2JN0A

Solution nmr structure of the ygdr protein from escherichia coli. northeast structural genomics target er382a.
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
50
structure length
50
Chain Sequence
b'DYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQINRDDVSQIIER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical lipoprotein ygdR
publication title Solution NMR structure of the ygdR protein from Escherichia coli. Northeast Structural Genomics target ER382A.
rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 7
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2006-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2jn0A00
2Y90A 3EFSA 3RESA 4M78A 3JCMc 1H641 4PJOF 2DKGA 5GAOn 4C92C 1Y96B 4RCCA 5GANe 3QO3A 1WPYA 1HK9A 4NL3A 4JRIA 3V8LA 4DQ2A 3JB9G 3M4GA 1D3BB 5GAMe 4F7UB 2YLBA 5I21A 5LJ5e 4M77C 4C92B 4X9DA 1Y96A 5DY9A 3SWNC 3JB9D 3JCMh 4J5YA 4M75G 1KQ2A 4M77B 2E41A 3V7SA 2EJFA 4XTVA 4XU2A 5GAOp 4M7DG 4Y91A 2FB7A 3HFNA 3SWNB 1M5Q1 4M75D 4XTXA 4EMKA 1I8FA 1LOJA 1WQWA 3INZA 2CGHA 1BIAA 4OP0A 4M7DD 4M7AG 4C8QG 3RIRA 4F7UE 3SWNA 2JN0A 2VXEA 4C92E 5GMKl 1JBMA 3RUXA 4M7AD 3JCMe 4XQ3A 3FB9A 4M77E 4F7UF 5LJ5d 2FYKA 2VC8A 4M75A 4PNOA 4C92F 5GMKi 3V8KA 4EMKC 5LJ3j 4M7DA 4M78E 2ZGWA 4WF2A 4EMHA 3BW1A 4HT8A 2YLCA 4M77F 3V7CA 4XU3A 2QTXA 3BFMA 4J6YA 4EMKB 4C8QA 3EFRA 3SB2A 3HSBA 5LJ3d 4M7AA 4PJOG 5GAN7 5GAN3 4M78F 3FJPA 1MGQA 4XTUA 5GAMf 5LJ5f 3L2ZA 1X01A 2VXFA 5GMKj 4HT9A 1M8VA 5GAN6 1TH7A 4M75C 3L1AA 2RA2A 3V8JA 5GMKm 2DXTA 3QSUA 4PJOD 2DTOA 4JLIA 4NL2A 5GAMg 5LJ5g 3RKXA 1U1TA 4MMKA 5LJ5j 5GAMj 4A53A 4M7DC 3JCMb 2EWNA 5GAN4 4M75B 5GAN8 3JCMV 2K57A 5GANd 3JCMW 3BDUA 4C8QD 5LJ3f 1YCYA 4M7AC 4C8QC 4M7DB 4J6XA 5GAOl 5GAMd 4PJOE 4X9CA 3JB9H 1I81A 4PJOA 5LJ3g 3JCMX 4RCBA 3VU3C 4N0AA 4M7AB 1I4K1 4C8QB 5CAIA 5GAOr 2DVEA 5GMKh 3RKWA 2RD1A 3JCMf 1LNXA 3QHSA 3RKYA 4XTWA 2DTHA 5GANf 1B34B 4QVDA 3RERA 5LJ5h 2HNIA 4M75E 3JB9F 3JCMg 1U1SA 1WNLA 2DJZA 2YHTA 2E64A 4JUVA 4F7UG 1BIBA 5GAN2 4M7DE 2EJ9A 4C92G 5GANg 1B34A 5GANj 3FIFA 1I5LA 4PJOC 3AHUA 4M75F 1KQ1A 4N0AC 4V2SA 2E65A 3GIBA 4C92D 4C8QE 4M77G 2DZ9A 2E10A 5GMKe 2I2LA 3JCMd 2DZCA 5LJ3h 4HA8A 4MMLA 2RM4A 5GAN5 5GAOm 4M7DF 2DTIA 3JCMJ 3QUIA 4PJOB 1JRIA 4M78G 4NOYA 4M77D 2RB6A 4QVCA 4EMGA 4M7AF 1LJOA 4J6WA 4XTYA 4C8QF 3V7RA 4XTZA 4M78D 1HXDA 1D3BA 2DXUA 4M78C 4F7UA 3JCMP 4C92A 3HFOA 1N9RA 1WQ7A 4XU0A 5GANh 2EJGA 3JB9J 4M7AE 2DEQA 4A54A 3JB9I 5LJ3e 1N9SA 4JRKA 4M78B 2EAYA 5GAMh 5GAOq 4M77A 3BY7A 3PGGA 3JCMQ 2E1HA 4XU1A
chains in the Genus database with same CATH superfamily
4DBHA 1PRMC 3OYFA 1PSFA 3E19A 5KYUB 3CCQT 1UG1A 5L23A 3PIPA 3O5ZA 1Q82R 2JTFA 2GFAA 2PNIA 2XDPA 1UTIA 1AZEA 4J9DA 4A63B 4JDSA 2CGHA 2COZA 5CIUA 2ROTA 4DOWA 2EYQA 1MMGA 3WVDB 3FB9A 3CMAA 3OW2S 2VC8A 1Z9QA 1N8RC 1VYUA 3BFMA 2MPXC 5CKHA 3FJPA 4C0ZA 4OMLA 5KE2A 3L2ZA 2J06A 3N5BB 2JOYA 1Y57A 3L2QA 1M3AA 2EKHA 4JLIA 5GAMg 3RKXA 5KYWA 1QVFP 3EHRA 4DEYA 2DL5A 5FU6B 2X4WA 1HJDA 1QVFS 2EQUA 2LJ1A 1YHQA 1OX9A 1UGRB 2CS7A 1X27A 4PFPA 2CP3A 3RKYA 1HYOA 4JJDA 1AHJB 5I2MA 1WHLA 2XK0A 3CMEA 3GNGA 5CQXA 3GIBA 4HA8A 1SSHA 2JTMA 4IURA 1VQ6T 5HK3A 3OYMA 2EVRA 3ASKA 3CCLQ 2JTEA 3AT1B 3V7RA 2A36A 1K73U 3QZ9B 4OVAA 4M4ZA 2RQUA 3EG9B 4Y92A 1UFFA 1Q81C 1ZLMA 4M78B 2MAMA 3MP1A 2K79A 1ZUKA 4CC7A 4BE1A 2FL7A 4LDVA 1VQNA 3EAEA 1YJWA 4ELZC 1UEBA 1K73C 2KY9A 4QW2A 2LJ3A 2JM9A 3EGDB 3TQ7P 3QO3A 1N27A 5IAYA 2RO0A 2YLBA 1K9AA 4C92B 3CC7Q 2RMOA 2X51A 1AWWA 2AIRB 1GBRA 3SWNB 3PMIA 2OAUA 4KULA 1MV3A 4XK8E 1PKSA 1UGSB 5CO7A 1M1GA 2QTVA 3TEEA 4IUPA 5GMKl 2BZ8A 1TWBA 4A4HA 3ZFJA 1YHQT 1WHMA 1H92A 2DL7A 1AWJA 1ZUUA 1U8RA 1WX6A 1UDLA 4M77F 2DX1A 2QTXA 1UGVA 3CMET 2K2VA 2RJDA 2E6ZA 1YP5A 2FZKB 3THKA 5GAMj 5CVIA 1KK7A 3DLMA 2LQKA 1YN8A 5KYNA 1I81A 3PVQA 3UWNA 1VQ5T 1QWEA 1K8AR 2DE0X 2XI9A 3G6EA 5IXBA 1ZSGA 2E64A 1YJWT 4KH0B 4C92G 1LVKA 1B34A 3MJXA 3FIFA 4ATOA 5C6SA 1KQSA 2IG0A 2E10A 4OB3B 2EW3A 4A4EA 2B8AA 1ZSZC 2F1LA 1KFZA 4PKCC 1K0XA 1QQJA 3M0PA 4VUBA 2ESWA 3OYCA 1QP3A 1ZX6A 2R5MA 5FROA 2YRDA 3QZ5B 1KSWA 4ANJA 2KEAA 1WJQA 4WCIA 1TXQA 1YIJA 6AT1B 3CBMA 2PVOB 4OMMA 2YRCA 2LNHB 5I21A 2FRYA 1TG0A 3VS2A 3M5AA 1F1BB 1T0HA 2W10A 5LL6S 1M5Q1 4XTXA 1LOJA 3OBYA 4IIOA 4F7UE 4LDUA 3P8HA 2EGAA 4XQ3A 2OI3A 2G3RA 2IVWA 1T3SA 2KVQG 2X4YA 3GF5A 4FSXA 3NPFA 4EMKC 3OYLA 2GQVA 2EYXA 2PZ1A 3CCSA 2RQVA 4IKFA 5LJ3d 2RHUA 3HRUA 3CXCP 4FCYA 5IHKA 5FRNA 3TCJA 4BDZA 1VQLQ 4QKUA 4D6WA 1E7OA 3LGLA 5LJ5g 3CXCS 5IHNA 2QI2A 2DIQA 4Z8AA 3S3OA 3OBWA 3SD4A 5HKCA 1XOVA 3OQ5A 1UGQB 2D0NA 4BE2A 4RCBA 2WSFE 2PQWA 1G3WA 4RKUE 3S6WA 3CCJT 4FT2A 4OMFB 4LE9A 4BUGA 2HQEA 3AHUA 4RUGA 3VJPA 2M0YA 3EH2A 3JCMd 4LUEA 1YJ9A 1WZOA 1X2KA 4MMLA 1OX8A 4FIBA 1ACMB 1S72T 3RR6A 4A4KA 2QGFB 2XHCA 3QWYA 2GTJA 1X6BA 3CC2Q 4RG8A 1X6GA 1GCQC 5FU7B 2AT1B 1N9SA 4F14A 3PE0A 1TSFA 3EG9A 2DA9A 3I55Q 1Q86U 4M78A 3OYNA 1K4US 5GAOn 4PL6A 3V8LA 2ZPHB 2PVGB 4BI8B 3FC3A 1M1FA 2EYWA 2VB6A 1WGSA 1XQHA 2RI5A 1FMVA 4Z02A 1GFDA 2OTLA 3M0TA 2D0QB 2MCNA 2O31A 1SEMA 1VQOA 1UECA 3SWNA 3QYHB 2NUPA 5CKBA 3CBOA 5EC7A 3RUXA 1K73R 1XTDA 1OYXA 4A4GA 2NLUA 2X4XA 4BDYA 2YSQA 4C92F 2L8DA 2M16A 4WF2A 4HT8A 2LQNA 2R5AA 1Y71A 4M7AA 2GTOA 1G3TA 1PG5B 2DXBA 2HBPA 1YITQ 1TH7A 2EFIA 1VA7A 3NHNA 3QSUA 1MMAA 2DTOA 2SRCA 4M7DC 1KIKA 5LJ5j 4J8OA 4D8DA 5GAN4 3G4SA 1VYTA 4F16A 4ESRA 1C0MA 3UA6A 3TSZA 3WXMB 2JM8A 3E9GA 3NTKA 3CCUA 3L2VA 3EG2A 2CSQA 1YI2Q 3RKWA 3JCMf 3I9QA 4E2FB 1X6OA 5GANf 2PTKA 4II1A 3MEAA 2YHTA 3LYIA 2LCSA 1OPLA 2KROA 4M7DE 1CKBA 2HCKA 1WXBA 1QVGP 3CCRA 4DBQA 3I56Q 2VUBA 4FSSA 2DZCA 1OZ3A 5LJ3h 1QVGS 3JCMJ 2RB6A 2FPEA 2YWWA 2L3RA 2P0QA 3OYDA 1D3BA 3JCMP 2V8KA 3CCQQ 3M53A 3L42A 2EJGA 2LZ6B 3QG1A 5LJ3e 1WHJA 1G3YA 2DEUA 2ZPGB 3A1PA 1O75A 2JMAA 4J9EA 4P5NA 2VVKA 4RCCA 4NL3A 1EIFA 2HKNA 1VQPA 5IXFA 1MNEA 3RNJA 1PSEA 2FPDA 4RTTA 3JCMh 4J5YA 1HD3A 4ELYC 3KXTA 3UT1A 1CKAA 3V7SA 3OYIA 1M30A 2A0FB 2DM1A 4ZTFA 1W6XA 3REBB 3VKIA 2GQIA 4M7DD 3LH5A 4AFUC 3DB4A 1ZA2B 1ZHIA 5GJWB 1M90U 1JBMA 3JCMe 1V29B 1BU1A 3CCUT 1WJSA 1NBEB 2KT8A 4RTUA 3CD6Q 2EQJA 3SB2A 3CCRT 2K3YA 3L2RA 3H0IA 4M75C 2RA2A 3ZEHA 2EKOA 4Q5WA 5KYYA 2DYIA 1AWOA 3BDUA 3M4YA 4C8QC 3CPWA 4L5GA 2CH4W 2RK2A 2VASA 1WXUA 3PIOA 3KBGA 3CBPA 1ZSZB 2L5QA 1LNXA 2CYZB 1FMKA 4M75E 1VIEA 2EJ9A 3ER0A 2D1XA 1W4SA 4PJOC 3OS1A 3FLGA 4N0AC 4C8QE 2LVMA 2JZ2A 2DXCA 3VV0A 4J7IA 2ZPEB 3OS2A 1WA7A 3CCVA 2ZZDA 4DOVA 4RMOA 5FRMA 4KRTA 4N4IA 2BIVA 3OMGA 4PJOE 2RQRA 1NE8A 3JCMc 2O01E 1UB4A 1HK9A 4FYXB 7AT1B 2RNAA 5CKDA 2AHJB 1KHCA 1ZA1B 4LDYA 1YHQQ 4JZ4A 3QDFA 2A3LA 4C5IA 1NLOC 3H6ZA 2EYYA 4M75D 4KGZB 1M2OA 1RAGB 2V26A 3EG3A 3CMEQ 1D0ZA 3GNFB 2XIDA 5KCOA 3UF4A 1YFNA 4JPBW 3VS0A 3QKJA 2DL4A 4EMHA 2K3XA 1Q86R 8AT1B 4CC2A 1VUBA 4AMCA 2CDTA 2O4XB 2DFUA 