2JN0A

Solution nmr structure of the ygdr protein from escherichia coli. northeast structural genomics target er382a.
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
50
structure length
50
Chain Sequence
DYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQINRDDVSQIIER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of the ygdR protein from Escherichia coli. Northeast Structural Genomics target ER382A.
rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Hypothetical lipoprotein ygdR
total genus 7
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2006-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2jn0A00
2EWNA 2CGHA 1B34B 4XQ3A 4M7AA 4M7DC 4F7UA 4M7AE 2EJ9A 4M78B 4XU0A 1BIBA 1D3BB 1LNXA 5GMKi 2HNIA 3BDUA 1I81A 3JCMW 5GMKj 3INZA 4PJOG 1WNLA 5GAMh 5CAIA 4J6YA 4M75G 4C92D 5GANf 3BW1A 4M7DD 5LJ3e 1M5Q1 5GAN5 4C8QG 5LJ3h 2RD1A 5GAN4 4M75B 4HA8A 4N0AC 5LJ5f 3PGGA 2DXUA 5LJ5h 5GAMe 2DJZA 3FJPA 4XU1A 4C8QC 3JCMc 4M77A 4M77F 5GAN8 5GAOp 4EMKA 4RCCA 4X9CA 4Y91A 3FB9A 2E64A 2E41A 4M75D 3BFMA 5LJ5j 4A54A 4M7DA 4C8QD 4M78C 4C92F 4M78E 2YLCA 5GAMg 3L2ZA 3JCMb 5GAMd 2DTOA 3RERA 3VU3C 4XTZA 4JUVA 1BIAA 1Y96B 5GMKl 4XTVA 4XU3A 5DY9A 5LJ3g 4F7UF 5LJ5g 5GAOm 3SWNA 5LJ3d 3JB9I 4C8QE 4PJOC 2RM4A 4NOYA 1JBMA 1WPYA 4JLIA 4M75C 2YLBA 4J6WA 4M75E 4N0AA 3JCMe 3JB9H 4C8QA 4HT9A 4QVDA 5LJ5e 1I4K1 4PJOE 2E10A 3JCMh 4M75F 1TH7A 4XTXA 3JCMf 2DXTA 4PJOF 5GMKe 5GANh 2YHTA 2DZ9A 2QTXA 3L1AA 1I8FA 3V8LA 1LJOA 4XTWA 1HXDA 5GANe 5GAN7 5GAN6 5LJ3j 4XU2A 4C92G 4F7UB 5GAN3 2DTIA 1D3BA 3M4GA 2I2LA 1U1TA 3JB9D 1LOJA 4NL3A 2EAYA 4EMKB 3JCMV 5GMKh 4M78F 3HFOA 4NL2A 4F7UG 5GAMj 3JCMP 1MGQA 4J5YA 4M77D 3V7SA 2RA2A 5GANg 4PJOA 1JRIA 4XTYA 4C8QB 4C92E 1B34A 4M7AC 4M75A 4M7DE 4M78G 