X6O A;  4C92 G;  4A4E A;  4M77 E;  5CKB A;  2G3R A;  2AK5 A;  4J6W A;  3G6E Q;  3UF4 A;  2KXD A;  4J83 A;  3VRZ A;  2R5A A;  3JV3 A;  5IHN A;  2K5L A;  1H3H A;  2LP5 A;  2PVG B;  2HSE B;  5FU6 B;  1I1J A;  2DTI A;  4M75 C;  1D3B B;  4EDU A;  4HKE A;  3L2V A;  4M78 F;  1ARK A;  4PFP A;  2A08 A;  5D6X A;  3OYA A;  3GOX A;  2C0T A;  2O2O A;  2FPD A;  2GTO A;  1Q82 U;  2K5I A;  3CCR A;  1O9S A;  4JUV A;  4F17 A;  2QA4 T;  5GAM j;  2VXE A;  4DBF A;  3UA6 A;  5L23 A;  2L2P A;  4BI4 A;  2LVM A;  3E19 A;  3CC7 Q;  1WLP B;  2WAC A;  2J6F A;  5FLX E;  1WHL A;  2ED1 A;  4M77 F;  1TWB A;  4JLI A;  3I55 A;  3G71 A;  4PFO A;  3I35 A;  3FC3 A;  1C0M A;  1Q82 C;  2P0K A;  1ZA2 B;  2IPO B;  2FYK A;  3HRU A;  1V1C A;  1WQ7 A;  4HVW A;  3RKW A;  4M4Z A;  2YLC A;  1YJ9 T;  2MWP A;  3CCQ T;  1UGR B;  3A8H B;  2EJG A;  2NUP A;  3CCM Q;  1M2O A;  3J7A F;  1BKB A;  3H8Z A;  1VQL A;  1IGQ A;  3GIB A;  1BBZ A;  5GAN j;  2DL8 A;  4RTY A;  1W1F A;  3HRS A;  2J6K A;  1KHI A;  3OYM A;  5J3B A;  4J9G A;  1PSE A;  1JEG A;  4A53 A;  3KXT A;  4LDU A;  1I5L A;  5LJ5 d;  3OMC A;  5IHK A;  1R0C B;  1Y96 A;  1NJI U;  1NYG A;  1YCY A;  2E65 A;  1Q95 G;  2F2X A;  4L5G A;  1G3W A;  2RNA A;  4M7A C;  4RCC A;  2CZ7 B;  3ZFJ A;  2L89 A;  3LGF A;  2YRV A;  2XHC A;  3EHR A;  4PJO E;  3BE3 A;  1JJ2 A;  3HFN A;  1WHM A;  2PVD B;  5CAI A;  3OBY A;  3FB9 A;  1ABO A;  1ABQ A;  3NTI A;  2PTK A;  1GRI A;  3C95 A;  4KUL A;  1YI2 Q;  3OBW A;  3CBP A;  1UGV A;  5KYN A;  2VVK A;  3CC4 Q;  1UGP B;  3M9Q A;  4Z02 A;  4EPC A;  4JJB A;  1NJI C;  1WYX A;  2QEX Q;  1YIJ Q;  4KUD K;  4XTW A;  2K2M A;  1C6V X;  1R8O B;  4HCC A;  4M7D D;  5LJ5 e;  3MEU A;  3RMQ A;  2NWM A;  4LUD A;  1OOT A;  3X28 B;  3RKX A;  3VS4 A;  4DBR A;  3SEM A;  1TH7 A;  1K76 A;  2F2V A;  1VQ8 A;  4BAC A;  4BUG A;  1HD3 A;  5FRN A;  1PC0 A;  2A36 A;  4LUE A;  3X20 B;  3EG9 A;  4PJO F;  2VGN A;  2D0N A;  4XAX B;  1MMD A;  1BIA A;  3VYG A;  1HK9 A;  1UFF A;  2X3X D;  1K8A U;  2CZ0 B;  2VAS A;  2JZ2 A;  2GQV A;  1WX6 A;  4OVA A;  3I9Q A;  3EH1 A;  1JJ2 S;  1VQ9 A;  4HA8 A;  1YJN A;  1Q86 U;  4V2S A;  1J3T A;  1FMW A;  4QVD A;  3OSV A;  4KUI A;  3PGG A;  2GTJ A;  1KQ2 A;  3FJP A;  1K9M U;  4BDZ A;  1VQO T;  4N4H A;  3VS2 A;  2DEQ A;  1KD1 R;  3EFO A;  4C8Q C;  5KE3 A;  3JCM h;  4FSS A;  2I0N A;  1UHF A;  5FWC A;  3MP1 A;  1K8A C;  4PJL A;  3R6N A;  3L2U A;  3PMT A;  4DBH A;  3CME T;  2DEU A;  4GLM A;  5GAN 3;  2EGA A;  2DLP A;  2M0Y A;  1Q86 C;  2RQW A;  4KGZ B;  2CKK A;  2FG0 A;  2K3X A;  2J05 A;  2HQX A;  2EYQ A;  1SPK A;  3CCU T;  1RI9 A;  3I5R A;  2HMA A;  3M55 A;  1K9M C;  3G4S T;  3I56 A;  3NFC A;  1ZUK A;  1IHW A;  2RHU A;  1O75 A;  4A54 A;  3MCA B;  