2NUZA 1VQ5Q 2IIMA 4C5GA 1N8RU 3L1AA 4PJOD 1X2QA 3OW2P 1AT1B 2VYTA 2X9HA 5A0GA 3JCMW 1VQNQ 2HL5C 1YJWQ 3CCVT 1VYVA 3GLXA 4OB1B 4FYWB 1AD5A 4EIKA 2EBPA 1UE9A 3LX7A 2X3XD 3QHSA 4HVUA 1NEBA 2VKNA 2FPFA 1G8XA 2F2WA 5EG2A 1J3TA 2V1QA 4IUVA 4JUVA 1D0YA 5CK9A 1YJNT 2LQ8A 1SPKA 3HP9A 1D09B 2HL3A 1VQMA 3CD6T 4IUUA 2EYZA 2F69A 1I5OB 3GOXA 2DTIA 3QUIA 1XJWB 1UGPB 2KNBB 4LD9K 3OYAA 4AG2C 2XU8A 4HVWA 5J3BA 2BUDA 4BI4A 2ROLA 3H41A 1Y07A 2BZXA 3JCMQ 4XU1A 1BBZA 2HSEB 1LPLA 4B6MA 1SG5A 2LT1A 1Q81U 2AKKA 1I1JA 2J7IA 1B3QA 2ECZA 4TVRA 3CC4A 1SHGA 2XMFA 8ATCB 3OY9A 3H0FA 2OX7A 1HSQA 3EHQA 4XU2A 5GAOp 2DPPB 3HKSA 2IPOB 2K7AA 4RTYA 1CSKA 2RF0A 5HCKA 1K76A 3CMAT 1RLQC 2RI3A 4X34A 3SHWA 3FDRA 2D9TA 2OAWA 3F70A 2FHDA 3ZL7C 2QXFA 1D0XA 2CP2A 4OB0B 1IZ6A 4HCKA 1TTHB 1VQMT 1KD1R 1X01A 4B9WA 4EDUA 5GAN6 2NUPB 2QDYB 5GMKm 5C0MA 3MO8A 2HKQB 4MMKA 2V8IA 4A53A 3NTIA 4J7FA 2FZGB 4JS5A 1YIJQ 3CCJQ 1QMCA 2Y4XA 4OB2B 4R55A 4M7AB 3HRTA 1QP2A 1C1AA 1KC8U 1TUGB 1M90R 4NS5A 2CP6A 1C6VX 2RQWA 1S72Q 2E4HA 2VV5A 1IRXA 1P92A 3S3MA 1M9SA 1S1NA 1ZSZA 1BB9A 2RM4A 1KC8C 5D6WA 1VQ8A 2MWPA 2QG9B 4BACA 3C0CA 4M78G 1Q7YU 2GBQA 3QJYA 4E7HA 2HMAA 2YDLA 4F7UA 2OTJA 1M2VB 1G5VA 4C0DB 1WFWA 4E7JA 3CCSQ 5A0DA 3JB9I 5KE3A 3I5SA 3VU3C 1VQNT 5ECAA 1Q7YC 2K2MA 3VYHB 4R0KA 2FVUA 1N6AA 2DKGA 3CPWP 1PCXA 1NYGA 4JZ3A 3JB9G 1B7TA 3M4GA 1D3BB 4BY6B 2H8HA 4M77C 3CPWS 3EGUA 3M0RA 3QXEB 1KQ2A 1JU5C 2LQWA 2OJ2A 2P84A 3WVEB 5HK0A 4KGXB 2GCXA 4EMKA 4M7AG 2JUFA 2YUOA 1M3CA 4CI0C 3META 4O6JA 2ENMA 1WLPB 4M77E 5LJ5d 4KBMB 5IT9E 4PJMA 2PVDB 3M9QA 4E6RA 4XU3A 1VQ7A 2CP0A 1I07A 1VQKA 1SKUB 2HAXA 3E2UA 4CC4B 4XTUA 1JJ2P 1FMWA 2G6FX 1NLPC 5GMKj 3OA6A 1A0NB 3VS3A 1MUZA 1VQ8T 2O4XA 5D6YA 2GFUA 1UHFA 1JJ2S 2O88A 1RUWA 1RL2A 1WXTA 1W2BP 1YCYA 1JB0E 2ED0A 2MK5A 4JRPA 2ATCB 3LLRA 2BKDN 1ZUYA 3JCMX 1W2BS 3G6ET 4E7ZA 2XD0A 2K3BA 2EQKA 1PHTA 4FYVB 1VQ4A 2RHZA 4XTWA 2KYMA 5CKFA 5I2SA 1MV0B 2DJZA 1SHFA 5KYYB 2D8JA 3OB9A 2GGRA 3P8BB 1TUCA 1KQ1A 1RADB 2M9UA 1GCQA 1OU9A 1FYNA 1UJ0A 2RHXA 3A8GB 3NMZC 4NOYA 4M77D 1QCOA 2CUDA 1N8RR 1IHWA 2EGCA 2WSEE 1FWZA 1TS9A 1MNDA 3A8OB 4J9BA 1T0JA 3FEOA 2LCCA 1YIJT 2K6DA 4JJBA 1MMNA 4J83A 4Z89A 4OGEA 2JNGA 2RQTA 1VQ7T 3X20B 3EG0A 3PVLA 4X9DA 3OYHA 3KFVA 4YTLA 4X1VA 2PUKB 3CCUQ 2DAQA 1RAEB 4HVVA 1VOMA 4MZMA 2BTTA 2LC4A 1OOTA 2HQHA 2VGNA 2XKOC 3H8ZA 1H8KA 2RK1A 1SSFA 3CCRQ 5CQYA 4ORZA 2KGTA 2FZCB 1VQ4T 3MEUA 3CCST 3LGFA 2CUBA 2JW4A 3KUFA 1X69A 4K11A 5FWBA 1PD0A 3I35A 4BB7A 4M7DA 2YLCA 3V7CA 1WHGA 3A98A 1FX7A 1M27C 4FU6A 2QQAA 3UDCA 3OMCA 1V1CA 4M78F 1Q81R 1MGQA 2QQ9A 2VXFA 1BI0A 1VIFA 2WACA 3DLLA 5FU6C 2AK5A 3UPUA 4HCZA 4NL2A 1PNJA 2CREA 2HDAA 1GXIE 4KH1B 2K57A 5LJ3f 1NPRA 3JV3A 1X43A 1VQPQ 5GAOr 2LNVA 2V8JA 2X3WD 4QVDA 5LJ5h 3JB9F 3JCMg 3QIIA 1U1SA 3QJ6A 1BIBA 1YJ9T 4BE0A 1IGUA 5GANg 4RTZA 2C0OA 2LCLA 2EQIA 4OMOA 3RDVA 1QVFA 4RTXA 3QBYA 2KMTA 4M7AF 2LTOA 4FT4A 2E3HA 5HY6A 4XTZA 1BYMA 2P0KA 3CCMA 4M78C 4PJJA 1OPKA 1EX4A 1WQ7A 2DEQA 1OI1A 1N5ZA 1M2VA 3X26B 1WHKA 3R6NA 4HXJA 3EFSA 1ABQA 4J9HA 3OS0A 3HPWA 4RTWA 5GJVB 1KC8R 1BCOA 4C92C 1W70A 1Y96B 2RJFA 2JS0A 3H0HA 1TU0B 3CC2A 2M02A 3SWNC 2OTLT 2F5TX 3MPUB 4Y91A 1VQOT 5FW9A 3A5ZB 1Q7YR 2DJQA 1QCFA 2JN0A 2Z0WA 4C92E 3T9NA 1R77A 2ZPIB 3PFSA 3UA7A 2BE7D 4M75A 3V8KA 4FW2A 4DBRA 5LJ3j 2DNUA 1AOJA 1NEGA 3IQLA 4QQ6A 1QKWA 3HSBA 3CCVQ 4C8QA 2J6KA 2LMJA 2NYSA 1RAHB 4LNPA 2DLPA 1WDXA 3A8LB 1G2BA 3G4ST 1KQSP 4IIMA 2VGMA 2LRQA 1BK2A 5AYFA 2KAFA 1KQSS 3CCMT 1YJNQ 5GAOl 4E7LA 4X9CA 4F17A 4PJOA 2RHIA 4N0AA 4PJNA 1OZ2A 2RD1A 3M56A 3I5RA 2MOXA 3M54A 3QDRB 2AZVA 3PNWC 4J9GA 5GANj 1AZGB 3EG1A 4V2SA 4C92D 5GAN5 5DM7R 4GLMA 4ZTJA 2RJEA 2RH2A 3VRYA 1UUEA 4PLIA 4RTVA 4OF1A 4J6WA 3TSWA 2FG0A 2HEQA 1VQ9A 1EZZB 1WYXA 2CKKA 2O9VA 4ZGDB 3G71A 2F2VA 3I56A 2KYBA 1WHHA 4ME7A 1H641 1QW1A 2DIGA 1VQPT 3LW5E 4QQGA 1T3LA 4DQ2A 2LX7A 3G1JA 4F7UB 3CMAQ 4QQDA 5DY9A 4BI3A 2PUOB 1RACB 4LD6A 2SEMA 2FB7A 3RBBB 3HFNA 1Z9ZA 1BI1A 5J39A 1UHCA 4PFOA 1H3ZA 2QQSA 1RAIB 1JXOA 1RI0A 2A08A 3FJ5A 3CCEA 2QK0A 1SRLA 2A7YA 2D8HA 1VQMQ 3R6OA 1ZBXA 3VUZA 1R0CB 2EQMA 2ZGWA 1NJIU 5D7UA 4ZGEB 2L3PA 3M59A 4MZTA 4EMKB 3GPLA 2L3QA 4KT0E 5GAN3 4OMPA 4FW1A 3HRSA 5KYXB 3S3NA 2BZYA 3EGXA 2QGGA 1U1TA 3H9NA 3PTAA 1NJIC 3JCMb 2JS2A 3VS5A 2CZ6B 4C8QD 2CT4A 4OGCA 2NWMA 5GAMd 2ZCFB 2YUQA 3L2WA 4JRQA 3CC4Q 2NUTB 1QVPA 3G71T 1ABOA 2QA4A 4FL6A 2HQXA 3CXCA 4F7UG 1TUDA 1PD1A 3MEWA 3ZBDA 2FEIA 2C0IA 2FO0A 3PT9A 1KHIA 1KJWA 2DD5A 5KCHA 4PFZA 4XTYA 1AEYA 1VQ6A 5FU7C 2LP5A 2CP5A 2MYSA 3JB9J 4AFSC 3MCAB 3CCET 1Q95G 5FLXE 2M51A 2M1HA 4JLGA 3OSVA 1DJ7B 2CT3A 2CZ1B 2QYZA 4JRIA 4GY5A 1U5SA 2QDLA 4J9CA 1Y96A 2K5IA 5D6XA 2R58A 4XTVA 2KSSA 3MP8A 2CH4A 3JRZA 4C0GA 4N4HA 4IUQA 1GRIA 2BE9B 2XDBA 2J05A 4QVZA 3JSCA 2ED1A 5GMKi 1VQ8Q 3C4SA 2QA4T 1RAFB 5DLQE 4FM4B 2QEXA 4DEXA 4MDWA 3BDLA 4R56A 4LDWA 1XNIA 3EFRA 2OTJQ 5GAMf 3G6EQ 3G7ZA 2DERA 4AG1C 1U06A 3VUBA 2L0AA 3CQTA 4C5HA 4PK4A 4BD3A 2JJ9A 5J26A 4L6V5 2P4TA 1GCPA 2COWA 4M7DB 3OS5A 1AWXA 4LDXA 1GL5A 2DVEA 2HD0A 2V1RA 4IUTA 1VQ5A 1H3HA 3Q1JA 1WNLA 5GAN2 4Z88A 2EGEA 4XAXB 4EMGA 3OSSC 2KXCA 1NPPA 1VQ7Q 3DKMA 3ULRB 5GAMh 5GAOq 4M77A 3BY7A 1VQKQ 3OYGA 2X35A 3REAB 1M1KU 3RESA 1QVGA 3X25B 1JO8A 2X4JA 1NZ9A 1BI2A 2CZ7B 3CC4T 1AVZC 3URGA 1SRMA 2DETA 2QEXT 1I0CA 2E3IA 5GAMe 2YUNA 2EPDA 3SEMA 2E70A 1M1KC 1NYFA 2YUPA 2RJCA 4E7SA 2LDMA 2E41A 1VQ4Q 4M7DG 1IB8A 1G3SA 3OYKA 1K9MU 5AT1B 2P0PA 4ZN1A 5KH6A 2QQRA 2AKLA 4F7UF 4E7KA 2FYKA 3CCLA 1QKXA 1GBQA 1PM3A 3LWHA 1ZBJA 3BW1A 2RN8A 1K0SA 4MDXA 1K9MC 1M8MA 5GAN7 3EFOA 2LJ0A 1JQQA 3V8JA 4AFZC 3LH0A 2MMPA 2C0TA 5DLOA 4KUIA 5KYXA 2EWNA 4M75B 5GAN8 3O8VA 1YJ9Q 3M58A 2K5FA 4J6XA 2E5KA 1UJYA 1YBYA 3JB9H 2ABLA 3CC7A 2XG8D 4C8QB 5CAIA 2E6NA 5GMKh 1D1BA 4HKEA 2ZAEA 2NUTA 1BI3A 3HHTB 1NM7A 3DB3A 1O9SA 2DO3A 1I5LA 3QPHA 1IXDA 1NJIR 3CCJA 5GMKe 1OQKA 2ZPBB 3BE3A 3OYJA 4PJOB 1W1FA 2CSIA 3NFCA 2OTJT 5KYUA 1LJOA 2KK4A 2WSCE 4ZNXA 2QAZA 5CCAA 1S72A 2P4RA 1HXDA 2DXUA 4KUDK 1E6GA 2I0NA 4PJLA 5M9OA 2Y90A 2OTLQ 4JJNK 3CCLT 2HBWA 1VQOQ 2MI6A 4RG2A 9ATCB 3MKDA 2DL8A 2YT6A 2KXDA 2J6FA 3MEVA 1X75C 4M75G 3VRZA 3M0QA 2F5KA 1ARKA 3INZA 3PMTA 1BIAA 1OULA 2DVJA 2O2OA 3UATA 3P8DA 4C8QG 4DBFA 1RI9A 1V76A 3CC7T 5I22A 2DILA 1SF9A 2KBTA 1QLYA 3G4SQ 2LT4A 4PNOA 4OMQA 1KG1A 2DK3A 1NG2A 1VQKT 4D8KA 2W0ZA 1YWOA 3A8MB 2EIFA 3CCMQ 2KT1A 4PJOG 3M55A 5LJ5f 1M8VA 1LCKA 4FYYB 3TVTA 1IHVA 3VS4A 1PC0A 1RLPC 4EPCA 2JMCA 3M57A 4UC4A 3JCMV 2O9SA 1QWFA 5GANd 2JXBA 3M0SA 5LJ3g 3TU4K 2C06A 1Y7XA 2YXYA 5A0LA 2K4YA 4L59A 5FWCA 2KRMA 3EGXB 3NGPA 1WJRA 2QASA 1Q82U 2RI2A 2XDDA 1YNZA 4B9XA 3GBQA 1M3BA 4J9FA 5A2QE 3OW2A 4M7DF 3VYGA 4QVCA 2YRVA 1OV3A 3EGDA 1Q82C 2GF7A 3U23A 1Q86C 4C92A 1OEBA 1BKBA 1OU8A 2K5LA 3HFOA 4XU0A 3RMSA 1TOVA 4A54A 5IN1A 4N4GA 4HCBA 1VQLA 2KDSA 4JJCA 3NTHA 3EH1A 3SDZA 3C94A 2COYA 1WPYA 2DBKA 5LJ5e 3GP8A 4LXCA 3RMQA 3VS7A 5CKEA 1BCMA 2XICA 4CRIA 2RHYA 1WQWA 4OMNA 5IH2A 4MZPA 2DRKA 1D1CA 3RIRA 2VXEA 1IO6A 4LN2A 2VWFA 2RPNA 1ZQ1A 2KRNA 2H3JA 4M78E 1M1KR 2L2PA 1JEGA 1WI7A 1YWPA 4J6YA 3FRNA 1VQ9Q 5KYWB 3I55A 1IREB 4HT9A 3VS6A 2MIOA 2DXTA 3G71Q 3E9FA 3X24B 1Y0MA 3VS1A 3A8HB 3CEYA 3C12A 2H3EB 1QCNA 5L8RE 4PLLA 2M0OA 4M7AC 2DYBA 3OYBA 2DF6A 4C0FA 1I4K1 2HZYA 3J81E 1E6HA 1VQLT 2K9GA 1K9MR 2PU9B 3OYEA 1YCSB 2DTHA 3M0UA 2Y4YA 3RERA 2HNIA 2CZ0B 1R0BG 4JS4A 4M75F 4M7AE 3CCEQ 1EFNA 5GAOm 1KD1U 1JRIA 3C95A 4C0DC 4AT1B 2MF2A 4C8QF 1IGQA 1G83A 4Y28E 4M78D 3JAME 3J7AF 2FRWA 1MHNA 5GANh 3LWIA 2A37A 1YITA 1KD1C 4DA4A 3PGGA 4QT7A 2E1HA 3J80E 1RAAB 3HTRA 4PJOF 4BY6C 2E12A 3CC2T 4KGVB 4CC3A 5GANe 1WIEA 2KQWA 5CR2A 1GFCA 1YI2A 3TREA 2R57A 2GNCA 3JB9D 3I55T 2E5QA 2DRMA 1M90C 4M77B 4ZN3A 2EJFA 2QA4Q 1I8FA 3HL8A 4OP0A 4J9IA 3SFMA 1K8AU 3QYGB 4LUDA 5IHIA 1MMDA 3MHXA 4M7AD 2L3SA 4HCCA 2DMOA 2ZPFB 3OYYA 3CCQA 1VQ6Q 1K8AC 4E7IA 1M4ZA 2HSPA 3CPFA 2QQBA 3D7SB 1PWTA 4WTOB 2AZSA 2DD4A 1R8OB 1D1AA 4GBQA 2L89A 2KI7A 1FXXA 4AFQC 1RABB 2KE9A 2KR3A 2D6FA 1PRLC 2DBMA 1PKTA 1YITT 3QWXX 2CP7A 1U3OA 2JT4A 2A28A 3EFOB 1B34B 1JXMA 4C5EA 2JVVA 1JJ2A 4GLKA 4O5VA 3MP6A 2KRSA 3X28B 1B07A 4E47A 4F04B 2E65A 3L2UA 1YJNA 4M77G 2DZ9A 2I2LA 1YI2T 2J6OA 4ZGJB 3CD6A 2F2XA 1W2BA 2DL3A 3E1SA 1K1ZA 2LX9A 2B86A 1VQ9T 5I11A 2QEXQ 1N9RA 3I56T 4A4FA 4JRKA 2EAYA 2MWOA 3ME9A
chains in the Genus database with same CATH topology
1YIJT 1M1KU 3RESA 2ZPGB 1QVGA 3X25B 1O75A 2X4JA 1NZ9A 1BI2A 2CZ7B 4J83A 4OGEA 3URGA 3OYFA 3CC4T 4P5NA 1PSFA 3E19A 2JNGA 3CCQT 4RCCA 2QEXT 4NL3A 1EIFA 1VQ7T 5GAMe 3X20B 3PIPA 1VQPA 4X9DA 2JTFA 3OYHA 2GFAA 2E70A 4YTLA 1PSEA 1M1KC 2PUKB 2XDPA 3JCMh 4ELYC 2DAQA 4J5YA 3KXTA 2RJCA 2LDMA 2E41A 3UT1A 3V7SA 3OYIA 4M7DG 4ZTFA 4MZMA 2LC4A 4JDSA 1G3SA 2VGNA 2CGHA 3VKIA 4M7DD 2XKOC 3H8ZA 3DB4A 3OYKA 1ZHIA 1SSFA 2RK1A 5CIUA 4DOWA 1K9MU 1M90U 1JBMA 2EYQA 5CQYA 2P0PA 3WVDB 1V29B 4ZN1A 3JCMe 5KH6A 3CCUT 2QQRA 3FB9A 1WJSA 4F7UF 3CMAA 3OW2S 4E7KA 2FYKA 2VC8A 1VQ4T 3CCLA 3MEUA 3CCST 3LGFA 1N8RC 4M7DA 3KUFA 4BB7A 3LWHA 3BW1A 2YLCA 3V7CA 1FX7A 2EQJA 3BFMA 4MDXA 1K9MC 4FU6A 2QQAA 3SB2A 3OMCA 3UDCA 3CCRT 5CKHA 5GAN7 4M78F 3FJPA 4C0ZA 1MGQA 2K3YA 5KE2A 3L2RA 3L2ZA 3N5BB 2QQ9A 2VXFA 1BI0A 1VIFA 2WACA 3DLLA 2JOYA 4M75C 5FU6C 3V8JA 2RA2A 3UPUA 3ZEHA 3LH0A 2EKOA 4HCZA 4Q5WA 4JLIA 4NL2A 2MMPA 5GAMg 3RKXA 3L2QA 5DLOA 4KUIA 1GXIE 2EWNA 5FU6B 4M75B 5GAN8 3O8VA 2K57A 3BDUA 3M4YA 2X4WA 5LJ3f 1NPRA 4C8QC 3M58A 2K5FA 4J6XA 3CPWA 4L5GA 1QVFS 1YBYA 2RK2A 3JB9H 2EQUA 3CC7A 1YHQA 3PIOA 3KBGA 2XG8D 1UGRB 2CS7A 2E6NA 4C8QB 5CAIA 5GAOr 3CBPA 5GMKh 2LNVA 2L5QA 1LNXA 2CYZB 4HKEA 3RKYA 2V8JA 4QVDA 1BI3A 4M75E 1AHJB 5I2MA 3JCMg 3QIIA 1U1SA 3HHTB 5LJ5h 3JB9F 3DB3A 1VIEA 3QJ6A 1O9SA 1BIBA 1YJ9T 2DO3A 2EJ9A 4BE0A 2XK0A 5GANg 3ER0A 3CMEA 1I5LA 3QPHA 1W4SA 4PJOC 3OS1A 2LCLA 3GNGA 3FLGA 4N0AC 3CCJA 5CQXA 3GIBA 4C8QE 5GMKe 1QVFA 2ZPBB 2LVMA 4HA8A 2JTMA 2JZ2A 2DXCA 4IURA 3VV0A 3OYJA 4PJOB 1VQ6T 3NFCA 3QBYA 4J7IA 2KMTA 2OTJT 5HK3A 3OYMA 4M7AF 1LJOA 2KK4A 2LTOA 2WSCE 2ZPEB 3ASKA 4FT4A 3V7RA 3OS2A 5HY6A 4XTZA 5CCAA 1BYMA 1S72A 2P0KA 1HXDA 2DXUA 4M78C 3CCVA 3CCMA 1K73U 3QZ9B 2ZZDA 4OVAA 1WQ7A 4DOVA 4RMOA 4KUDK 2DEQA 5FRMA 1Q81C 1OI1A 2BIVA 4N4IA 3OMGA 4M78B 2MAMA 3MP1A 5M9OA 4PJOE 3X26B 2Y90A 4BE1A 3EFSA 1NE8A 2FL7A 4JJNK 3OS0A 3HPWA 3CCLT 4LDVA 3JCMc 1VQNA 3EAEA 1YJWA 2MI6A 1UEBA 4ELZC 4RG2A 2KY9A 2O01E 4QW2A 4C92C 1Y96B 2RJFA 1K73C 1UB4A 3QO3A 1HK9A 1N27A 5IAYA 2RO0A 2YLBA 5CKDA 3CC2A 2AHJB 4C92B 1KHCA 4LDYA 3SWNC 3MEVA 2OTLT 1X75C 4M75G 2F5TX 2A3LA 4C5IA 3H6ZA 4Y91A 1VQOT 3SWNB 4M75D 2F5KA 3PMIA 2OAUA 3A5ZB 3INZA 3PMTA 1BIAA 4KULA 4XK8E 1UGSB 3P8DA 5CO7A 1M1GA 3TEEA 4C8QG 4IUPA 2JN0A 4C92E 5GMKl 3GNFB 3T9NA 2XIDA 4A4HA 3ZFJA 5KCOA 3CC7T 1YHQT 2ZPIB 3PFSA 2LT4A 4M75A 4PNOA 1U8RA 3V8KA 1KG1A 3QKJA 5LJ3j 2DK3A 4EMHA 4QQ6A 1VQKT 2K3XA 4M77F 3A8MB 2QTXA 1VUBA 2EIFA 3HSBA 3CMET 4C8QA 2K2VA 2RJDA 2E6ZA 4PJOG 2O4XB 3M55A 5LJ5f 1M8VA 4C5GA 1N8RU 3A8LB 3L1AA 3G4ST 4PJOD 2VGMA 2LRQA 4EPCA 5GAMj 5CVIA 3M57A 3DLMA 4UC4A 5AYFA 2VYTA 2KAFA 3JCMV 2LQKA 5A0GA 5GANd 3JCMW 1KQSS 3CCMT 3CCVT 3GLXA 5GAOl 4E7LA 4OB1B 4X9CA 1I81A 3UWNA 4PJOA 5LJ3g 2RHIA 1VQ5T 3TU4K 4N0AA 2C06A 1Y7XA 5A0LA 1OZ2A 2K4YA 2RD1A 4L59A 3M56A 3LX7A 3QHSA 2XI9A 3M54A 3G6EA 3QDRB 5EG2A 1WJRA 2E64A 4IUVA 4JUVA 1YJWT 1Q82U 5CK9A 2RI2A 4C92G 3PNWC 4B9XA 2XDDA 1YJNT 1B34A 2LQ8A 3FIFA 3HP9A 5GANj 4ATOA 5C6SA 1KQSA 2IG0A 5A2QE 1VQMA 4V2SA 3CD6T 4C92D 4IUUA 2E10A 5DM7R 2F69A 5GAN5 3GOXA 3OW2A 4ZTJA 4M7DF 2RJEA 3VYGA 2DTIA 2RH2A 3QUIA 4OB3B 4QVCA 1UGPB 4PLIA 4OF1A 2YRVA 4A4EA 2B8AA 4J6WA 4LD9K 3OYAA 1Q82C 2XU8A 4PKCC 2GF7A 1Q86C 4VUBA 5J3BA 1BKBA 2K5LA 3HFOA 2BUDA 4XU0A 3RMSA 4BI4A 4C92A 3OYCA 1QP3A 1VQ9A 4A54A 2R5MA 5IN1A 1Y07A 4N4GA 5FROA 2CKKA 4ZGDB 2KDSA 3QZ5B 3JCMQ 3G71A 3I56A 1VQLA 4HCBA 4XU1A 3NTHA 1WJQA 3SDZA 4ME7A 1H641 1YIJA 1QW1A 2DIGA 2LT1A 3CBMA 2PVOB 1VQPT 1Q81U 3C94A 3LW5E 4QQGA 1WPYA 4TVRA 3CC4A 4DQ2A 4F7UB 5LJ5e 5I21A 3GP8A 3OY9A 3RMQA 4QQDA 5DY9A 4BI3A 2PUOB 5CKEA 4XU2A 3M5AA 2XICA 5GAOp 4LD6A 4CRIA 2DPPB 2FB7A 3HFNA 2RHYA 1M5Q1 3HKSA 1BI1A 4XTXA 5LL6S 1LOJA 5J39A 1WQWA 3OBYA 4MZPA 1H3ZA 2QQSA 1RI0A 3RIRA 4F7UE 4LDUA 2VXEA 3CCEA 3P8HA 3CMAT 2A7YA 2RI3A 4X34A 4XQ3A 2G3RA 3R6OA 2IVWA 2KVQG 2X4YA 3FDRA 2D9TA 1ZBXA 3GF5A 4FSXA 3F70A 1ZQ1A 3VUZA 2FHDA 4EMKC 3OYLA 2H3JA 2GQVA 2EQMA 2ZGWA 4M78E 1NJIU 2QXFA 4ZGEB 4OB0B 3CCSA 3M59A 1IZ6A 4J6YA 4MZTA 3FRNA 4EMKB 3GPLA 4IKFA 4KT0E 5LJ3d 5GAN3 2RHUA 3HRUA 1VQMT 5FRNA 3HRSA 3I55A 1X01A 1IREB 3TCJA 4B9WA 4EDUA 4HT9A 5GAN6 4BDZA 3S3NA 2QDYB 5GMKm 5C0MA 2DXTA 3E9FA 3MO8A 4D6WA 3LGLA 3X24B 5LJ5g 3CXCS 1U1TA 4MMKA 2V8IA 4A53A 3A8HB 3CEYA 3NTIA 3PTAA 3C12A 2QI2A 3JCMb 1NJIC 4J7FA 2DIQA 3S3OA 2CZ6B 3OBWA 5L8RE 3SD4A 4PLLA 4C8QD 2M0OA 5HKCA 4JS5A 4M7AC 1XOVA 2Y4XA 4OGCA 3OYBA 3OQ5A 1UGQB 4OB2B 4C0FA 5GAMd 2ZCFB 4BE2A 3L2WA 4JRQA 4RCBA 2WSFE 4R55A 4M7AB 2PQWA 1I4K1 1QVPA 3HRTA 3J81E 1QP2A 3G71T 1VQLT 1KC8U 4NS5A 2PU9B 3OYEA 2DTHA 2QA4A 2Y4YA 3RERA 2VV5A 1G3WA 1P92A 2HNIA 4FL6A 2CZ0B 2HQXA 3CXCA 1M9SA 4F7UG 4RKUE 3S6WA 3S3MA 3MEWA 4FT2A 4OMFB 3CCJT 4BUGA 3ZBDA 2HQEA 4JS4A 4M75F 3AHUA 3VJPA 3PT9A 1YJ9A 4M7AE 3JCMd 1KHIA 4MMLA 5GAOm 2DD5A 2RM4A 5D6WA 4FIBA 2MWPA 5KCHA 1KC8C 1KD1U 1VQ8A 4BACA 1JRIA 4M78G 4A4KA 1S72T 3C95A 1Q7YU 4C0DC 4C8QF 2MF2A 4XTYA 2XHCA 3QJYA 4E7HA 1VQ6A 4Y28E 5FU7C 4M78D 4F7UA 2OTJA 3JAME 3J7AF 1G5VA 4C0DB 4RG8A 1MHNA 5GANh 4E7JA 3LWIA 3JB9J 5FU7B 5A0DA 3JB9I 1YITA 1N9SA 3MCAB 3CCET 5KE3A 1KD1C 4DA4A 3PGGA 3VU3C 5FLXE 2E1HA 1VQNT 1Q7YC 3J80E 1Q86U 4M78A 3VYHB 3OYNA 2M1HA 2FVUA 4JLGA 