2Y90A 3JCMg 1WQWA 3HFNA 2DVEA 2VC8A 4EMGA 2EJGA 2FB7A 2K57A 3QSUA 4PJOB 2E65A 4PNOA 4RCBA 1N9SA 5GAMf 5I21A 4M77E 4A53A 4EMHA 3QHSA 4HT8A 2DEQA 4MMKA 5GAOl 3RKXA 3BY7A 2VXFA 5LJ3f 2DTHA 4QVCA 3GIBA 4F7UE 4PJOD 3FIFA 4M78D 1H641 1U1SA 5GAOr 2ZGWA 2JN0A 5GAN2 4C92A 5GAOq 4M7AD 3JB9F 4M7DF 1Y96A 2VXEA 3JB9G 3HSBA 3EFSA 1I5LA 2E1HA 2EJFA 3JB9J 4EMKC 5GAOn 4C92B 4JRIA 3RKYA 4X9DA 4M7AB 3EFRA 4DQ2A 4M7DB 3V7RA 3V8KA 3JCMJ 3QUIA 3JCMQ 4WF2A 3RUXA 4M78A 4M7AG 3SB2A 4M77B 2RB6A 1HK9A 5GANj 3RESA 3QO3A 2DZCA 4MMLA 4XTUA 3AHUA 1N9RA 1WQ7A 4OP0A 3SWNB 3V7CA 4M77G 3V8JA 1KQ1A 3RKWA 4J6XA 4JRKA 3SWNC 4C92C 1KQ2A 4V2SA 3JCMX 1M8VA 5LJ5d 4M77C 1X01A 2DKGA 2FYKA 5GMKm 4C8QF 3JCMd 3RIRA 4M7DG 1YCYA 4M7AF 5GANd
chains in the Genus database with same CATH superfamily
1OZ2A 3CC2A 3UA6A 2ECZA 4XU0A 1YIJA 3JCMW 3LW5E 1YBYA 1GRIA 5GAMh 3PIPA 5KYYA 3CMEA 5IHIA 1YI2A 1D0XA 2RN8A 4E7LA 3H41A 3CCJQ 2L89A 1AVZC 2OAUA 2FZGB 3HL8A 2HMAA 3FJPA 5GAOp 3JCMc 3M9QA 1AWXA 2DYBA 1K73U 1QVFS 3CBOA 2O2OA 3PNWC 3QZ9B 1AEYA 3OSVA 1W4SA 3L2ZA 3JCMb 5D6XA 3GNGA 1IRXA 3RERA 1RUWA 4XTVA 2DRMA 3ME9A 5M9OA 3OA6A 2DILA 1QP2A 2V1RA 3VS7A 1PRMC 1D1BA 3UATA 2FZCB 4C8QA 5LJ5e 3CC7A 2YWWA 1I0CA 2DM1A 1YNZA 2J05A 2DZ9A 3AT1B 1Q82R 2XICA 1K8AC 1DJ7B 1VQLA 2DMOA 1YFNA 1IGQA 4C92E 1Y57A 1KFZA 1NYGA 2E6ZA 2KK4A 2VC8A 3MCAB 5D6YA 4ZN3A 4C5HA 1V29B 4Y92A 5EC7A 4EMHA 5C0MA 1T3LA 5CKFA 2AKKA 2A28A 2V8IA 1VQMQ 5FRNA 5GAOq 2JTFA 3OB9A 3A8GB 3LGFA 5J26A 2ZPHB 4KULA 4X9DA 2O9VA 3QWYA 4LDXA 3JCMQ 2O9SA 3MJXA 1PSFA 2DBKA 2L2PA 3QO3A 1GFDA 4IURA 3QBYA 3C4SA 1I5OB 2EQJA 3UF4A 3TEEA 1TUGB 3A8OB 2EYQA 3JCMX 1JJ2A 4AT1B 5FWBA 3RBBB 2GQVA 3L2RA 1UEBA 4JRQA 1SF9A 4II1A 2DPPB 1OPKA 1BIBA 2DL7A 5IH2A 1M3AA 3U23A 2E3IA 5CAIA 1RAEB 3A5ZB 