1SSH A;  3DLL A;  1AWJ A;  3OYC A;  1VQ7 T;  1VQL Q;  3O5Z A;  2KYM A;  2YT6 A;  1UGQ B;  5FWB A;  3CD6 Q;  1W70 A;  1AHJ B;  2FVU A;  1FX7 A;  2L3R A;  2HL5 C;  4AFS C;  4C92 C;  4K11 A;  2KRS A;  2EQJ A;  4RTX A;  2WSE E;  2QEX T;  5C0M A;  3M56 A;  3LH5 A;  1Q7Y U;  2C0I A;  2JNG A;  3REA B;  2J06 A;  3CBM A;  4M75 E;  2B86 A;  8AT1 B;  1UB4 A;  3CCV Q;  1PSF A;  2RM4 A;  1C1A A;  2JUF A;  2D9T A;  4E47 A;  1QP3 A;  3RMS A;  2RH2 A;  4JJC A;  3OS1 A;  4OGC A;  2KI7 A;  3DLM A;  3A8G B;  2O9S A;  4Y28 E;  2R57 A;  3VYH B;  3HPW A;  3PTA A;  4N4G A;  3LGL A;  2LJ1 A;  5DY9 A;  1Q7Y C;  4OP0 A;  4PLI A;  3FLG A;  2PNI A;  2OAW A;  4KGV B;  1QP2 A;  4Y91 A;  4OMM A;  1YIT A;  3CC2 A;  4A4H A;  1VQK A;  4EMK B;  5HK3 A;  3LX7 A;  4J6Y A;  4HCB A;  1VQ8 Q;  1CSK A;  2RO0 A;  1G3Y A;  2X35 A;  3HTR A;  1H92 A;  1M9S A;  3E9F A;  1RAE B;  4M75 F;  4M78 A;  1ZX6 A;  3CCR T;  3HHT B;  2D0Q B;  1VIE A;  2NUP B;  1WQW A;  2IVW A;  2KRM A;  2HBW A;  2ED0 A;  3JB9 D;  2DXU A;  2XU8 A;  4OB3 B;  2RQT A;  4WTO B;  2V8I A;  4FL6 A;  1YJN Q;  4M7D B;  5FU7 B;  2EJF A;  2CP7 A;  1M30 A;  3QDF A;  1YP5 A;  2BUD A;  3E2U A;  3I5S A;  3I55 T;  4E7L A;  3G71 T;  2FZC B;  4PJM A;  4M77 A;  5KH6 A;  5CQX A;  2KT8 A;  3M0S A;  2YUO A;  2ECZ A;  5LJ5 j;  1NEB A;  4BY6 C;  4M7A E;  3UT1 A;  4J6X A;  4FIB A;  1GFC A;  2COZ A;  2ABL A;  4NL2 A;  1BCO A;  2K3Y A;  1M1G A;  2ZCF B;  3HRT A;  1GBQ A;  4EIK A;  1TUC A;  1B34 A;  3URG A;  5I22 A;  1YN8 A;  1VA7 A;  3GF5 A;  1PKS A;  3JCM Q;  4PKC C;  2OI3 A;  4M78 D;  1N8R U;  2EYX A;  3GP8 A;  1VQN A;  3G6E A;  1D09 B;  4RTV A;  1W2B S;  4DA4 A;  4M7A G;  1MUZ A;  2XI9 A;  3Q1J A;  1X01 A;  2JVV A;  1FXX A;  3D7S B;  2G6F X;  4OB2 B;  2EBP A;  4IIO A;  3CCJ T;  1GBR A;  4ELY C;  1ZSZ C;  3L2Z A;  1IHV A;  1WHJ A;  2RQU A;  4M77 D;  2KBT A;  1N8R C;  1RLQ C;  2QXF A;  2XDB A;  2CUB A;  1Z9Z A;  4DBQ A;  1UE9 A;  5GMK h;  1M3C A;  1RAB B;  1CKA A;  1X6B A;  3EG9 B;  1MMG A;  2CP0 A;  1CKB A;  1IXD A;  4J8O A;  2QTX A;  3M57 A;  1ZBJ A;  1Z9Q A;  5A0G A;  1S72 A;  3A1P A;  3CC7 A;  1NZ9 A;  2WSC E;  1VQ6 T;  2QK0 A;  4FYX B;  3RIR A;  1SHG A;  2EGE A;  2ZAE A;  3TSZ A;  4JRI A;  3AHU A;  1H8K A;  5LJ3 d;  4FU6 A;  4ZN1 A;  5GAN 7;  2LT4 A;  1Q81 R;  2F69 A;  2PVO B;  4PL6 A;  3HKS A;  1TS9 A;  4C8Q E;  3OS0 A;  1TSF A;  3P8D A;  1MND A;  3EFO B;  3JB9 J;  3CCM A;  2MK5 A;  3SFM A;  1D0Z A;  4JDS A;  4LN2 A;  1N27 A;  2RI3 A;  1XJW B;  4QQD A;  3H6Z A;  3CCS T;  2V8J A;  2CP5 A;  2VXF A;  4N0A A;  4PJO A;  2K3B A;  2A3L A;  1ZSZ A;  2RD1 A;  1QKW A;  1JRI A;  1FWZ A;  3BW1 A;  1VQ9 T;  2XDP A;  4AT1 B;  3CC2 Q;  1KG1 A;  3LWH A;  1NBE B;  1K73 