1N6AA 3OSVA 1DJ7B 2DKGA 4PJOF 4BY6C 5GAOn 2E12A 3CC2T 5GANe 2CZ1B 2KQWA 4PL6A 4JRIA 4GY5A 3V8LA 5CR2A 3JB9G 3M4GA 1D3BB 2ZPHB 2PVGB 4BI8B 4BY6B 4M77C 3FC3A 1M1FA 3CPWS 1Y96A 2K5IA 2R57A 5D6XA 3TREA 1YI2A 3QXEB 2R58A 1WGSA 1XQHA 3I55T 2E5QA 3JB9D 1KQ2A 1M90C 4M77B 4ZN3A 2EJFA 4XTVA 2RI5A 2KSSA 3MP8A 4Z02A 3WVEB 5HK0A 2OTLA 2GCXA 4EMKA 1I8FA 3FEOA 3HL8A 3JRZA 2D0QB 4OP0A 4M7AG 2JUFA 3SFMA 1VQOA 1K8AU 3SWNA 3QYGB 3QYHB 4IUQA 4N4HA 4C0GA 5CKBA 3CBOA 2XDBA 4CI0C 3MHXA 3RUXA 4M7AD 1XTDA 1OYXA 4A4GA 2NLUA 3META 4HCCA 4QVZA 4O6JA 2X4XA 4BDYA 3JSCA 4M77E 5LJ5d 4KBMB 5GMKi 4C92F 3OYGA 5IT9E 3C4SA 2ZPFB 2L8DA 3OYYA 2PVDB 3M9QA 2QA4T 2M16A 4FM4B 4WF2A 5DLQE 3CCQA 2QEXA 4HT8A 4XU3A 4MDWA 1VQ7A 3BDLA 4R56A 1K8AC 2R5AA 4LDWA 1Y71A 4E7IA 1XNIA 4M7AA 3EFRA 1M4ZA 1VQKA 2HAXA 1G3TA 4XTUA 3CPFA 5GAMf 2DXBA 2QQBA 2HBPA 5GMKj 3OA6A 3G7ZA 1TH7A 2EFIA 3QSUA 3VUBA 1VQ8T 2O4XA 2DD4A 1R8OB 2DTOA 5D6YA 2GFUA 4M7DC 1JJ2S 5LJ5j 2L89A 4C5HA 4J8OA 5GAN4 3G4SA 4BD3A 1RL2A 1FXXA 5J26A 4L6V5 2P4TA 1YCYA 1JB0E 4M7DB 3OS5A 4JRPA 2D6FA 3LLRA 3WXMB 2BKDN 3E9GA 4LDXA 3NTKA 3JCMX 3CCUA 3L2VA 1YITT 1W2BS 3G6ET 2XD0A 2EQKA 2DVEA 2HD0A 3RKWA 3JCMf 1VQ4A 4IUTA 1VQ5A 2RHZA 1X6OA 4XTWA 5GANf 1B34B 5CKFA 4C5EA 2JVVA 4II1A 5I2SA 3Q1JA 3MEAA 1WNLA 2DJZA 2YHTA 3LYIA 1JJ2A 4GLKA 5GAN2 4M7DE 3OB9A 3P8BB 3CCRA 4O5VA 3MP6A 3X28B 1KQ1A 2VUBA 2M9UA 2E65A 4E47A 3L2UA 1YJNA 4M77G 2DZ9A 2I2LA 2DZCA 1OZ3A 5LJ3h 1YI2T 4XAXB 1QVGS 4ZGJB 3JCMJ 2RHXA 3A8GB 3CD6A 4NOYA 1W2BA 4M77D 2RB6A 4EMGA 3OSSC 3E1SA 2LX9A 1VQ9T 2L3RA 2P0QA 1NPPA 3OYDA 1D3BA 2WSEE 3JCMP 2V8KA 1FWZA 1N9RA 3M53A 3I56T 3L42A 2EJGA 4A4FA 3A8OB 3QG1A 5LJ3e 3DKMA 4JRKA 2EAYA 2MWOA 5GAMh 4M77A 3BY7A 5GAOq 3ME9A 1G3YA 2LCCA 2X35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y90 A;  3EFS A;  3RES A;  4M78 A;  3JCM c;  1H64 1;  4PJO F;  2DKG A;  5GAO n;  4C92 C;  1Y96 B;  4RCC A;  5GAN e;  3QO3 A;  1WPY A;  1HK9 A;  4NL3 A;  4JRI A;  3V8L A;  4DQ2 A;  3JB9 G;  3M4G A;  1D3B B;  5GAM e;  4F7U B;  2YLB A;  5I21 A;  5LJ5 e;  4M77 C;  4C92 B;  4X9D A;  1Y96 A;  5DY9 A;  3SWN C;  3JB9 D;  3JCM h;  4J5Y A;  4M75 G;  1KQ2 A;  4M77 B;  2E41 A;  3V7S A;  2EJF A;  4XTV A;  4XU2 A;  5GAO p;  4M7D G;  4Y91 A;  2FB7 A;  3HFN A;  3SWN B;  1M5Q 1;  4M75 D;  4XTX A;  4EMK A;  1I8F A;  1LOJ A;  1WQW A;  3INZ A;  2CGH A;  1BIA A;  4OP0 A;  4M7D D;  4M7A G;  4C8Q G;  3RIR A;  4F7U E;  3SWN A;  2JN0 A;  2VXE A;  4C92 E;  5GMK l;  1JBM A;  3RUX A;  4M7A D;  3JCM e;  4XQ3 A;  3FB9 A;  4M77 E;  4F7U F;  5LJ5 d;  2FYK A;  2VC8 A;  4M75 A;  4PNO A;  4C92 F;  5GMK i;  3V8K A;  4EMK C;  5LJ3 j;  4M7D A;  4M78 E;  2ZGW A;  4WF2 A;  4EMH A;  3BW1 A;  4HT8 A;  2YLC A;  4M77 F;  3V7C A;  4XU3 A;  2QTX A;  3BFM A;  4J6Y A;  4EMK B;  4C8Q A;  3EFR A;  3SB2 A;  3HSB A;  5LJ3 d;  4M7A A;  4PJO G;  5GAN 7;  5GAN 3;  4M78 F;  3FJP A;  1MGQ A;  4XTU A;  5GAM f;  5LJ5 f;  3L2Z A;  1X01 A;  2VXF A;  5GMK j;  4HT9 A;  1M8V A;  5GAN 6;  1TH7 A;  4M75 C;  3L1A A;  2RA2 A;  3V8J A;  5GMK m;  2DXT A;  3QSU A;  4PJO D;  2DTO A;  4JLI A;  4NL2 A;  5GAM g;  5LJ5 g;  3RKX A;  1U1T A;  4MMK A;  5LJ5 j;  5GAM j;  4A53 A;  4M7D C;  3JCM b;  2EWN A;  5GAN 4;  4M75 B;  5GAN 8;  3JCM V;  2K57 A;  5GAN d;  3JCM W;  3BDU A;  4C8Q D;  5LJ3 f;  1YCY A;  4M7A C;  4C8Q C;  4M7D B;  4J6X A;  5GAO l;  5GAM d;  4PJO E;  4X9C A;  3JB9 H;  1I81 A;  4PJO A;  5LJ3 g;  3JCM X;  4RCB A;  3VU3 C;  4N0A A;  4M7A B;  1I4K 1;  4C8Q B;  5CAI A;  5GAO r;  2DVE A;  5GMK h;  3RKW A;  2RD1 A;  3JCM f;  1LNX A;  3QHS A;  3RKY A;  4XTW A;  2DTH A;  5GAN f;  1B34 B;  4QVD A;  3RER A;  5LJ5 h;  2HNI A;  4M75 E;  3JB9 F;  3JCM g;  1U1S A;  1WNL A;  2DJZ A;  2YHT A;  2E64 A;  4JUV A;  4F7U G;  1BIB A;  5GAN 2;  4M7D E;  2EJ9 A;  4C92 G;  5GAN g;  1B34 A;  5GAN j;  3FIF A;  1I5L A;  4PJO C;  3AHU A;  4M75 F;  1KQ1 A;  4N0A C;  4V2S A;  2E65 A;  3GIB A;  4C92 D;  4C8Q E;  4M77 G;  2DZ9 A;  2E10 A;  5GMK e;  2I2L A;  3JCM d;  2DZC A;  5LJ3 h;  4HA8 A;  4MML A;  2RM4 A;  5GAN 5;  5GAO m;  4M7D F;  2DTI A;  3JCM J;  3QUI A;  4PJO B;  1JRI A;  4M78 G;  4NOY A;  4M77 D;  2RB6 A;  4QVC A;  4EMG A;  4M7A F;  1LJO A;  4J6W A;  4XTY A;  4C8Q F;  3V7R A;  4XTZ A;  4M78 D;  1HXD A;  1D3B A;  2DXU A;  4M78 C;  4F7U A;  3JCM P;  4C92 A;  3HFO A;  1N9R A;  1WQ7 A;  4XU0 A;  5GAN h;  2EJG A;  3JB9 J;  4M7A E;  2DEQ A;  4A54 A;  3JB9 I;  5LJ3 e;  1N9S A;  4JRK A;  4M78 B;  2EAY A;  5GAM h;  5GAO q;  4M77 A;  3BY7 A;  3PGG A;  3JCM Q;  2E1H A;  4XU1 A; 
#chains in the Genus database with same CATH topology
 4DBH A;  1PRM C;  3OYF A;  1PSF A;  3E19 A;  5KYU B;  3CCQ T;  1UG1 A;  5L23 A;  3PIP A;  3O5Z A;  1Q82 R;  2JTF A;  2GFA A;  2PNI A;  2XDP A;  1UTI A;  1AZE A;  4J9D A;  4A63 B;  4JDS A;  2CGH A;  2COZ A;  5CIU A;  2ROT A;  4DOW A;  2EYQ A;  1MMG A;  3WVD B;  3FB9 A;  3CMA A;  3OW2 S;  2VC8 A;  1Z9Q A;  1N8R C;  1VYU A;  3BFM A;  2MPX C;  5CKH A;  3FJP A;  4C0Z A;  4OML A;  5KE2 A;  3L2Z A;  2J06 A;  3N5B B;  2JOY A;  1Y57 A;  3L2Q A;  1M3A A;  2EKH A;  4JLI A;  5GAM g;  3RKX A;  5KYW A;  1QVF P;  3EHR A;  4DEY A;  2DL5 A;  5FU6 B;  2X4W A;  1HJD A;  1QVF S;  2EQU A;  2LJ1 A;  1YHQ A;  1OX9 A;  1UGR B;  2CS7 A;  1X27 A;  4PFP A;  2CP3 A;  3RKY A;  1HYO A;  4JJD A;  1AHJ B;  5I2M A;  1WHL A;  2XK0 A;  3CME A;  3GNG A;  5CQX A;  3GIB A;  4HA8 A;  1SSH A;  2JTM A;  4IUR A;  1VQ6 T;  5HK3 A;  3OYM A;  2EVR A;  3ASK A;  3CCL Q;  2JTE A;  3AT1 B;  3V7R A;  2A36 A;  1K73 U;  3QZ9 B;  4OVA A;  4M4Z A;  2RQU A;  3EG9 B;  4Y92 A;  1UFF A;  1Q81 C;  1ZLM A;  4M78 B;  2MAM A;  3MP1 A;  2K79 A;  1ZUK A;  4CC7 A;  4BE1 A;  2FL7 A;  4LDV A;  1VQN A;  3EAE A;  1YJW A;  4ELZ C;  1UEB A;  1K73 C;  2KY9 A;  4QW2 A;  2LJ3 A;  2JM9 A;  3EGD B;  3TQ7 P;  3QO3 A;  1N27 A;  5IAY A;  2RO0 A;  2YLB A;  1K9A A;  4C92 B;  3CC7 Q;  2RMO A;  2X51 A;  1AWW A;  2AIR B;  1GBR A;  3SWN B;  3PMI A;  2OAU A;  4KUL A;  1MV3 A;  4XK8 E;  1PKS A;  1UGS B;  5CO7 A;  1M1G A;  2QTV A;  3TEE A;  4IUP A;  5GMK l;  2BZ8 A;  1TWB A;  4A4H A;  3ZFJ A;  1YHQ T;  1WHM A;  1H92 A;  2DL7 A;  1AWJ A;  1ZUU A;  1U8R A;  1WX6 A;  1UDL A;  4M77 F;  2DX1 A;  2QTX A;  1UGV A;  3CME T;  2K2V A;  2RJD A;  2E6Z A;  1YP5 A;  2FZK B;  3THK A;  5GAM j;  5CVI A;  1KK7 A;  3DLM A;  2LQK A;  1YN8 A;  5KYN A;  1I81 A;  3PVQ A;  3UWN A;  1VQ5 T;  1QWE A;  1K8A R;  2DE0 X;  2XI9 A;  3G6E A;  5IXB A;  1ZSG A;  2E64 A;  1YJW T;  4KH0 B;  4C92 G;  1LVK A;  1B34 A;  3MJX A;  3FIF A;  4ATO A;  5C6S A;  1KQS A;  2IG0 A;  2E10 A;  4OB3 B;  2EW3 A;  4A4E A;  2B8A A;  1ZSZ C;  2F1L A;  1KFZ A;  4PKC C;  1K0X A;  1QQJ A;  3M0P A;  4VUB A;  