2RD1A 2RHIA 3D7SB 3URGA 5HK0A 2WACA 1G3SA 4XK8E 1VQMA 3MPUB 3M56A 4CRIA 4RTTA 3CCUA 2YUOA 3H6ZA 2O4XA 5FW9A 2RQVA 1JJ2S 5IXBA 4PJOC 1AWJA 4LD9K 3HTRA 3JCMe 3MP8A 4FM4B 2COYA 2MOXA 2K5IA 3JCMh 1BI3A 2J06A 2EYXA 4MDXA 1YWOA 2QK0A 3V8LA 5FWCA 4Z88A 5DM7R 5J3BA 1U1TA 1UG1A 3P8BB 1CSKA 2F5KA 2H3JA 4A4KA 2EQIA 3G4SA 3TU4K 3OYKA 3I9QA 2FB7A 3CCEQ 4RCBA 2V26A 3S3OA 4D8KA 2OJ2A 3T9NA 1M2VA 1EIFA 1TG0A 4J8OA 3A8HB 1QCFA 1H641 2CKKA 1MNEA 1D1AA 2CZ6B 2JN0A 3E9FA 1OYXA 2PQWA 4EMKC 5GAOn 3CCJA 1VQLT 4HCZA 2JS2A 4KBMB 2ATCB 5GANj 4MMLA 2MI6A 1N6AA 3SWNB 1WLPB 1M2OA 4YTLA 3CMAA 2OI3A 3C95A 2KR3A 2KQWA 4GLMA 4CC4B 1MV0B 2KBTA 3NTIA 2O88A 1ABOA 4C92D 2XMFA 5HKCA 1ACMB 1VYVA 1M1KC 5GAN5 5LJ3h 1HJDA 3EAEA 1M1FA 4EDUA 4BB7A 2RHYA 3C94A 3EG0A 3M0RA 4QQGA 4BI4A 2M02A 5FLXE 2PUOB 4PFOA 4ELYC 1R0BG 1MMGA 2X3XD 1E6HA 1PD0A 4JUVA 1Y96B 5DY9A 2K3XA 1D1CA 5LJ5g 1X43A 2DD5A 3J80E 3I56A 1X6OA 2YLBA 3OYCA 3X26B 4KRTA 1NE8A 1Q81U 1S1NA 4A4FA 2JM8A 4F04B 2FO0A 1PHTA 4C92G 2BE9B 4HKEA 1PG5B 4LN2A 1LOJA 2HBPA 4F7UG 1QWFA 4OF1A 2QQSA 2EQMA 1NPRA 3VS5A 3CCVT 1WQWA 4ANJA 2H3EB 1VQ7A 2IVWA 2JMCA 2HKQB 2EYZA 3KUFA 2LX9A 1K73R 2K5FA 5GAOl 1VUBA 2QI2A 2DF6A 1N5ZA 4FSXA 2M9UA 3LH0A 2F2VA 4OB0B 5FU7B 1NZ9A 4C0GA 1RI9A 3JB9J 2VWFA 2JJ9A 3EFRA 2FVUA 3X20B 1NYFA 1ABQA 4OGCA 2F69A 2AHJB 1QVPA 3OS5A 3CPWS 4OMFB 1VQNQ 2E4HA 3MEWA 1Q82U 1VQ8A 4M4ZA 1XTDA 1K76A 4QQ6A 2PTKA 4F7UA 2D9TA 1VQ6A 1JJ2P 4C5IA 4M7DD 5FRMA 1M5Q1 4LDUA 1SG5A 2A3LA 3EGDB 1SSHA 2FEIA 5LJ5f 2YDLA 4M77A 2E64A 1ZHIA 1R8OB 3O8VA 2WSFE 4M7DA 1YHQA 1NPPA 4M78E 2GCXA 2EGCA 2CP5A 3QIIA 1NLOC 2DK3A 2ENMA 2XK0A 5LJ3d 3OYBA 1YWPA 1OQKA 2RM4A 3M0SA 4PJOE 3EHQA 2EPDA 2AKLA 2ROLA 3CXCS 2VVKA 2QTXA 2RJDA 2DTIA 5FU6C 4N4IA 1YIJQ 2DD4A 1BCOA 1M1KR 2J7IA 