R;  2HNI A;  3TSW A;  1SKU B;  1OX9 A;  1VQ4 A;  1TUD A;  5LJ3 e;  1UEC A;  4RCB A;  2GNC A;  3JSC A;  3QSU A;  3H0F A;  3CCL T;  3UAT A;  3C94 A;  3CPW A;  3CPW P;  2L3Q A;  2Z0W A;  3V8L A;  3UA7 A;  5IXB A;  1YI2 A;  4C8Q F;  4IUR A;  1VOM A;  1ZBX A;  2E10 A;  3LLR A;  1PD0 A;  1N9R A;  4HVV A;  2KXC A;  3JCM f;  4C92 E;  3MJX A;  4NS5 A;  4KH1 B;  4RTU A;  3KBG A;  1GCQ C;  2PUK B;  2LTO A;  4PJO D;  2GFU A;  1TG0 A;  4JS5 A;  1KSW A;  1YJW Q;  2X51 A;  3NTH A;  3I56 T;  2MWO A;  3TVT A;  2R58 A;  3EFS A;  3M59 A;  3F70 A;  1BK2 A;  3SWN A;  3ZBD A;  2KYB A;  2MMP A;  2ROT A;  2XK0 A;  1VQ5 A;  2LCL A;  3JCM g;  1QW1 A;  1EZZ B;  1V29 B;  2EYY A;  3CXC A;  3CXC P;  4IUT A;  4F14 A;  1AWO A;  1YWP A;  1LJO A;  3GNG A;  1NLO C;  2FZK B;  1VQN Q;  1KHC A;  4C0D B;  3S3N A;  2EQM A;  1PM3 A;  2CRE A;  5LL6 S;  1Q82 R;  1X2K A;  4JJD A;  5CQY A;  2EW3 A;  1JXM A;  3SDZ A;  2NUT B;  2JM9 A;  5KCO A;  3L1A A;  4C92 F;  3S6W A;  1G2B A;  2E3H A;  5EC7 A;  3C12 A;  5KYW B;  2FL7 A;  2P0Q A;  5CKD A;  5HCK A;  1VQP Q;  3HSB A;  4LDY A;  4M78 B;  2LCC A;  3CMA A;  2A28 A;  4CRI A;  2KR3 A;  4X1V A;  2ZGW A;  1S72 Q;  1NLP C;  1FMV A;  4AFU C;  3M5A A;  3QHS A;  4EMG A;  4OF1 A;  3JCM V;  1YIT T;  1VQK T;  4R0K A;  1RAF B;  2RPN A;  3NMZ C;  2MOX A;  4BE2 A;  2RJC A;  1JB0 E;  2AKK A;  2Y4X A;  4M77 B;  1M8M A;  2P4T A;  1BI3 A;  2H3E B;  1K1Z A;  4F04 B;  3NPF A;  1I81 A;  2RHY A;  5L8R E;  3RNJ A;  1I07 A;  5GAO n;  1NJI R;  5GAM h;  1SSF A;  3MEA A;  2KK4 A;  4XTZ A;  2OAU A;  4M75 A;  2HEQ A;  5IT9 E;  3MEW A;  1AEY A;  1B34 B;  5DLQ E;  3CD6 A;  1XTD A;  1H64 1;  1VUB A;  3ASK A;  4OMQ A;  1LNX A;  1YWO A;  4UC4 A;  5IHI A;  4D8K A;  1BI1 A;  5CKE A;  3BFM A;  1JQQ A;  2VB6 A;  4B9X A;  1HYO A;  2KQW A;  1VQ4 Q;  1AT1 B;  1Y0M A;  2IG0 A;  2XDD A;  2WSF E;  5KYY A;  2HCK A;  2EYW A;  1KQS A;  1KQS P;  4R55 A;  3CCV A;  2CYZ B;  2K7A A;  4C5H A;  3JAM E;  5D7U A;  4RTT A;  2DRM A;  3INZ A;  3S3O A;  3DB3 A;  5GAN h;  4P5N A;  3VU3 C;  3A8M B;  4E7H A;  3REB B;  2DIL A;  3JB9 H;  1RI0 A;  4RTW A;  1YNZ A;  4AMC A;  2XD0 A;  2M0O A;  4GBQ A;  3G6E T;  2EPD A;  2DL5 A;  2ROL A;  2AZV A;  4M75 D;  2YRC A;  4A63 B;  1VQM Q;  2E5Q A;  1TTH B;  1K8A R;  2JMC A;  3EG3 A;  2YDL A;  2DIQ A;  2DRK A;  2QDY B;  1VQ5 Q;  3CCE A;  2KRO A;  5KYU A;  1Q86 R;  1XOV A;  1M5Q 1;  3GLX A;  2O01 E;  1YFN A;  5LJ3 j;  2L3P A;  1PCX A;  1QCF A;  3EGD A;  2DFU A;  3X26 B;  1OYX A;  4PK4 A;  1K9M R;  4BE0 A;  4M7A A;  2PQW A;  1NPR A;  2FHD A;  2M51 A;  3QUI A;  3QO3 A;  2F2W A;  2OTL Q;  4AFQ C;  3V7S A;  3PFS A;  3CC7 T;  2CP2 A;  2RK1 A;  1I5O B;  4PJO B;  2E4H A;  2BZY A;  4CC3 A;  2QYZ A;  4ZGD B;  2ZPF B;  4OMN A;  3QII A;  2OTJ Q;  2K4Y A;  3A5Z B;  2LDM A;  2DL7 A;  1VIF A;  2DM1 A;  2Y90 A;  3CMA Q;  3GNF B;  2B8A A;  3CCM T;  1GL5 A;  2D1X A;  4IKF A;  2SEM A;  3M0R A;  3JCM P;  3L2W A;  2CP6 A;  1WZO A;  2O4X A;  4PJJ A;  4ME7 A;  2E70 A;  2EJ9 A;  2HDA A;  4EMH A;  2K9G A;  2DTO A;  3EG1 A;  1FYN A;  4M7A D;  5IXF A;  3EH2 A;  1W6X A;  2DER A;  5DLO A;  3DKM A;  1RUW A;  3MPU B;  2AT1 B;  1WA7 A;  2K6D A;  1T3L A;  4FYV B;  1Q7Y R;  3SWN B;  2C0O A;  1QQJ A;  4XU2 A;  1AZE A;  5FU6 C;  1YI2 T;  2LX7 A;  3TU4 K;  4GY5 A;  4OMO A;  3NTK A;  2KY9 A;  4FM4 B;  1YBY A;  1YHQ Q;  1KC8 U;  2JTE A;  5IAY A;  4E7Z A;  3CC4 T;  4C8Q A;  3FIF A;  1YIJ T;  2PU9 B;  4KT0 E;  3THK A;  2RJF A;  1K4U S;  1IRE B;  3FEO A;  1QCO A;  2QDL A;  3FDR A;  4ESR A;  4BE1 A;  5KE2 A;  1X69 A;  2D8H A;  1XNI A;  2V1Q A;  1KK7 A;  1M27 C;  1MMA A;  2DO3 A;  2XMF A;  3M4G A;  1OPK A;  2COW A;  2CT4 A;  3ER0 A;  2FRW A;  1WIE A;  5HKC A;  3QWY A;  2XKO C;  4FYY B;  1KC8 C;  2JOY A;  2M1H A;  5GJV B;  4M7D E;  2CGH A;  3CEY A;  1OU8 A;  3AT1 B;  1OZ2 A;  4ZTF A;  1M90 U;  3P8H A;  5GAO l;  5CKH A;  1WNL A;  4HT9 A;  2QA4 A;  3O8V A;  1K0S A;  1VYU A;  3BDU A;  3G7Z A;  4JPB W;  2DTH A;  2LCS A;  4C0Z A;  3J81 E;  1UJ0 A;  1AVZ C;  2OX7 A;  2X4W A;  4C8Q D;  5FRM A;  1AD5 A;  4ANJ A;  3R6O A;  2RK2 A;  1N5Z A;  2AKL A;  2NYS A;  3H41 A;  3CCE Q;  4C92 A;  1M3A A;  4E2F B;  4AFZ C;  1ZSG A;  2J6O A;  2QGG A;  4J9C A;  4F7U E;  4M7D G;  1M8V A;  2VYT A;  4C0G A;  4IUQ A;  4DEY A;  3OYB A;  1M90 C;  4NL3 A;  2L3S A;  2GQI A;  2DKG A;  3HL8 A;  2DVE A;  2MPX C;  2YUN A;  2RJE A;  3CCQ A;  4IIM A;  5GAM d;  4M75 B;  2R5M A;  4JJN K;  4MML A;  3SD4 A;  2LX9 A;  1OX8 A;  1E7O A;  2JN0 A;  2DIG A;  4MZT A;  2V1R A;  2NUZ A;  1LVK A;  3OY9 A;  1N8R R;  3QYG B;  5D6W A;  1Y96 B;  4F7U G;  1YJW A;  2K57 A;  4VUB A;  2YUQ A;  4KH0 B;  1VYV A;  1X43 A;  1JXO A;  3PNW C;  8ATC B;  2QTV A;  3EGU A;  4J9I A;  1B07 A;  3VV0 A;  1QVF A;  1QVF P;  2EAY A;  1U8R A;  1ZHI A;  1RAH B;  5GMK l;  2RHI A;  4XQ3 A;  2OJ2 A;  5CVI A;  2QG9 B;  1VQL T;  2EQI A;  4C92 D;  3VRY A;  2BE7 D;  5A0D A;  4PFZ A;  3N5B B;  1KQ1 A;  2RMO A;  1T3S A;  4J9D A;  3CD6 T;  1U06 A;  1ZQ1 A;  5GAN d;  2LC4 A;  2EQK A;  5GJW B;  2DBM A;  3E9G A;  1RAI B;  4O6J A;  2EKH A;  2AIR B;  2X4Y A;  2DYB A;  5GAM f;  1WPY A;  3OS2 A;  2D8J A;  2EWN A;  4Q5W A;  4C5E A;  1ZA1 B;  5LJ5 h;  1T0J A;  2K5F A;  2CH4 A;  2KGT A;  3QYH B;  3JCM c;  4E7J A;  4XU1 A;  2KAF A;  3JCM X;  3CCV T;  4QVZ A;  4M7A F;  1VQP A;  7AT1 B;  1UHC A;  2DET A;  5GAM g;  2K79 A;  5KYU B;  1OQK A;  1PHT A;  3V7R A;  4A4G A;  3PIO A;  4QQ6 A;  1B7T