2ESW A;  3OYC A;  1QP3 A;  1ZX6 A;  2R5M A;  5FRO A;  2YRD A;  3QZ5 B;  1KSW A;  4ANJ A;  2KEA A;  1WJQ A;  4WCI A;  1TXQ A;  1YIJ A;  6AT1 B;  3CBM A;  2PVO B;  4OMM A;  2YRC A;  2LNH B;  5I21 A;  2FRY A;  1TG0 A;  3VS2 A;  3M5A A;  1F1B B;  1T0H A;  2W10 A;  5LL6 S;  1M5Q 1;  4XTX A;  1LOJ A;  3OBY A;  4IIO A;  4F7U E;  4LDU A;  3P8H A;  2EGA A;  4XQ3 A;  2OI3 A;  2G3R A;  2IVW A;  1T3S A;  2KVQ G;  2X4Y A;  3GF5 A;  4FSX A;  3NPF A;  4EMK C;  3OYL A;  2GQV A;  2EYX A;  2PZ1 A;  3CCS A;  2RQV A;  4IKF A;  5LJ3 d;  2RHU A;  3HRU A;  3CXC P;  4FCY A;  5IHK A;  5FRN A;  3TCJ A;  4BDZ A;  1VQL Q;  4QKU A;  4D6W A;  1E7O A;  3LGL A;  5LJ5 g;  3CXC S;  5IHN A;  2QI2 A;  2DIQ A;  4Z8A A;  3S3O A;  3OBW A;  3SD4 A;  5HKC A;  1XOV A;  3OQ5 A;  1UGQ B;  2D0N A;  4BE2 A;  4RCB A;  2WSF E;  2PQW A;  1G3W A;  4RKU E;  3S6W A;  3CCJ T;  4FT2 A;  4OMF B;  4LE9 A;  4BUG A;  2HQE A;  3AHU A;  4RUG A;  3VJP A;  2M0Y A;  3EH2 A;  3JCM d;  4LUE A;  1YJ9 A;  1WZO A;  1X2K A;  4MML A;  1OX8 A;  4FIB A;  1ACM B;  1S72 T;  3RR6 A;  4A4K A;  2QGF B;  2XHC A;  3QWY A;  2GTJ A;  1X6B A;  3CC2 Q;  4RG8 A;  1X6G A;  1GCQ C;  5FU7 B;  2AT1 B;  1N9S A;  4F14 A;  3PE0 A;  1TSF A;  3EG9 A;  2DA9 A;  3I55 Q;  1Q86 U;  4M78 A;  3OYN A;  1K4U S;  5GAO n;  4PL6 A;  3V8L A;  2ZPH B;  2PVG B;  4BI8 B;  3FC3 A;  1M1F A;  2EYW A;  2VB6 A;  1WGS A;  1XQH A;  2RI5 A;  1FMV A;  4Z02 A;  1GFD A;  2OTL A;  3M0T A;  2D0Q B;  2MCN A;  2O31 A;  1SEM A;  1VQO A;  1UEC A;  3SWN A;  3QYH B;  2NUP A;  5CKB A;  3CBO A;  5EC7 A;  3RUX A;  1K73 R;  1XTD A;  1OYX A;  4A4G A;  2NLU A;  2X4X A;  4BDY A;  2YSQ A;  4C92 F;  2L8D A;  2M16 A;  4WF2 A;  4HT8 A;  2LQN A;  2R5A A;  1Y71 A;  4M7A A;  2GTO A;  1G3T A;  1PG5 B;  2DXB A;  2HBP A;  1YIT Q;  1TH7 A;  2EFI A;  1VA7 A;  3NHN A;  3QSU A;  1MMA A;  2DTO A;  2SRC A;  4M7D C;  1KIK A;  5LJ5 j;  4J8O A;  4D8D A;  5GAN 4;  3G4S A;  1VYT A;  4F16 A;  4ESR A;  1C0M A;  3UA6 A;  3TSZ A;  3WXM B;  2JM8 A;  3E9G A;  3NTK A;  3CCU A;  3L2V A;  3EG2 A;  2CSQ A;  1YI2 Q;  3RKW A;  3JCM f;  3I9Q A;  4E2F B;  1X6O A;  5GAN f;  2PTK A;  4II1 A;  3MEA A;  2YHT A;  3LYI A;  2LCS A;  1OPL A;  2KRO A;  4M7D E;  1CKB A;  2HCK A;  1WXB A;  1QVG P;  3CCR A;  4DBQ A;  3I56 Q;  2VUB A;  4FSS A;  2DZC A;  1OZ3 A;  5LJ3 h;  1QVG S;  3JCM J;  2RB6 A;  2FPE A;  2YWW A;  2L3R A;  2P0Q A;  3OYD A;  1D3B A;  3JCM P;  2V8K A;  3CCQ Q;  3M53 A;  3L42 A;  2EJG A;  2LZ6 B;  3QG1 A;  5LJ3 e;  1WHJ A;  1G3Y A;  2DEU A;  2ZPG B;  3A1P A;  1O75 A;  2JMA A;  4J9E A;  4P5N A;  2VVK A;  4RCC A;  4NL3 A;  1EIF A;  2HKN A;  1VQP A;  5IXF A;  1MNE A;  3RNJ A;  1PSE A;  2FPD A;  4RTT A;  3JCM h;  4J5Y A;  1HD3 A;  4ELY C;  3KXT A;  3UT1 A;  1CKA A;  3V7S A;  3OYI A;  1M30 A;  2A0F B;  2DM1 A;  4ZTF A;  1W6X A;  3REB B;  3VKI A;  2GQI A;  4M7D D;  3LH5 A;  4AFU C;  3DB4 A;  1ZA2 B;  1ZHI A;  5GJW B;  1M90 U;  1JBM A;  3JCM e;  1V29 B;  1BU1 A;  3CCU T;  1WJS A;  1NBE B;  2KT8 A;  4RTU A;  3CD6 Q;  2EQJ A;  3SB2 A;  3CCR T;  2K3Y A;  3L2R A;  3H0I A;  4M75 C;  2RA2 A;  3ZEH A;  2EKO A;  4Q5W A;  5KYY A;  2DYI A;  1AWO A;  3BDU A;  3M4Y A;  4C8Q C;  3CPW A;  4L5G A;  2CH4 W;  2RK2 A;  2VAS A;  1WXU A;  3PIO A;  3KBG A;  3CBP A;  1ZSZ B;  2L5Q A;  1LNX A;  2CYZ B;  1FMK A;  4M75 E;  1VIE A;  2EJ9 A;  3ER0 A;  2D1X A;  1W4S A;  4PJO C;  3OS1 A;  3FLG A;  4N0A C;  4C8Q E;  2LVM A;  2JZ2 A;  2DXC A;  3VV0 A;  4J7I A;  2ZPE B;  3OS2 A;  1WA7 A;  3CCV A;  2ZZD A;  4DOV A;  4RMO A;  5FRM A;  4KRT A;  4N4I A;  2BIV A;  3OMG A;  4PJO E;  2RQR A;  1NE8 A;  3JCM c;  2O01 E;  1UB4 A;  1HK9 A;  4FYX B;  7AT1 B;  2RNA A;  5CKD A;  2AHJ B;  1KHC A;  1ZA1 B;  4LDY A;  1YHQ Q;  4JZ4 A;  3QDF A;  2A3L A;  4C5I A;  1NLO C;  3H6Z A;  2EYY A;  4M75 D;  4KGZ B;  1M2O A;  1RAG B;  2V26 A;  3EG3 A;  3CME Q;  1D0Z A;  3GNF B;  2XID A;  5KCO A;  3UF4 A;  1YFN A;  4JPB W;  3VS0 A;  3QKJ A;  2DL4 A;  4EMH A;  2K3X A;  1Q86 R;  8AT1 B;  4CC2 A;  1VUB A;  4AMC A;  2CDT A;  2O4X B;  2DFU A;  2NUZ A;  1VQ5 Q;  2IIM A;  4C5G A;  1N8R U;  3L1A A;  4PJO D;  1X2Q A;  3OW2 P;  1AT1 B;  2VYT A;  2X9H A;  5A0G A;  3JCM W;  1VQN Q;  2HL5 C;  1YJW Q;  3CCV T;  1VYV A;  3GLX A;  4OB1 B;  4FYW B;  1AD5 A;  4EIK A;  2EBP A;  1UE9 A;  3LX7 A;  2X3X D;  3QHS A;  4HVU A;  1NEB A;  2VKN A;  2FPF A;  1G8X A;  2F2W A;  5EG2 A;  1J3T A;  2V1Q A;  4IUV A;  4JUV A;  1D0Y A;  5CK9 A;  1YJN T;  2LQ8 A;  1SPK A;  3HP9 A;  1D09 B;  2HL3 A;  1VQM A;  3CD6 T;  4IUU A;  2EYZ A;  2F69 A;  1I5O B;  3GOX A;  2DTI A;  3QUI A;  1XJW B;  1UGP B;  2KNB B;  4LD9 K;  3OYA A;  4AG2 C;  2XU8 A;  4HVW A;  5J3B A;  2BUD A;  4BI4 A;  2ROL A;  3H41 A;  1Y07 A;  2BZX A;  3JCM Q;  4XU1 A;  1BBZ A;  2HSE B;  1LPL A;  4B6M A;  1SG5 A;  2LT1 A;  1Q81 U;  2AKK A;  1I1J A;  2J7I A;  1B3Q A;  2ECZ A;  4TVR A;  3CC4 A;  1SHG A;  2XMF A;  8ATC B;  3OY9 A;  3H0F A;  2OX7 A;  1HSQ A;  3EHQ A;  4XU2 A;  5GAO p;  2DPP B;  3HKS A;  2IPO B;  2K7A A;  4RTY A;  1CSK A;  2RF0 A;  5HCK A;  1K76 A;  3CMA T;  1RLQ C;  2RI3 A;  4X34 A;  3SHW A;  3FDR A;  2D9T A;  2OAW A;  3F70 A;  2FHD A;  3ZL7 C;  2QXF A;  1D0X A;  2CP2 A;  4OB0 B;  1IZ6 A;  4HCK A;  1TTH B;  1VQM T;  1KD1 R;  1X01 A;  4B9W A;  4EDU A;  5GAN 6;  2NUP B;  2QDY B;  5GMK m;  5C0M A;  3MO8 A;  2HKQ B;  4MMK A;  2V8I A;  4A53 A;  3NTI A;  4J7F A;  2FZG B;  4JS5 A;  1YIJ Q;  3CCJ Q;  1QMC A;  2Y4X A;  4OB2 B;  4R55 A;  4M7A B;  3HRT A;  1QP2 A;  1C1A A;  1KC8 U;  1TUG B;  1M90 R;  4NS5 A;  2CP6 A;  1C6V X;  2RQW A;  1S72 Q;  2E4H A;  2VV5 A;  1IRX A;  1P92 A;  3S3M A;  1M9S A;  1S1N A;  1ZSZ A;  1BB9 A;  2RM4 A;  1KC8 C;  5D6W A;  1VQ8 A;  2MWP A;  2QG9 B;  4BAC A;  3C0C A;  4M78 G;  1Q7Y U;  2GBQ A;  3QJY A;  4E7H A;  2HMA A;  2YDL A;  4F7U A;  2OTJ A;  1M2V B;  1G5V A;  4C0D B;  1WFW A;  4E7J A;  3CCS Q;  5A0D A;  3JB9 I;  5KE3 A;  3I5S A;  3VU3 C;  1VQN T;  5ECA A;  1Q7Y C;  2K2M A;  3VYH B;  4R0K A;  2FVU A;  1N6A A;  2DKG A;  3CPW P;  1PCX A;  1NYG A;  4JZ3 A;  3JB9 G;  1B7T A;  3M4G A;  1D3B B;  4BY6 B;  2H8H A;  4M77 C;  3CPW S;  3EGU A;  3M0R A;  3QXE B;  1KQ2 A;  1JU5 C;  2LQW A;  2OJ2 A;  2P84 A;  3WVE B;  5HK0 A;  4KGX B;  2GCX A;  4EMK A;  4M7A G;  2JUF A;  2YUO A;  1M3C A;  4CI0 C;  3MET A;  4O6J A;  2ENM A;  1WLP B;  4M77 E;  5LJ5 d;  4KBM B;  5IT9 E;  4PJM A;  2PVD B;  3M9Q A;  4E6R A;  4XU3 A;  1VQ7 A;  2CP0 A;  1I07 A;  1VQK A;  1SKU B;  2HAX A;  3E2U A;  4CC4 B;  4XTU A;  1JJ2 P;  1FMW A;  2G6F X;  1NLP C;  5GMK j;  3OA6 A;  1A0N B;  3VS3 A;  1MUZ A;  1VQ8 T;  2O4X A;  5D6Y A;  2GFU A;  1UHF A;  1JJ2 S;  2O88 A;  1RUW A;  1RL2 A;  1WXT A;  