3HFOA 1K9MC 5D6WA 4QKUA 1KHIA 2KT8A 2Y4XA 4O6JA 2EGEA 1K73C 3M59A 4KH0B 3QG1A 5GAMf 5I21A 2K2MA 2QAZA 3VS1A 2F2XA 5IHKA 4IUUA 2KGTA 5L23A 4BI3A 3M4YA 1KG1A 1BK2A 3TQ7P 3G7ZA 1VQNA 2F5TX 3OBWA 3OW2P 2LQNA 1XOVA 2NUPB 4ELZC 2CP2A 1SKUB 1YJWT 2DNUA 2V1QA 4RG2A 4JRKA 3KFVA 3G4ST 3C12A 1M8MA 5GANd 2EWNA 3OYDA 1VQ4Q 1X6GA 4ZGDB 3CEYA 2DBMA 5HY6A 4RTVA 5GMKj 1TWBA 2AIRB 1OULA 1WJQA 1MMDA 4HA8A 5GJVB 5DLQE 1VQ8T 1O9SA 2NLUA 1KQSP 1VQNT 4VUBA 3OMGA 4M78C 1PCXA 4D8DA 1E7OA 4R0KA 4BD3A 5CR2A 1VQPT 3RNJA 2CUBA 2GF7A 1TS9A 2DVJA 4PJMA 4F7UF 2LT1A 1WI7A 1JB0E 3DLMA 3JB9H 4HT9A 2MYSA 1VYUA 4LUDA 2OTLA 1JO8A 3E1SA 2YRVA 2JXBA 1HYOA 5GMKe 3KBGA 3L1AA 1QQJA 1I8FA 4XTWA 2L3QA 3A8LB 1MUZA 1VQ5Q 1SHFA 2O01E 1YITT 3FC3A 3JCMP 2BZYA 1Z9QA 3OY9A 3EH1A 3NTKA 2JM9A 2K6DA 2Y90A 2ED1A 3FLGA 1O75A 3CMAT 1GXIE 2DJQA 1RAIB 4AFZC 1K0SA 4E2FB 1MHNA 2XDPA 2O31A 3BY7A 4BE2A 1D0YA 4F7UE 1TOVA 2Z0WA 2I0NA 3S3NA 3TSZA 1TUCA 2FPDA 4DEXA 2BKDN 4HCCA 4FCYA 2CP7A 4C92B 4MZPA 3V8KA 3JCMJ 2EKHA 1EFNA 5HK3A 2PZ1A 1Q81R 2K9GA 1W6XA 4FSSA 1WQ7A 4OP0A 4ATOA 3M57A 1K9MR 2CH4A 3GNFB 1UHFA 2MF2A 4OMPA 4A63B 1LCKA 4WCIA 4C5EA 2WSEE 2AT1B 2E70A 4C8QF 4KGVB 1YCYA 4EIKA 3EG2A 3CCVA 2KRSA 5CK9A 1QVGS 4E7IA 1YJNT 2EJ9A 3JAME 2YUPA 2KY9A 4M75G 3BE3A 2DE0X 1ZSZB 2BIVA 1VQ5T 4F14A 4ZTJA 1XNIA 4RCCA 4Y91A 5IN1A 1YJNQ 1R77A 1RADB 3H9NA 3P8HA 3LWIA 1KC8U 3OYJA 1UGVA 3VKIA 3CMET 3L2QA 4FU6A 4Z8AA 1GBRA 3PMIA 3J81E 3CC2Q 2L8DA 2JMAA 3GOXA 2X9HA 1WPYA 4DA4A 4M75F 4GY5A 3CPFA 3CCSA 1MV3A 5GAN3 2FZKB 5KCOA 4N4GA 2CZ0B 5GMKh 1IGUA 1X27A 2EFIA 2A0FB 3CCMA 1VA7A 2RJEA 3UWNA 4EMGA 3OYHA 2OTJT 1WZOA 2K57A 2KMTA 3NPFA 3VS3A 2NUPA 3CD6T 4L59A 5LJ3f 2JTMA 4C0DC 1AOJA 1TTHB 3REBB 2YUNA 2ZGWA 3PVLA 5A2QE 3JB9F 2E3HA 2MCNA 3H0IA 2EYYA 