A;  3EGD B;  4ZGJ B;  3J80 E;  3VS5 A;  5GAN f;  1JU5 C;  1QVF S;  3JB9 I;  1WXU A;  4J5Y A;  3P8B B;  1GCP A;  4R56 A;  3OYH A;  2JTM A;  2O9V A;  2FZG B;  4FT4 A;  3L2Q A;  2F5T X;  2AZS A;  1NYF A;  2HKN A;  2QQA A;  3QZ5 B;  1VQ8 T;  4J9E A;  1BI2 A;  1I0C A;  1PKT A;  3S3M A;  4OML A;  2MYS A;  4OB0 B;  1KIK A;  4LD6 A;  2BZX A;  5GAN g;  1M1K U;  5GAO p;  4DOV A;  1SF9 A;  4PNO A;  3JCM d;  1AZG B;  1VQO A;  1G3T A;  2NLU A;  2L5Q A;  1OU9 A; 
#chains in the Genus database with same CATH homology
 3OSV A;  3M5A A;  3QHS A;  5J39 A;  4KUI A;  3PGG A;  1YJ9 A;  5HK0 A;  1KQ2 A;  3MO8 A;  4EMG A;  4OF1 A;  2QI2 A;  3JCM V;  1HXD A;  2RHX A;  3FJP A;  1YIT T;  4J7F A;  1YJN T;  2O4X B;  1W2B A;  1K9M U;  2KDS A;  2CS7 A;  4BDZ A;  1VQO T;  4N4H A;  1VQK T;  4M7D F;  2DEQ A;  2LQ8 A;  4C8Q C;  3JCM b;  5KE3 A;  2DZC A;  3OS5 A;  2RJC A;  4BE2 A;  3JCM h;  1JB0 E;  2Y4X A;  4M77 B;  2P4T A;  1BI3 A;  2VV5 A;  3MP1 A;  4RG2 A;  1K8A C;  5L8R E;  1I81 A;  2RHY A;  4IUV A;  3L2U A;  3PMT A;  4X9C A;  5AYF A;  5GAO n;  3CME T;  5GAM h;  1M1K C;  1SSF A;  2QQS A;  3MEA A;  2KK4 A;  5GAN 3;  3CCU A;  4E7I A;  4XTU A;  4XTZ A;  2OAU A;  4M75 A;  1Q86 C;  3G4S A;  4ZN3 A;  5IT9 E;  2I2L A;  3HP9 A;  2CKK A;  2LT1 A;  3MEW A;  4XTV A;  1B34 B;  5DLQ E;  3OYE A;  1XTD A;  3CD6 A;  1H64 1;  1BIB A;  3QDR B;  2K3X A;  1VUB A;  3X24 B;  2KMT A;  3ASK A;  3PMI A;  4JS4 A;  4BDY A;  4HT8 A;  1LNX A;  2HQX A;  3JCM e;  3L2R A;  2EYQ A;  3CCU T;  4UC4 A;  3QG1 A;  3M55 A;  1K9M C;  1BI1 A;  3KUF A;  5CKE A;  4F7U F;  4JRQ A;  3G4S T;  1P92 A;  1EIF A;  3BFM A;  1QVP A;  4ZTJ A;  3I56 A;  2AHJ B;  4B9X A;  5GAM e;  2KQW A;  3JCM J;  1VQ7 A;  2IG0 A;  2XDD A;  3OA6 A;  3WVE B;  1GXI E;  2WSF E;  3NFC A;  4XK8 E;  3VJP A;  1YHQ T;  2RHU A;  4C8Q B;  4YTL A;  2DXB A;  1KQS A;  1O75 A;  4A54 A;  4R55 A;  3MCA B;  1OI1 A;  4X9D A;  1VQM A;  3DLL A;  3L42 A;  4F7U B;  3CCV A;  2CYZ B;  3M53 A;  4C5H A;  3OYC A;  3JB9 G;  3JAM E;  1VQ7 T;  3OYN A;  3RER A;  1BYM A;  1WJS A;  3LYI A;  2RA2 A;  1UGQ B;  3X25 B;  2DJZ A;  3BDL A;  1LOJ A;  3INZ A;  3S3O A;  5CIU A;  5GMK j;  3DB3 A;  4TVR A;  5GAO q;  5GAN h;  2RJD A;  4P5N A;  3VU3 C;  1AHJ B;  2VUB A;  3A8M B;  2CZ6 B;  2FVU A;  4JRK A;  1FX7 A;  2L3R A;  5CK9 A;  4E7H A;  4C92 C;  1M4Z A;  3OW2 A;  2HAX A;  3LWI A;  3JB9 H;  3OYY A;  1Y07 A;  1RI0 A;  3OSS C;  2EQJ A;  3OYJ A;  2WSE E;  2QEX T;  5C0M A;  3UPU A;  3M56 A;  2XD0 A;  2M0O A;  3G6E T;  1Q7Y U;  4M75 D;  4MMK A;  4N0A C;  2JNG A;  4PJO C;  3BY7 A;  5DM7 R;  4EMK C;  2OTL A;  3CBM A;  4M75 E;  4MZM A;  4A4F A;  2KVQ G;  5GAN e;  3MET A;  4C0F A;  3OYG A;  1UB4 A;  4KBM B;  