1W2B P;  1YCY A;  1JB0 E;  2ED0 A;  2MK5 A;  4JRP A;  2ATC B;  3LLR A;  2BKD N;  1ZUY A;  3JCM X;  1W2B S;  3G6E T;  4E7Z A;  2XD0 A;  2K3B A;  2EQK A;  1PHT A;  4FYV B;  1VQ4 A;  2RHZ A;  4XTW A;  2KYM A;  5CKF A;  5I2S A;  1MV0 B;  2DJZ A;  1SHF A;  5KYY B;  2D8J A;  3OB9 A;  2GGR A;  3P8B B;  1TUC A;  1KQ1 A;  1RAD B;  2M9U A;  1GCQ A;  1OU9 A;  1FYN A;  1UJ0 A;  2RHX A;  3A8G B;  3NMZ C;  4NOY A;  4M77 D;  1QCO A;  2CUD A;  1N8R R;  1IHW A;  2EGC A;  2WSE E;  1FWZ A;  1TS9 A;  1MND A;  3A8O B;  4J9B A;  1T0J A;  3FEO A;  2LCC A;  1YIJ T;  2K6D A;  4JJB A;  1MMN A;  4J83 A;  4Z89 A;  4OGE A;  2JNG A;  2RQT A;  1VQ7 T;  3X20 B;  3EG0 A;  3PVL A;  4X9D A;  3OYH A;  3KFV A;  4YTL A;  4X1V A;  2PUK B;  3CCU Q;  2DAQ A;  1RAE B;  4HVV A;  1VOM A;  4MZM A;  2BTT A;  2LC4 A;  1OOT A;  2HQH A;  2VGN A;  2XKO C;  3H8Z A;  1H8K A;  2RK1 A;  1SSF A;  3CCR Q;  5CQY A;  4ORZ A;  2KGT A;  2FZC B;  1VQ4 T;  3MEU A;  3CCS T;  3LGF A;  2CUB A;  2JW4 A;  3KUF A;  1X69 A;  4K11 A;  5FWB A;  1PD0 A;  3I35 A;  4BB7 A;  4M7D A;  2YLC A;  3V7C A;  1WHG A;  3A98 A;  1FX7 A;  1M27 C;  4FU6 A;  2QQA A;  3UDC A;  3OMC A;  1V1C A;  4M78 F;  1Q81 R;  1MGQ A;  2QQ9 A;  2VXF A;  1BI0 A;  1VIF A;  2WAC A;  3DLL A;  5FU6 C;  2AK5 A;  3UPU A;  4HCZ A;  4NL2 A;  1PNJ A;  2CRE A;  2HDA A;  1GXI E;  4KH1 B;  2K57 A;  5LJ3 f;  1NPR A;  3JV3 A;  1X43 A;  1VQP Q;  5GAO r;  2LNV A;  2V8J A;  2X3W D;  4QVD A;  5LJ5 h;  3JB9 F;  3JCM g;  3QII A;  1U1S A;  3QJ6 A;  1BIB A;  1YJ9 T;  4BE0 A;  1IGU A;  5GAN g;  4RTZ A;  2C0O A;  2LCL A;  2EQI A;  4OMO A;  3RDV A;  1QVF A;  4RTX A;  3QBY A;  2KMT A;  4M7A F;  2LTO A;  4FT4 A;  2E3H A;  5HY6 A;  4XTZ A;  1BYM A;  2P0K A;  3CCM A;  4M78 C;  4PJJ A;  1OPK A;  1EX4 A;  1WQ7 A;  2DEQ A;  1OI1 A;  1N5Z A;  1M2V A;  3X26 B;  1WHK A;  3R6N A;  4HXJ A;  3EFS A;  1ABQ A;  4J9H A;  3OS0 A;  3HPW A;  4RTW A;  5GJV B;  1KC8 R;  1BCO A;  4C92 C;  1W70 A;  1Y96 B;  2RJF A;  2JS0 A;  3H0H A;  1TU0 B;  3CC2 A;  2M02 A;  3SWN C;  2OTL T;  2F5T X;  3MPU B;  4Y91 A;  1VQO T;  5FW9 A;  3A5Z B;  1Q7Y R;  2DJQ A;  1QCF A;  2JN0 A;  2Z0W A;  4C92 E;  3T9N A;  1R77 A;  2ZPI B;  3PFS A;  3UA7 A;  2BE7 D;  4M75 A;  3V8K A;  4FW2 A;  4DBR A;  5LJ3 j;  2DNU A;  1AOJ A;  1NEG A;  3IQL A;  4QQ6 A;  1QKW A;  3HSB A;  3CCV Q;  4C8Q A;  2J6K A;  2LMJ A;  2NYS A;  1RAH B;  4LNP A;  2DLP A;  1WDX A;  3A8L B;  1G2B A;  3G4S T;  1KQS P;  4IIM A;  2VGM A;  2LRQ A;  1BK2 A;  5AYF A;  2KAF A;  1KQS S;  3CCM T;  1YJN Q;  5GAO l;  4E7L A;  4X9C A;  4F17 A;  4PJO A;  2RHI A;  4N0A A;  4PJN A;  1OZ2 A;  2RD1 A;  3M56 A;  3I5R A;  2MOX A;  3M54 A;  3QDR B;  2AZV A;  3PNW C;  4J9G A;  5GAN j;  1AZG B;  3EG1 A;  4V2S A;  4C92 D;  5GAN 5;  5DM7 R;  4GLM A;  4ZTJ A;  2RJE A;  2RH2 A;  3VRY A;  1UUE A;  4PLI A;  4RTV A;  4OF1 A;  4J6W A;  3TSW A;  2FG0 A;  2HEQ A;  1VQ9 A;  1EZZ B;  1WYX A;  2CKK A;  2O9V A;  4ZGD B;  3G71 A;  2F2V A;  3I56 A;  2KYB A;  1WHH A;  4ME7 A;  1H64 1;  1QW1 A;  2DIG A;  1VQP T;  3LW5 E;  4QQG A;  1T3L A;  4DQ2 A;  2LX7 A;  3G1J A;  4F7U B;  3CMA Q;  4QQD A;  5DY9 A;  4BI3 A;  2PUO B;  1RAC B;  4LD6 A;  2SEM A;  2FB7 A;  3RBB B;  3HFN A;  1Z9Z A;  1BI1 A;  5J39 A;  1UHC A;  4PFO A;  1H3Z A;  2QQS A;  1RAI B;  1JXO A;  1RI0 A;  2A08 A;  3FJ5 A;  3CCE A;  2QK0 A;  1SRL A;  2A7Y A;  2D8H A;  1VQM Q;  3R6O A;  1ZBX A;  3VUZ A;  1R0C B;  2EQM A;  2ZGW A;  1NJI U;  5D7U A;  4ZGE B;  2L3P A;  3M59 A;  4MZT A;  4EMK B;  3GPL A;  2L3Q A;  4KT0 E;  5GAN 3;  4OMP A;  4FW1 A;  3HRS A;  5KYX B;  3S3N A;  2BZY A;  3EGX A;  2QGG A;  1U1T A;  3H9N A;  3PTA A;  1NJI C;  3JCM b;  2JS2 A;  3VS5 A;  2CZ6 B;  4C8Q D;  2CT4 A;  4OGC A;  2NWM A;  5GAM d;  2ZCF B;  2YUQ A;  3L2W A;  4JRQ A;  3CC4 Q;  2NUT B;  1QVP A;  3G71 T;  1ABO A;  2QA4 A;  4FL6 A;  2HQX A;  3CXC A;  4F7U G;  1TUD A;  1PD1 A;  3MEW A;  3ZBD A;  2FEI A;  2C0I A;  2FO0 A;  3PT9 A;  1KHI A;  1KJW A;  2DD5 A;  5KCH A;  4PFZ A;  4XTY A;  1AEY A;  1VQ6 A;  5FU7 C;  2LP5 A;  2CP5 A;  2MYS A;  3JB9 J;  4AFS C;  3MCA B;  3CCE T;  1Q95 G;  5FLX E;  2M51 A;  2M1H A;  4JLG A;  3OSV A;  1DJ7 B;  2CT3 A;  2CZ1 B;  2QYZ A;  4JRI A;  4GY5 A;  1U5S A;  2QDL A;  4J9C A;  1Y96 A;  2K5I A;  5D6X A;  2R58 A;  4XTV A;  2KSS A;  3MP8 A;  2CH4 A;  3JRZ A;  4C0G A;  4N4H A;  4IUQ A;  1GRI A;  2BE9 B;  2XDB A;  2J05 A;  4QVZ A;  3JSC A;  2ED1 A;  5GMK i;  1VQ8 Q;  3C4S A;  2QA4 T;  1RAF B;  5DLQ E;  4FM4 B;  2QEX A;  4DEX A;  4MDW A;  3BDL A;  4R56 A;  4LDW A;  1XNI A;  3EFR A;  2OTJ Q;  5GAM f;  3G6E Q;  3G7Z A;  2DER A;  4AG1 C;  1U06 A;  3VUB A;  2L0A A;  3CQT A;  4C5H A;  4PK4 A;  4BD3 A;  2JJ9 A;  5J26 A;  4L6V 5;  2P4T A;  1GCP A;  2COW A;  4M7D B;  3OS5 A;  1AWX A;  4LDX A;  1GL5 A;  2DVE A;  2HD0 A;  2V1R A;  4IUT A;  1VQ5 A;  1H3H A;  3Q1J A;  1WNL A;  5GAN 2;  4Z88 A;  2EGE A;  4XAX B;  4EMG A;  3OSS C;  2KXC A;  1NPP A;  1VQ7 Q;  3DKM A;  3ULR B;  5GAM h;  5GAO q;  4M77 A;  3BY7 A;  1VQK Q;  3OYG A;  2X35 A;  3REA B;  1M1K U;  3RES A;  1QVG A;  3X25 B;  1JO8 A;  2X4J A;  1NZ9 A;  1BI2 A;  2CZ7 B;  3CC4 T;  1AVZ C;  3URG A;  1SRM A;  2DET A;  2QEX T;  1I0C A;  2E3I A;  5GAM e;  2YUN A;  2EPD A;  3SEM A;  2E70 A;  1M1K C;  1NYF A;  2YUP A;  2RJC A;  4E7S A;  2LDM A;  2E41 A;  1VQ4 Q;  4M7D G;  1IB8 A;  1G3S A;  3OYK A;  1K9M U;  5AT1 B;  2P0P A;  4ZN1 A;  5KH6 A;  2QQR A;  2AKL A;  4F7U F;  4E7K A;  2FYK A;  3CCL A;  1QKX A;  1GBQ A;  1PM3 A;  3LWH A;  1ZBJ A;  3BW1 A;  2RN8 A;  1K0S A;  4MDX A;  1K9M C;  1M8M A;  5GAN 7;  3EFO A;  2LJ0 A;  1JQQ A;  3V8J A;  4AFZ C;  3LH0 A;  2MMP A;  2C0T A;  5DLO A;  4KUI A;  5KYX A;  2EWN A;  4M75 B;  5GAN 8;  3O8V A;  1YJ9 Q;  3M58 A;  2K5F A;  4J6X A;  2E5K A;  1UJY A;  1YBY A;  3JB9 H;  2ABL A;  3CC7 A;  2XG8 D;  4C8Q B;  5CAI A;  2E6N A;  5GMK h;  1D1B A;  4HKE A;  2ZAE A;  2NUT A;  1BI3 A;  3HHT B;  1NM7 A;  3DB3 A;  1O9S A;  2DO3 A;  1I5L A;  3QPH A;  1IXD A;  1NJI R;  3CCJ A;  5GMK e;  1OQK A;  2ZPB B;  3BE3 A;  3OYJ A;  4PJO B;  1W1F A;  2CSI A;  3NFC A;  2OTJ T;  5KYU A;  1LJO A;  2KK4 A;  2WSC E;  4ZNX A;  2QAZ A;  5CCA A;  1S72 A;  2P4R A;  1HXD A;  2DXU A;  4KUD K;  1E6G A;  2I0N A;  4PJL A;  5M9O A;  2Y90 A;  2OTL Q;  4JJN K;  3CCL T;  2HBW A;  1VQO Q;  2MI6 A;  4RG2 A;  9ATC B;  3MKD A;  2DL8 A;  2YT6 A;  2KXD A;  2J6F A;  3MEV A;  1X75 C;  4M75 G;  3VRZ A;  3M0Q A;  2F5K A;  1ARK A;  3INZ A;  3PMT A;  1BIA A;  1OUL A;  2DVJ A;  2O2O A;  3UAT A;  3P8D A;  4C8Q G;  4DBF A;  1RI9 A;  1V76 A;  3CC7 T;  5I22 A;  2DIL A;  1SF9 A;  2KBT A;  1QLY A;  3G4S Q;  2LT4 A;  4PNO A;  4OMQ A;  1KG1 A;  2DK3 A;  1NG2 