3HRSA 5ECAA 3G71Q 1PRLC 1AHJB 1ZSZC 3CXCP 4M7AG 8AT1B 2DZCA 3VUBA 2HAXA 2KYMA 2FHDA 2ZCFB 2YUQA 1WHMA 3RKWA 1G83A 2RJCA 3M53A 3H0HA 1M1KU 3DKMA 2IPOB 1YP5A 2VYTA 1GCPA 4FIBA 2OTJA 3CC7Q 3VUZA 1IO6A 1K0XA 2HEQA 2KXCA 2RQRA 4J6YA 2JW4A 3FRNA 2O4XB 3PMTA 1OZ3A 5KCHA 4QW2A 4AG2C 1JU5C 3A1PA 5EG2A 4IIMA 4QQDA 4E47A 4C8QC 2B8AA 2DAQA 2JNGA 2RPNA 3MHXA 4A54A 3OW2A 1VQOT 1RLPC 1W2BP 1LPLA 2HQHA 5A0GA 3NMZC 4E7ZA 1YJWQ 3JB9I 1NJIC 1Q82C 2A36A 1FX7A 4M7AA 2RK2A 3E2UA 1WX6A 3JV3A 2QEXA 3CC2T 5GANh 2XDBA 4HXJA 3CMEQ 1M30A 2XDDA 2RJFA 1T0JA 2C0OA 2DIQA 1D09B 2CYZB 4IIOA 1ZLMA 1Q81C 4M78G 2QTVA 1GCQC 1FYNA 2D6FA 2BTTA 3DB3A 3QHSA 1BKBA 2QQ9A 1UFFA 2KSSA 5CVIA 5HCKA 2RHUA 5KE3A 2RK1A 2OAWA 2CSIA 3C0CA 1Q86C 1WFWA 4JRIA 4DQ2A 2HQXA 2Y4YA 1S72T 2K79A 3CC4A 1X6BA 1H3HA 1RAAB 2MAMA 3NGPA 3AHUA 2E12A 2E6NA 4RTUA 5GJWB 3GLXA 1UGPB 3A8MB 2MWOA 1ZUUA 3MP1A 1IHVA 1PM3A 2CGHA 3M0PA 2OTJQ 2M1HA 1OU8A 4RTZA 3INZA 3CD6Q 3RDVA 1M2VB 4CC2A 1WHJA 2KXDA 4C8QG 4OMLA 3G4SQ 1BI2A 1VIFA 1KK7A 1M3BA 4L5GA 5CQXA 3CC7T 2E41A 2EBPA 1JXMA 1VQ5A 2LX7A 2BZ8A 2DLPA 5KYWB 1RAFB 4XU3A 3Q1JA 3SWNA 4JS5A 4C8QE 1NG2A 1X2QA 5I22A 1K9MU 1B07A 2KVQG 2RI2A 4F17A 4JJCA 2DL5A 3GBQA 1WHHA 3R6OA 1KJWA 4BI8B 2ROTA 4BY6B 3JB9D 4NL3A 2QGFB 2CT3A 1NBEB 4B6MA 1JXOA 4Q5WA 4DBFA 1PKTA 3I56Q 4CC7A 3EG9A 4RUGA 3CD6A 4M75A 3A98A 1OV3A 4XAXB 2EJGA 3O5ZA 4KUDK 2LQWA 4BDZA 1VOMA 2A08A 3UT1A 2P84A 1QKXA 2KROA 4HVVA 3GPLA 1KC8R 3FIFA 1VQ4T 4M78D 1PNJA 3ER0A 3HKSA 3SHWA 3EFSA 5KYXA 2DL8A 5IAYA 3M5AA 3RKYA 2ZPGB 3QUIA 2DX1A 4FW2A 3ZEHA 2KEAA 4ESRA 3G71A 2SEMA 1WXBA 4XTUA 4IUPA 4C5GA 3EFOB 1T0HA 4HVUA 4TVRA 3I35A 1UTIA 3V8JA 2LTOA 2X3WD 2DERA 1UJ0A 1G2BA 3RIRA 1WGSA 3CQTA 3X24B 5CQYA 4JS4A 1D3BB 2X51A 4AFQC 4MZTA 5I2SA 1YN8A 3BDLA 