4LDW A;  4ELZ C;  4LD9 K;  4M7A B;  2E5Q A;  1PSF A;  2RM4 A;  4XU3 A;  3RKY A;  3T9N A;  3CPW S;  2YLB A;  2JUF A;  2D9T A;  4E47 A;  4ATO A;  1QP3 A;  3RMS A;  2RH2 A;  2DK3 A;  4M78 G;  3OS1 A;  2DIQ A;  4OGC A;  2OTJ A;  2QDY B;  3DLM A;  3OYF A;  5M9O A;  3CCE A;  3A8G B;  2ZZD A;  1XOV A;  2K2V A;  4Y28 E;  1M5Q 1;  2R57 A;  1RL2 A;  3GLX A;  3VYH B;  2O01 E;  3HPW A;  1DJ7 B;  4N4G A;  5LJ3 j;  3PTA A;  3LGL A;  3JRZ A;  2XID A;  2GF7 A;  3OQ5 A;  3TCJ A;  3X26 B;  2M9U A;  1BI0 A;  1OYX A;  5DY9 A;  3DB4 A;  1Q7Y C;  4OP0 A;  4PLI A;  2DPP B;  4BI3 A;  4C92 B;  3FLG A;  3CCE T;  4M7D C;  4BE0 A;  5FU7 C;  4M7A A;  4LDV A;  2PQW A;  1NPR A;  2FHD A;  1N6A A;  3QUI A;  3QO3 A;  1QP2 A;  4Y91 A;  3CBO A;  2F5K A;  3V7S A;  2D6F A;  3UWN A;  3PFS A;  1YIT A;  2CZ1 B;  3CC2 A;  2LRQ A;  2RK1 A;  4A4H A;  3CC7 T;  4PJO B;  1VQK A;  2E1H A;  4EMK B;  5HK3 A;  4ZGD B;  4IUU A;  3LX7 A;  4J6Y A;  4M77 G;  2ZPF B;  4HCB A;  4LDX A;  3VUB A;  2DD5 A;  2EQU A;  3QII A;  2RO0 A;  3CXC S;  1G3Y A;  2K4Y A;  2X35 A;  3V8K A;  4QVC A;  3OW2 S;  3CC2 T;  1M9S A;  2QQ9 A;  3E9F A;  4M75 F;  4M78 A;  4L6V 5;  4JLG A;  3A5Z B;  2LDM A;  3CME A;  3CCR T;  1JBM A;  5CO7 A;  5KCH A;  1VIF A;  2X4X A;  4IUP A;  3HHT B;  2V8K A;  2ZPI B;  5I2M A;  5I2S A;  2VC8 A;  1QVG A;  4J7I A;  2D0Q B;  1VIE A;  2Y90 A;  1WQW A;  2IVW A;  4RG8 A;  5CKF A;  4ZGE B;  2ZPB B;  2ZPG B;  3SWN C;  3GNF B;  3QJY A;  2B8A A;  3CCM T;  1M1F A;  4N4I A;  4EMK A;  3JB9 D;  4GLK A;  2DXU A;  1Q81 U;  2XU8 A;  4OB3 B;  4IKF A;  4JRP A;  3HFO A;  1Y7X A;  2V8I A;  4FL6 A;  4OB1 B;  2DXC A;  3JCM P;  4M7D B;  3L2W A;  5FU7 B;  2EJF A;  2QQR A;  2O4X A;  2PUO B;  4ME7 A;  5A0L A;  2BUD A;  5HY6 A;  2E70 A;  2EJ9 A;  4NOY A;  3I55 T;  2GCX A;  4EMH A;  4E7L A;  3G71 T;  4C5I A;  2DTO A;  1W4S A;  2L8D A;  3TRE A;  4C8Q G;  1NE8 A;  5GAN 8;  4M77 A;  2MI6 A;  4M7A D;  3RES A;  5KH6 A;  5CQX A;  2XG8 D;  1YHQ A;  2VGM A;  2BKD N;  5LJ5 j;  4M7A E;  4BY6 C;  5GAN 6;  5LJ3 f;  4E7K A;  3UT1 A;  2KSS A;  5DLO A;  3DKM A;  4J6X A;  4MZP A;  4FIB A;  2M16 A;  2A7Y A;  4NL2 A;  2K3Y A;  2EKO A;  4M7D A;  1M1G A;  2ZCF B;  2ZPH B;  3HRT A;  1NPP A;  1K73 U;  1B34 A;  1Q81 C;  1YJW T;  3URG A;  4A4K A;  3RUX A;  5GAN 2;  2JTF A;  3GF5 A;  3MHX A;  3SWN B;  4XU2 A;  4PKC C;  3JCM Q;  1U8R A;  1UEB A;  4M78 D;  1N8R U;  3CC4 A;  3A8L B;  3GP8 A;  1Y71 A;  3QPH A;  2QEX A;  5FU6 C;  1YIJ A;  2C06 A;  4M78 E;  3OYK A;  1VQN A;  1OZ3 A;  5D6Y A;  3G6E A;  1YI2 T;  2E41 A;  3TU4 K;  4GY5 A;  4O5V A;  3NTK A;  2KY9 A;  5LJ3 g;  4FM4 B;  1W2B S;  4DA4 A;  3CCJ A;  1XQH A;  1YBY A;  3EFR A;  1KC8 U;  5IAY A;  3CC4 T;  2E6Z A;  