A;  1VQK T;  4D8K A;  2W0Z A;  1YWO A;  3A8M B;  2EIF A;  3CCM Q;  2KT1 A;  4PJO G;  3M55 A;  5LJ5 f;  1M8V A;  1LCK A;  4FYY B;  3TVT A;  1IHV A;  3VS4 A;  1PC0 A;  1RLP C;  4EPC A;  2JMC A;  3M57 A;  4UC4 A;  3JCM V;  2O9S A;  1QWF A;  5GAN d;  2JXB A;  3M0S A;  5LJ3 g;  3TU4 K;  2C06 A;  1Y7X A;  2YXY A;  5A0L A;  2K4Y A;  4L59 A;  5FWC A;  2KRM A;  3EGX B;  3NGP A;  1WJR A;  2QAS A;  1Q82 U;  2RI2 A;  2XDD A;  1YNZ A;  4B9X A;  3GBQ A;  1M3B A;  4J9F A;  5A2Q E;  3OW2 A;  4M7D F;  3VYG A;  4QVC A;  2YRV A;  1OV3 A;  3EGD A;  1Q82 C;  2GF7 A;  3U23 A;  1Q86 C;  4C92 A;  1OEB A;  1BKB A;  1OU8 A;  2K5L A;  3HFO A;  4XU0 A;  3RMS A;  1TOV A;  4A54 A;  5IN1 A;  4N4G A;  4HCB A;  1VQL A;  2KDS A;  4JJC A;  3NTH A;  3EH1 A;  3SDZ A;  3C94 A;  2COY A;  1WPY A;  2DBK A;  5LJ5 e;  3GP8 A;  4LXC A;  3RMQ A;  3VS7 A;  5CKE A;  1BCM A;  2XIC A;  4CRI A;  2RHY A;  1WQW A;  4OMN A;  5IH2 A;  4MZP A;  2DRK A;  1D1C A;  3RIR A;  2VXE A;  1IO6 A;  4LN2 A;  2VWF A;  2RPN A;  1ZQ1 A;  2KRN A;  2H3J A;  4M78 E;  1M1K R;  2L2P A;  1JEG A;  1WI7 A;  1YWP A;  4J6Y A;  3FRN A;  1VQ9 Q;  5KYW B;  3I55 A;  1IRE B;  4HT9 A;  3VS6 A;  2MIO A;  2DXT A;  3G71 Q;  3E9F A;  3X24 B;  1Y0M A;  3VS1 A;  3A8H B;  3CEY A;  3C12 A;  2H3E B;  1QCN A;  5L8R E;  4PLL A;  2M0O A;  4M7A C;  2DYB A;  3OYB A;  2DF6 A;  4C0F A;  1I4K 1;  2HZY A;  3J81 E;  1E6H A;  1VQL T;  2K9G A;  1K9M R;  2PU9 B;  3OYE A;  1YCS B;  2DTH A;  3M0U A;  2Y4Y A;  3RER A;  2HNI A;  2CZ0 B;  1R0B G;  4JS4 A;  4M75 F;  4M7A E;  3CCE Q;  1EFN A;  5GAO m;  1KD1 U;  1JRI A;  3C95 A;  4C0D C;  4AT1 B;  2MF2 A;  4C8Q F;  1IGQ A;  1G83 A;  4Y28 E;  4M78 D;  3JAM E;  3J7A F;  2FRW A;  1MHN A;  5GAN h;  3LWI A;  2A37 A;  1YIT A;  1KD1 C;  4DA4 A;  3PGG A;  4QT7 A;  2E1H A;  3J80 E;  1RAA B;  3HTR A;  4PJO F;  4BY6 C;  2E12 A;  3CC2 T;  4KGV B;  4CC3 A;  5GAN e;  1WIE A;  2KQW A;  5CR2 A;  1GFC A;  1YI2 A;  3TRE A;  2R57 A;  2GNC A;  3JB9 D;  3I55 T;  2E5Q A;  2DRM A;  1M90 C;  4M77 B;  4ZN3 A;  2EJF A;  2QA4 Q;  1I8F A;  3HL8 A;  4OP0 A;  4J9I A;  3SFM A;  1K8A U;  3QYG B;  4LUD A;  5IHI A;  1MMD A;  3MHX A;  4M7A D;  2L3S A;  4HCC A;  2DMO A;  2ZPF B;  3OYY A;  3CCQ A;  1VQ6 Q;  1K8A C;  4E7I A;  1M4Z A;  2HSP A;  3CPF A;  2QQB A;  3D7S B;  1PWT A;  4WTO B;  2AZS A;  2DD4 A;  1R8O B;  1D1A A;  4GBQ A;  2L89 A;  2KI7 A;  1FXX A;  4AFQ C;  1RAB B;  2KE9 A;  2KR3 A;  2D6F A;  1PRL C;  2DBM A;  1PKT A;  1YIT T;  3QWX X;  2CP7 A;  1U3O A;  2JT4 A;  2A28 A;  3EFO B;  1B34 B;  1JXM A;  4C5E A;  2JVV A;  1JJ2 A;  4GLK A;  4O5V A;  3MP6 A;  2KRS A;  3X28 B;  1B07 A;  4E47 A;  4F04 B;  2E65 A;  3L2U A;  1YJN A;  4M77 G;  2DZ9 A;  2I2L A;  1YI2 T;  2J6O A;  4ZGJ B;  3CD6 A;  2F2X A;  1W2B A;  2DL3 A;  3E1S A;  1K1Z A;  2LX9 A;  2B86 A;  1VQ9 T;  5I11 A;  2QEX Q;  1N9R A;  3I56 T;  4A4F A;  4JRK A;  2EAY A;  2MWO A;  3ME9 A; 
#chains in the Genus database with same CATH homology
 1YIJ T;  1M1K U;  3RES A;  2ZPG B;  1QVG A;  3X25 B;  1O75 A;  2X4J A;  1NZ9 A;  1BI2 A;  2CZ7 B;  4J83 A;  4OGE A;  3URG A;  3OYF A;  3CC4 T;  4P5N A;  1PSF A;  3E19 A;  2JNG A;  3CCQ T;  4RCC A;  2QEX T;  4NL3 A;  1EIF A;  1VQ7 T;  5GAM e;  3X20 B;  3PIP A;  1VQP A;  4X9D A;  2JTF A;  3OYH A;  2GFA A;  2E70 A;  4YTL A;  1PSE A;  1M1K C;  2PUK B;  2XDP A;  3JCM h;  4ELY C;  2DAQ A;  4J5Y A;  3KXT A;  2RJC A;  2LDM A;  2E41 A;  3UT1 A;  3V7S A;  3OYI A;  4M7D G;  4ZTF A;  4MZM A;  2LC4 A;  4JDS A;  1G3S A;  2VGN A;  2CGH A;  3VKI A;  4M7D D;  2XKO C;  3H8Z A;  3DB4 A;  3OYK A;  1ZHI A;  1SSF A;  2RK1 A;  5CIU A;  4DOW A;  1K9M U;  1M90 U;  1JBM A;  2EYQ A;  5CQY A;  2P0P A;  3WVD B;  1V29 B;  4ZN1 A;  3JCM e;  5KH6 A;  3CCU T;  2QQR A;  3FB9 A;  1WJS A;  4F7U F;  3CMA A;  3OW2 S;  4E7K A;  2FYK A;  2VC8 A;  1VQ4 T;  3CCL A;  3MEU A;  3CCS T;  3LGF A;  1N8R C;  4M7D A;  3KUF A;  4BB7 A;  3LWH A;  3BW1 A;  2YLC A;  3V7C A;  1FX7 A;  2EQJ A;  3BFM A;  4MDX A;  1K9M C;  4FU6 A;  2QQA A;  3SB2 A;  3OMC A;  3UDC A;  3CCR T;  5CKH A;  5GAN 7;  4M78 F;  3FJP A;  4C0Z A;  1MGQ A;  2K3Y A;  5KE2 A;  3L2R A;  3L2Z A;  3N5B B;  2QQ9 A;  2VXF A;  1BI0 A;  1VIF A;  2WAC A;  3DLL A;  2JOY A;  4M75 C;  5FU6 C;  3V8J A;  2RA2 A;  3UPU A;  3ZEH A;  3LH0 A;  2EKO A;  4HCZ A;  4Q5W A;  4JLI A;  4NL2 A;  2MMP A;  5GAM g;  3RKX A;  3L2Q A;  5DLO A;  4KUI A;  1GXI E;  2EWN A;  5FU6 B;  4M75 B;  5GAN 8;  3O8V A;  2K57 A;  3BDU A;  3M4Y A;  2X4W A;  5LJ3 f;  1NPR A;  4C8Q C;  3M58 A;  2K5F A;  4J6X A;  3CPW A;  4L5G A;  1QVF S;  1YBY A;  2RK2 A;  3JB9 H;  2EQU A;  3CC7 A;  1YHQ A;  3PIO A;  3KBG A;  2XG8 D;  1UGR B;  2CS7 A;  2E6N A;  4C8Q B;  5CAI A;  5GAO r;  3CBP A;  5GMK h;  2LNV A;  2L5Q A;  1LNX A;  2CYZ B;  4HKE A;  3RKY A;  2V8J A;  4QVD A;  1BI3 A;  4M75 E;  1AHJ B;  5I2M A;  3JCM g;  3QII A;  1U1S A;  3HHT B;  5LJ5 h;  3JB9 F;  3DB3 A;  1VIE A;  3QJ6 A;  1O9S A;  1BIB A;  1YJ9 T;  2DO3 A;  2EJ9 A;  4BE0 A;  2XK0 A;  5GAN g;  3ER0 A;  3CME A;  1I5L A;  3QPH A;  1W4S A;  4PJO C;  3OS1 A;  2LCL A;  3GNG A;  3FLG A;  4N0A C;  3CCJ A;  5CQX A;  3GIB A;  4C8Q E;  5GMK e;  1QVF A;  2ZPB B;  2LVM A;  4HA8 A;  2JTM A;  2JZ2 A;  2DXC A;  4IUR A;  3VV0 A;  3OYJ A;  4PJO B;  1VQ6 T;  3NFC A;  3QBY A;  4J7I A;  2KMT A;  2OTJ T;  5HK3 A;  3OYM A;  4M7A F;  1LJO A;  2KK4 A;  2LTO A;  2WSC E;  2ZPE B;  3ASK A;  4FT4 A;  3V7R A;  3OS2 A;  5HY6 A;  4XTZ A;  5CCA A;  1BYM A;  1S72 A;  2P0K A;  1HXD A;  2DXU A;  4M78 C;  3CCV A;  3CCM A;  1K73 U;  3QZ9 B;  2ZZD A;  4OVA A;  1WQ7 A;  4DOV A;  4RMO A;  4KUD K;  2DEQ A;  5FRM A;  1Q81 C;  1OI1 A;  2BIV A;  4N4I A;  3OMG A;  4M78 B;  2MAM A;  3MP1 A;  5M9O A;  4PJO E;  3X26 B;  2Y90 A;  4BE1 A;  3EFS A;  1NE8 A;  2FL7 A;  4JJN K;  3OS0 A;  3HPW A;  3CCL T;  4LDV A;  3JCM c;  1VQN A;  3EAE A;  1YJW A;  2MI6 A;  1UEB A;  4ELZ C;  4RG2 A;  2KY9 A;  2O01 E;  4QW2 A;  4C92 C;  1Y96 B;  2RJF A;  1K73 C;  1UB4 A;  3QO3 A;  1HK9 A;  1N27 A;  5IAY A;  2RO0 A;  2YLB A;  5CKD A;  3CC2 A;  2AHJ B;  4C92 B;  1KHC A;  4LDY A;  3SWN C;  3MEV A;  2OTL T;  1X75 C;  4M75 G;  2F5T X;  2A3L A;  4C5I A;  3H6Z A;  4Y91 A;  1VQO T;  3SWN B;  4M75 D;  2F5K A;  3PMI A;  2OAU A;  3A5Z B;  3INZ A;  3PMT A;  1BIA A;  4KUL A;  4XK8 E;  1UGS B;  3P8D A;  5CO7 A;  1M1G A;  3TEE A;  4C8Q G;  4IUP A;  2JN0 A;  4C92 E;  5GMK l;  3GNF B;  3T9N A;  2XID A;  4A4H A;  3ZFJ A;  5KCO A;  3CC7 T;  1YHQ T;  2ZPI B;  3PFS A;  2LT4 A;  4M75 A;  4PNO A;  1U8R A;  3V8K A;  1KG1 A;  3QKJ A;  5LJ3 j;  2DK3 A;  4EMH A;  4QQ6 A;  1VQK T;  2K3X A;  4M77 F;  3A8M B;  2QTX A;  1VUB A;  2EIF A;  3HSB A;  3CME T;  