5LJ3e 1S72A 3NFCA 4PLIA 2GNCA 1KIKA 3PGGA 2DXCA 3EH2A 1AZEA 1YJNA 2RHZA 3BFMA 4DEYA 1SPKA 1UDLA 2P4TA 4C8QD 1ZX6A 1NEBA 2DTOA 1GL5A 3VU3C 4XTZA 1N8RU 3X25B 3CCEA 2XIDA 3G6EA 3OQ5A 2ZPBB 2YSQA 4J6WA 3PT9A 3QKJA 4JLGA 5KYUA 1KD1R 2P0QA 2M0OA 4BE0A 2YHTA 5FROA 1WYXA 2LP5A 1VQPQ 4F7UB 1M3CA 2M51A 1ZA2B 3R6NA 2QEXT 1VQ4A 2OTLQ 3OS0A 1YHQQ 1FMKA 3QDRB 2DL3A 1VQ8Q 2H8HA 2XHCA 5CKHA 2CP3A 4A4EA 1VQKA 3VRZA 1VQ6Q 1ARKA 2HDAA 3UDCA 4QVCA 2RO0A 1VQ7T 2QG9B 1YJ9A 1VIEA 4J9BA 1JQQA 4C92A 4KUIA 1SRMA 3M58A 3OYGA 2JVVA 3IQLA 4FW1A 1W70A 1BI1A 3SB2A 4E7HA 4KT0E 3V7CA 5AYFA 2HZYA 1WHKA 1KQ1A 5CO7A 4DOWA 1X01A 3LX7A 2FYKA 4QT7A 1ZQ1A 2RQUA 3MKDA 3PFSA 4X1VA 4L6V5 2L0AA 2L5QA 1D0ZA 2LCSA 2R57A 1VQPA 1KC8C 4X34A 3CCRT 5GAN4 2DYIA 2GGRA 1VQKQ 5CKEA 4N0AC 4A4HA 5LJ5h 1FWZA 2M16A 2DFUA 1YCSB 2D1XA 4Z02A 5LJ5j 1YJ9Q 2COWA 2MWPA 1OOTA 2XG8D 5GAMd 3TCJA 2ABLA 1UECA 1RLQC 2DA9A 2NWMA 5FU6B 3TREA 4JLIA 1RL2A 4M75E 4M75C 4N0AA 1I4K1 3G1JA 1M4ZA 1N27A 1M90C 2L3SA 1K8AR 5GAN6 4XU2A 3UA7A 3CCET 3CCST 3JCMV 2K3YA 1IB8A 1J3TA 1QCOA 2E5QA 2YT6A 4PL6A 1B34A 3OYFA 4DBRA 2VKNA 2QYZA 3PTAA 2PU9B 4PJOB 1NM7A 3LGLA 1M1GA 2VXFA 1B7TA 2DTHA 4MDWA 2LDMA 4J9CA 1UUEA 1NEGA 4PJNA 4R55A 4OMNA 1EZZB 2QQAA 2XU8A 4FYWB 1NJIR 2VXEA 1PC0A 1I5LA 4OMQA 3OS1A 2EYWA 2PNIA 2OX7A 1E6GA 2JUFA 3EGUA 3CC4Q 2RH2A 4LXCA 4M77G 1ZBXA 2VUBA 3CCUT 2LCCA 3LH5A 4JJDA 2DKGA 1U5SA 1KQSS 2L3RA 5DLOA 4JJNK 1QVGA 2G6FX 4LUEA 3OYNA 3EGDA 1EX4A 3OYAA 2FL7A 1KQSA 4E7KA 4PLLA 2R5MA 4EMKA 2W0ZA 4X9CA 5KYUB 3ZBDA 1RI0A 2YLCA 2NUTB 3KXTA 1TU0B 2VV5A 2EKOA 4ZTFA 2ZAEA 1BIAA 4BDYA 2KYBA 5GAOm 3TVTA 1BI0A 1ZSGA 2CSQA 3VRYA 2HSPA 5L8RE 1VQMT 3MEVA 3CXCA 3MEUA 2P4RA 3HRUA 4PJOF 1X2KA 2MPXC 3GP8A 1X75C 1G5VA 3OMCA 4RKUE 3S3MA 3QXEB 1TUDA 2BZXA 