2LQK A;  5GAN 4;  4M7A G;  4C5G A;  4C8Q A;  3FIF A;  1QVG S;  3A8O B;  2XI9 A;  1YIJ T;  2PU9 B;  3JB9 F;  3Q1J A;  1MHN A;  1WJQ A;  3OMG A;  1VQN T;  1X01 A;  4KT0 E;  2DAQ A;  1FXX A;  2JVV A;  3CPF A;  4F7U A;  2RJF A;  4OGE A;  4DOW A;  4OB2 B;  4BI8 B;  5A2Q E;  3CCJ T;  1K73 C;  1U1S A;  4ELY C;  1IRE B;  4BY6 B;  3L2Z A;  3FEO A;  4QW2 A;  3QBY A;  4XTX A;  3FDR A;  4HCZ A;  2RI2 A;  1WGS A;  1N9S A;  5EG2 A;  4BE1 A;  1UGS B;  5KE2 A;  1G5V A;  4M77 D;  3WXM B;  3VUZ A;  1H3Z A;  1XNI A;  1N8R C;  4D6W A;  1G3S A;  2QXF A;  2XDB A;  2DO3 A;  1X6O A;  2GFA A;  4C92 G;  4A4E A;  4M77 E;  5CKB A;  1X75 C;  3M4G A;  1WJR A;  2G3R A;  3ER0 A;  2X4J A;  4J6W A;  4QQG A;  4J83 A;  2RI5 A;  2R5A A;  5GMK h;  5HKC A;  1VQ6 A;  2XKO C;  5GAO m;  1KC8 C;  2K5L A;  2JOY A;  2PVG B;  2DZ9 A;  2M1H A;  3QZ9 B;  4II1 A;  4J8O A;  2QTX A;  3M57 A;  3MP8 A;  5FU6 B;  3MP6 A;  1VQP T;  4M7D E;  4PJO G;  2CGH A;  5A0G A;  1S72 A;  2DTI A;  3CC7 A;  3CEY A;  1NZ9 A;  5LJ5 f;  1OZ2 A;  4M75 C;  1D3B B;  2LNV A;  4ZTF A;  2WSC E;  1M90 U;  5CCA A;  4EDU A;  3P8H A;  4HKE A;  1VQ6 T;  5GMK i;  3L2V A;  5GAO l;  3C4S A;  4M78 F;  3RIR A;  1I8F A;  5CKH A;  1WNL A;  1KQS S;  4HT9 A;  4JRI A;  2QA4 A;  2E6N A;  3O8V A;  3AHU A;  1S72 T;  5D6X A;  3OYA A;  3GOX A;  3FRN A;  2FB7 A;  3BDU A;  3G7Z A;  5LJ3 d;  2DTH A;  4FU6 A;  5GMK e;  5CR2 A;  1Q82 U;  4ZN1 A;  5GAN 7;  2K5I A;  4C0Z A;  3CCR A;  1O9S A;  3J81 E;  4BD3 A;  2LT4 A;  3QKJ A;  2X4W A;  3QXE B;  4C8Q D;  5FRM A;  4BB7 A;  2E12 A;  4JUV A;  2F69 A;  2PVO B;  3R6O A;  3CCS A;  2RK2 A;  4PL6 A;  3HKS A;  2QA4 T;  2BIV A;  4C8Q E;  5GAM j;  2Y4Y A;  3OS0 A;  4C92 A;  2VXE A;  3M4Y A;  5LJ5 g;  3P8D A;  4B9W A;  3JB9 J;  3CCM A;  2HQE A;  4F7U E;  3SFM A;  4JDS A;  4M7D G;  4BI4 A;  1N27 A;  2DD4 A;  2LVM A;  2RI3 A;  3TEE A;  2VYT A;  3E19 A;  4C0G A;  1M8V A;  4QQD A;  4IUQ A;  3H6Z A;  2ZPE B;  3OYB A;  2V8J A;  5LJ3 h;  3CCS T;  2WAC A;  4NL3 A;  1M90 C;  2VXF A;  4N0A A;  5FLX E;  3OYD A;  4M77 F;  4PJO A;  2DKG A;  2A3L A;  3HL8 A;  4JLI A;  3I55 A;  2DVE A;  2RD1 A;  3G71 A;  1JRI A;  1FWZ A;  3BW1 A;  2RJE A;  3CCQ A;  4XTY A;  2XDP A;  5GAM d;  1VQ9 T;  4M75 B;  1IZ6 A;  2R5M A;  4JJN K;  4MML A;  3SD4 A;  3FC3 A;  1KG1 A;  2LX9 A;  2P0K A;  3LWH A;  1Q82 C;  2H3J A;  3CCL A;  2HNI A;  2FYK A;  4MDX A;  4XU0 A;  3HRU A;  1WQ7 A;  4CI0 C;  1VQ4 A;  3RKW A;  3M58 A;  2JN0 A;  2YLC A;  1YJ9 T;  2MWP A;  2DIG A;  3CCQ T;  1UGR B;  3A8H B;  4MZT A;  5LJ3 e;  2EJG A;  4RCB A;  3OY9 A;  2MF2 A;  3JSC A;  3QYG B;  5D6W A;  1Y96 B;  3UDC A;  3V8J A;  4F7U G;  3QSU A;  3CCL T;  1YJW A;  3J7A F;  1BKB A;  2K57 A;  4VUB