4C8Q A;  2K2V A;  2RJD A;  2E6Z A;  4PJO G;  2O4X B;  3M55 A;  5LJ5 f;  1M8V A;  4C5G A;  1N8R U;  3A8L B;  3L1A A;  3G4S T;  4PJO D;  2VGM A;  2LRQ A;  4EPC A;  5GAM j;  5CVI A;  3M57 A;  3DLM A;  4UC4 A;  5AYF A;  2VYT A;  2KAF A;  3JCM V;  2LQK A;  5A0G A;  5GAN d;  3JCM W;  1KQS S;  3CCM T;  3CCV T;  3GLX A;  5GAO l;  4E7L A;  4OB1 B;  4X9C A;  1I81 A;  3UWN A;  4PJO A;  5LJ3 g;  2RHI A;  1VQ5 T;  3TU4 K;  4N0A A;  2C06 A;  1Y7X A;  5A0L A;  1OZ2 A;  2K4Y A;  2RD1 A;  4L59 A;  3M56 A;  3LX7 A;  3QHS A;  2XI9 A;  3M54 A;  3G6E A;  3QDR B;  5EG2 A;  1WJR A;  2E64 A;  4IUV A;  4JUV A;  1YJW T;  1Q82 U;  5CK9 A;  2RI2 A;  4C92 G;  3PNW C;  4B9X A;  2XDD A;  1YJN T;  1B34 A;  2LQ8 A;  3FIF A;  3HP9 A;  5GAN j;  4ATO A;  5C6S A;  1KQS A;  2IG0 A;  5A2Q E;  1VQM A;  4V2S A;  3CD6 T;  4C92 D;  4IUU A;  2E10 A;  5DM7 R;  2F69 A;  5GAN 5;  3GOX A;  3OW2 A;  4ZTJ A;  4M7D F;  2RJE A;  3VYG A;  2DTI A;  2RH2 A;  3QUI A;  4OB3 B;  4QVC A;  1UGP B;  4PLI A;  4OF1 A;  2YRV A;  4A4E A;  2B8A A;  4J6W A;  4LD9 K;  3OYA A;  1Q82 C;  2XU8 A;  4PKC C;  2GF7 A;  1Q86 C;  4VUB A;  5J3B A;  1BKB A;  2K5L A;  3HFO A;  2BUD A;  4XU0 A;  3RMS A;  4BI4 A;  4C92 A;  3OYC A;  1QP3 A;  1VQ9 A;  4A54 A;  2R5M A;  5IN1 A;  1Y07 A;  4N4G A;  5FRO A;  2CKK A;  4ZGD B;  2KDS A;  3QZ5 B;  3JCM Q;  3G71 A;  3I56 A;  1VQL A;  4HCB A;  4XU1 A;  3NTH A;  1WJQ A;  3SDZ A;  4ME7 A;  1H64 1;  1YIJ A;  1QW1 A;  2DIG A;  2LT1 A;  3CBM A;  2PVO B;  1VQP T;  1Q81 U;  3C94 A;  3LW5 E;  4QQG A;  1WPY A;  4TVR A;  3CC4 A;  4DQ2 A;  4F7U B;  5LJ5 e;  5I21 A;  3GP8 A;  3OY9 A;  3RMQ A;  4QQD A;  5DY9 A;  4BI3 A;  2PUO B;  5CKE A;  4XU2 A;  3M5A A;  2XIC A;  5GAO p;  4LD6 A;  4CRI A;  2DPP B;  2FB7 A;  3HFN A;  2RHY A;  1M5Q 1;  3HKS A;  1BI1 A;  4XTX A;  5LL6 S;  1LOJ A;  5J39 A;  1WQW A;  3OBY A;  4MZP A;  1H3Z A;  2QQS A;  1RI0 A;  3RIR A;  4F7U E;  4LDU A;  2VXE A;  3CCE A;  3P8H A;  3CMA T;  2A7Y A;  2RI3 A;  4X34 A;  4XQ3 A;  2G3R A;  3R6O A;  2IVW A;  2KVQ G;  2X4Y A;  3FDR A;  2D9T A;  1ZBX A;  3GF5 A;  4FSX A;  3F70 A;  1ZQ1 A;  3VUZ A;  2FHD A;  4EMK C;  3OYL A;  2H3J A;  2GQV A;  2EQM A;  2ZGW A;  4M78 E;  1NJI U;  2QXF A;  4ZGE B;  4OB0 B;  3CCS A;  3M59 A;  1IZ6 A;  4J6Y A;  4MZT A;  3FRN A;  4EMK B;  3GPL A;  4IKF A;  4KT0 E;  5LJ3 d;  5GAN 3;  2RHU A;  3HRU A;  1VQM T;  5FRN A;  3HRS A;  3I55 A;  1X01 A;  1IRE B;  3TCJ A;  4B9W A;  4EDU A;  4HT9 A;  5GAN 6;  4BDZ A;  3S3N A;  2QDY B;  5GMK m;  5C0M A;  2DXT A;  3E9F A;  3MO8 A;  4D6W A;  3LGL A;  3X24 B;  5LJ5 g;  3CXC S;  1U1T A;  4MMK A;  2V8I A;  4A53 A;  3A8H B;  3CEY A;  3NTI A;  3PTA A;  3C12 A;  2QI2 A;  3JCM b;  1NJI C;  4J7F A;  2DIQ A;  3S3O A;  2CZ6 B;  3OBW A;  5L8R E;  3SD4 A;  4PLL A;  4C8Q D;  2M0O A;  5HKC A;  4JS5 A;  4M7A C;  1XOV A;  2Y4X A;  4OGC A;  3OYB A;  3OQ5 A;  1UGQ B;  4OB2 B;  4C0F A;  5GAM d;  2ZCF B;  4BE2 A;  3L2W A;  4JRQ A;  4RCB A;  2WSF E;  4R55 A;  4M7A B;  2PQW A;  1I4K 1;  1QVP A;  3HRT A;  3J81 E;  1QP2 A;  3G71 T;  1VQL T;  1KC8 U;  4NS5 A;  2PU9 B;  3OYE A;  2DTH A;  2QA4 A;  2Y4Y A;  3RER A;  2VV5 A;  1G3W A;  1P92 A;  2HNI A;  4FL6 A;  2CZ0 B;  2HQX A;  3CXC A;  1M9S A;  4F7U G;  4RKU E;  3S6W A;  3S3M A;  3MEW A;  4FT2 A;  4OMF B;  3CCJ T;  4BUG A;  3ZBD A;  2HQE A;  4JS4 A;  4M75 F;  3AHU A;  3VJP A;  3PT9 A;  1YJ9 A;  4M7A E;  3JCM d;  1KHI A;  4MML A;  5GAO m;  2DD5 A;  2RM4 A;  5D6W A;  4FIB A;  2MWP A;  5KCH A;  1KC8 C;  1KD1 U;  1VQ8 A;  4BAC A;  1JRI A;  4M78 G;  4A4K A;  1S72 T;  3C95 A;  1Q7Y U;  4C0D C;  4C8Q F;  2MF2 A;  4XTY A;  2XHC A;  3QJY A;  4E7H A;  1VQ6 A;  4Y28 E;  5FU7 C;  4M78 D;  4F7U A;  2OTJ A;  3JAM E;  3J7A F;  1G5V A;  4C0D B;  4RG8 A;  1MHN A;  5GAN h;  4E7J A;  3LWI A;  3JB9 J;  5FU7 B;  5A0D A;  3JB9 I;  1YIT A;  1N9S A;  3MCA B;  3CCE T;  5KE3 A;  1KD1 C;  4DA4 A;  3PGG A;  3VU3 C;  5FLX E;  2E1H A;  1VQN T;  1Q7Y C;  3J80 E;  1Q86 U;  4M78 A;  3VYH B;  3OYN A;  2M1H A;  2FVU A;  4JLG A;  1N6A A;  3OSV A;  1DJ7 B;  2DKG A;  4PJO F;  4BY6 C;  5GAO n;  2E12 A;  3CC2 T;  5GAN e;  2CZ1 B;  2KQW A;  4PL6 A;  4JRI A;  4GY5 A;  3V8L A;  5CR2 A;  3JB9 G;  3M4G A;  1D3B B;  2ZPH B;  2PVG B;  4BI8 B;  4BY6 B;  4M77 C;  3FC3 A;  1M1F A;  3CPW S;  1Y96 A;  2K5I A;  2R57 A;  5D6X A;  3TRE A;  1YI2 A;  3QXE B;  2R58 A;  1WGS A;  1XQH A;  3I55 T;  2E5Q A;  3JB9 D;  1KQ2 A;  1M90 C;  4M77 B;  4ZN3 A;  2EJF A;  4XTV A;  2RI5 A;  2KSS A;  3MP8 A;  4Z02 A;  3WVE B;  5HK0 A;  2OTL A;  2GCX A;  4EMK A;  1I8F A;  3FEO A;  3HL8 A;  3JRZ A;  2D0Q B;  4OP0 A;  4M7A G;  2JUF A;  3SFM A;  1VQO A;  1K8A U;  3SWN A;  3QYG B;  3QYH B;  4IUQ A;  4N4H A;  4C0G A;  5CKB A;  3CBO A;  2XDB A;  4CI0 C;  3MHX A;  3RUX A;  4M7A D;  1XTD A;  1OYX A;  4A4G A;  2NLU A;  3MET A;  4HCC A;  4QVZ A;  4O6J A;  2X4X A;  4BDY A;  3JSC A;  4M77 E;  5LJ5 d;  4KBM B;  5GMK i;  4C92 F;  3OYG A;  5IT9 E;  3C4S A;  2ZPF B;  2L8D A;  3OYY A;  2PVD B;  3M9Q A;  2QA4 T;  2M16 A;  4FM4 B;  4WF2 A;  5DLQ E;  3CCQ A;  2QEX A;  4HT8 A;  4XU3 A;  4MDW A;  1VQ7 A;  3BDL A;  4R56 A;  1K8A C;  2R5A A;  4LDW A;  1Y71 A;  4E7I A;  1XNI A;  4M7A A;  3EFR A;  1M4Z A;  1VQK A;  2HAX A;  1G3T A;  4XTU A;  3CPF A;  5GAM f;  2DXB A;  2QQB A;  2HBP A;  5GMK j;  3OA6 A;  3G7Z A;  1TH7 A;  2EFI A;  3QSU A;  3VUB A;  1VQ8 T;  2O4X A;  2DD4 A;  1R8O B;  2DTO A;  5D6Y A;  2GFU A;  4M7D C;  1JJ2 S;  5LJ5 j;  2L89 A;  4C5H A;  4J8O A;  5GAN 4;  3G4S A;  4BD3 A;  1RL2 A;  1FXX A;  5J26 A;  4L6V 5;  2P4T A;  1YCY A;  1JB0 E;  4M7D B;  3OS5 A;  4JRP A;  2D6F A;  3LLR A;  3WXM B;  2BKD N;  3E9G A;  4LDX A;  3NTK A;  3JCM X;  3CCU A;  3L2V A;  1YIT T;  1W2B S;  3G6E T;  2XD0 A;  2EQK A;  2DVE A;  2HD0 A;  3RKW A;  3JCM f;  1VQ4 A;  4IUT A;  1VQ5 A;  2RHZ A;  1X6O A;  4XTW A;  5GAN f;  1B34 B;  5CKF A;  4C5E A;  2JVV A;  4II1 A;  5I2S A;  3Q1J A;  3MEA A;  1WNL A;  2DJZ A;  2YHT A;  3LYI A;  1JJ2 A;  4GLK A;  5GAN 2;  4M7D E;  3OB9 A;  3P8B B;  3CCR A;  4O5V A;  3MP6 A;  3X28 B;  1KQ1 A;  2VUB A;  2M9U A;  2E65 A;  4E47 A;  3L2U A;  1YJN A;  4M77 G;  2DZ9 A;  2I2L A;  2DZC A;  1OZ3 A;  5LJ3 h;  1YI2 T;  4XAX B;  1QVG S;  4ZGJ B;  3JCM J;  2RHX A;  3A8G B;  3CD6 A;  4NOY A;  1W2B A;  4M77 D;  2RB6 A;  4EMG A;  3OSS C;  3E1S A;  2LX9 A;  1VQ9 T;  2L3R A;  2P0Q A;  1NPP A;  3OYD A;  1D3B A;  2WSE E;  3JCM P;  2V8K A;  1FWZ A;  1N9R A;  3M53 A;  3I56 T;  3L42 A;  2EJG A;  4A4F A;  3A8O B;  3QG1 A;  5LJ3 e;  3DKM A;  4JRK A;  2EAY A;  2MWO A;  5GAM h;  4M77 A;  3BY7 A;  5GAO q;  3ME9 A;  1G3Y A;  2LCC A;  2X35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...