1U3OA 3WVEB 4LD6A 2GTJA 2AK5A 2LNHB 4PKCC 4FL6A 4PK4A 3CCSQ 1PSEA 3DB4A 3CCVQ 3VS2A 2QA4T 4HT8A 2AZSA 2W10A 1UHCA 2CT4A 4Y28E 1YIJT 3UPUA 1IHWA 1Y96A 1N8RR 4F16A 2F1LA 2HCKA 2HKNA 3M55A 4BUGA 1RACB 1UJYA 1M90U 2J6KA 1CKAA 1KD1U 3RESA 3JRZA 2R5AA 1VQLQ 2KRNA 1RAHB 4J9EA 1Z9ZA 2L3PA 3EG1A 4J6XA 3SWNC 2CUDA 2PUKB 1RAGB 1G3WA 1KSWA 2MK5A 3CCRQ 4M7AF 3RR6A 4HVWA 4M78B 1H8KA 1LNXA 2LJ1A 1WNLA 2WSCE 3G6EQ 2CREA 2LJ3A 4JZ3A 4JRPA 3BW1A 1Q7YU 2K4YA 3FEOA 2RQWA 1QMCA 2YXYA 1G3YA 2LVMA 2QXFA 2IIMA 3QJ6A 1V1CA 1YITQ 3CCMQ 3CBPA 1I1JA 1BCMA 2R58A 3QJYA 5KYYB 1BYMA 2DETA 4A4GA 5CKBA 3OYIA 3CPWP 2QDYB 3DLLA 2DO3A 3PIOA 2AZVA 4DBHA 1C1AA 4PFZA 1H3ZA 3META 4OMOA 1Q86U 4C0FA 2A7YA 1TH7A 4J9GA 3OS2A 5GANe 1QW1A 1LJOA 4KH1B 1UGQB 2EIFA 2EAYA 4J9HA 4M78F 9ATCB 5GAMj 1MMAA 2RI5A 3V7SA 2RA2A 5GANg 2QDLA 4C8QB 2X4YA 4JPBW 2OTLT 3NTHA 3JCMg 2QEXQ 3E9GA 2KNBB 3FJ5A 2NYSA 4JJBA 2DL4A 3RKXA 2LJ0A 3CCUQ 1AT1B 1LVKA 2RQTA 5KYXB 4AG1C 5D7UA 3SFMA 2LCLA 3WXMB 3EHRA 3VS0A 4M7AB 4RMOA 1QCNA 3OW2S 3HRTA 1K8AU 4C0ZA 5C6SA 1ZBJA 2DIGA 2LQKA 2XI9A 4D6WA 2RI3A 1YJWA 3WVDB 4XQ3A 2RNAA 3QDFA 3BDUA 1ZSZA 2G3RA 2HL5C 1QP3A 1C0MA 1MNDA 4AMCA 3OBYA 2FPEA 4XU1A 1VQOA 5GAN8 1NJIU 1ZUKA 5IT9E 4B9WA 2GFUA 3I5RA 2JT4A 1A0NB 2RF0A 2RHXA 5GMKl 3PE0A 5LJ3g 4EPCA 1M9SA 4NOYA 1WJSA 2A37A 3EG9B 1GBQA 2EW3A 2M0YA 3CBMA 3S6WA 4PJLA 1Q95G 3QZ5B 4XTXA 3JCMf 2CP6A 2K2VA 5GAN7 1QLYA 4HCKA 5KYNA 5IHNA 3CCJT 5I11A 2CS7A 4E7JA 4GLKA 1XJWB 4Z89A 2NUZA 4J5YA 4M77D 3OYEA 4WTOB 1JRIA 4XTYA 2JOYA 3OSSC 1BB9A 1C6VX 2J6OA 2P0KA 2XKOC 3CMAQ 1UGRB 2HD0A 3E19A 1N9SA 4IUTA 4RTWA 4A53A 2QQRA 1HSQA 2HL3A 3GIBA 4E6RA 1Y7XA 1ZUYA 5KYWA 1TXQA 4M7DF 2QASA 1SHGA 3VYGA 3CPWA 1WHLA 4P5NA 2DXBA 2EVRA 3I5SA 1GCQA 4RTYA 3RUXA 3CCLT 4RG8A 2KAFA 1HK9A 