A;  3H8Z A;  3M54 A;  5GMK m;  1VQ4 T;  1VQL A;  3GIB A;  5GAN j;  3PNW C;  3HRS A;  3C94 A;  1KHI A;  3OYM A;  3LH0 A;  3CPW A;  3V8L A;  3VV0 A;  1KD1 U;  1QVF A;  5J3B A;  2MAM A;  1YI2 A;  2EAY A;  3OB9 A;  4RKU E;  1ZHI A;  4IUR A;  4C8Q F;  1ZBX A;  2E10 A;  2HBP A;  3LLR A;  5GMK l;  2RHI A;  4XQ3 A;  1PSE A;  5CVI A;  4A53 A;  1VQL T;  3KXT A;  2DXT A;  1N9R A;  4LDU A;  4C0D C;  4C92 D;  5J26 A;  5FRO A;  1I5L A;  2E64 A;  5A0D A;  3N5B B;  5LJ5 d;  3OMC A;  3ZEH A;  1KQ1 A;  3JCM f;  4FSX A;  4MDW A;  4C92 E;  1Y96 A;  3CD6 T;  1NJI U;  4NS5 A;  2RB6 A;  1YCY A;  1ZQ1 A;  2E65 A;  2LC4 A;  5GAN d;  2EQK A;  3E9G A;  3KBG A;  4L5G A;  1G3W A;  4M7A C;  4O6J A;  4RCC A;  2CZ7 B;  3ZFJ A;  2PUK B;  2LTO A;  2X4Y A;  4PJO D;  2L89 A;  5GAM f;  3LGF A;  2RHZ A;  2GFU A;  1WPY A;  2YRV A;  3OS2 A;  2XHC A;  3GPL A;  4JS5 A;  2EWN A;  3E1S A;  4PJO E;  3NTH A;  3I56 T;  2MWO A;  4Q5W A;  4C5E A;  3PIP A;  1JJ2 A;  2R58 A;  3EFS A;  3M59 A;  3HFN A;  3ME9 A;  5LJ5 h;  2PVD B;  4WF2 A;  2K5F A;  3F70 A;  3PT9 A;  3OBY A;  3SWN A;  5CAI A;  3QJ6 A;  3ZBD A;  3FB9 A;  3QYH B;  3JCM c;  1KD1 C;  2MMP A;  3NTI A;  3C95 A;  2XK0 A;  4E7J A;  1VQ5 A;  2LCL A;  4XU1 A;  4KUL A;  1QW1 A;  2KAF A;  3OBW A;  3JCM g;  3JCM X;  3OYL A;  1VQM T;  1V29 B;  3CCV T;  3CXC A;  4QVZ A;  3CBP A;  4M78 C;  4IUT A;  5I21 A;  4M7A F;  2HD0 A;  1LJO A;  5GAO r;  1VQP A;  1UGP B;  3GNG A;  3M9Q A;  4X34 A;  4Z02 A;  4EPC A;  5IN1 A;  5C6S A;  1NJI C;  5GAM g;  4KUD K;  4XTW A;  1VQ5 T;  1KHC A;  1R8O B;  4HCC A;  3V7R A;  4A4G A;  4C0D B;  3S3N A;  2EQM A;  5LL6 S;  3PIO A;  4M7D D;  5LJ5 e;  3JCM W;  4QQ6 A;  3MEU A;  5CQY A;  3RMQ A;  5GAN 5;  4ZGJ B;  3X28 B;  4RMO A;  3VKI A;  3SDZ A;  3RKX A;  3J80 E;  5KCO A;  3L1A A;  4C92 F;  1TH7 A;  5GAN f;  3S6W A;  1QVF S;  1VQ8 A;  3JB9 I;  2OTL T;  4J5Y A;  3P8B B;  2EIF A;  4PLL A;  3V7C A;  4R56 A;  3OYH A;  2YHT A;  2JTM A;  4BAC A;  4DQ2 A;  4FT4 A;  4M77 C;  3C12 A;  4BUG A;  2F5T X;  3L2Q A;  2FL7 A;  2QQA A;  2P0Q A;  5CKD A;  5FRN A;  3WVD B;  3X20 B;  3QZ5 B;  4PJO F;  2VGN A;  4XAX B;  1VQ8 T;  3HSB A;  4FT2 A;  1I4K 1;  4L59 A;  1BI2 A;  1BIA A;  2QQB A;  3VYG A;  2P0P A;  4LDY A;  4OMF B;  2OTJ T;  3LW5 E;  1HK9 A;  4M78 B;  2EFI A;  1D3B A;  2LCC A;  3CMA A;  3S3M A;  1K8A U;  2CZ0 B;  3MEV A;  4CRI A;  4OB0 B;  4M75 G;  2JZ2 A;  2GQV A;  4LD6 A;  4OVA A;  2ZGW A;  5GAN g;  3OYI A;  3SB2 A;  1JJ2 S;  3EAE A;  1M1K U;  1MGQ A;  2XIC A;  5GAO p;  4DOV A;  1VQ9 A;  4HA8 A;  1YJN A;  4PNO A;  3JCM d;  1VQO A;  1Q86 U;  4V2S A;  1G3T A;  4QVD A;  3CMA T;  2NLU A;  1U1T A;  2L5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...