3CCMT 5J39A 2ZPFB 3VYHB 3OYLA 1YI2Q 2MMPA 1PWTA 4C92C 1KQ2A 1VQ6T 4V2SA 4M77C 4M7DG 4B9XA 3ASKA 2GTOA 2CDTA 3P8DA 5GMKi 3CCRA 2LNVA 3I55T 2D8HA 2VGMA 2GFAA 4ME7A 4OVAA 4RTXA 1SSFA 3EG3A 3SDZA 1KHCA 2GQIA 2DXUA 2DJZA 2HBWA 4K11A 5LL6S 1FXXA 1ZA1B 2BUDA 2YRCA 4CC3A 3VJPA 4C92F 1K1ZA 2KI7A 1M90R 2JTEA 2PVOB 3PVQA 1WHGA 3OYYA 2LMJA 3M0TA 4CI0C 2FRYA 2KT1A 2YRDA 1JBMA 1OI1A 5GAOr 4QVDA 3SEMA 4LNPA 4J9FA 2B86A 4IUQA 4OB1B 5LJ3j 2D0QB 1D3BA 1M27C 2KRMA 3L2WA 4EMKB 4KGZB 1VQ9A 1JEGA 1VYTA 2C0IA 4UC4A 2X4XA 1B3QA 1AZGB 4J7IA 1FMWA 1Q7YR 4PJOA 2CZ7B 4BE1A 3ULRB 1PKSA 4E7SA 3G6ET 4MMKA 4AFSC 4PJOD 1TSFA 3QPHA 3I55A 3RMQA 1W2BA 1XQHA 1IXDA 2E1HA 3VS4A 4M7DB 3LYIA 2JZ2A 2F2WA 3SD4A 1Q86R 2X4JA 1VQOQ 2CH4W 2RB6A 2E5KA 1IZ6A 5KH6A 4DBQA 1AWOA 4C0DB 3MEAA 4ZN1A 1GFCA 5AT1B 7AT1B 2QA4A 2K5LA 1SEMA 2EGAA 4OB3B 2LQ8A 4M7AE 3GF5A 1V76A 2C0TA 1VQ9Q 4PJOG 1QVGP 1UE9A 5CCAA 1W2BS 1UGSB 4N4HA 2EQUA 5IXFA 3L2UA 2XD0A 1IREB 4JZ4A 1OEBA 1U8RA 1N8RC 5GAMe 4M77F 1G8XA 1YI2T 1OPLA 2X35A 4M75D 4KGXB 3CCLQ 4FT2A 4JDSA 5GAMg 2SRCA 2QQBA 3ZL7C 5CIUA 3G71T 2PVGB 3CCQT 1NLPC 3REAB 1K4US 3M54A 4QVZA 3JB9G 5I2MA 1OX9A 1OU9A 1WXTA 1OX8A 3CCQA 4MZMA 1YITA 2HQEA 1WDXA 4IKFA 2ED0A 3J7AF 2K7AA 4OMMA 3HHTB 1HXDA 3MP6A 2JS0A 6AT1B 3M4GA 4ZGEB 2IG0A 1Q7YC 1SRLA 2LC4A 1YHQT 1T3SA 4BY6C 4M7AC 2VB6A 4LDYA 3HFNA 2DVEA 3QSUA 3QYHB 4ZNXA 2E65A 1PD1A 4PNOA 1Y0MA 4GBQA 3LWHA 1Y07A 1VQ9T 2D8JA 3M0QA 2ZZDA 4FYXB 1U1SA 2J6FA 3CC4T 2LRQA 4FYVB 4J9IA 4HCBA 3CCLA 2ZPEB 8ATCB 1U06A 4J9DA 3VS6A 4J83A 3M0UA 2KE9A 1S72Q 4WF2A 1QVFA 3EFOA 4FT4A 2LZ6B 1AD5A 1FMVA 3CCQQ 4R56A 2CP0A 4O5VA 3FDRA 5CKDA 2QA4Q 1M8VA 5FU7C 2CZ1B 3JCMd 1I07A 3QWXX 2V8KA 2DEUA 1KD1C 3NHNA 1B34B 2RMOA 4M7DC 1HD3A 1BU1A 2HNIA 1I81A 2EQKA 2NUTA 2V8JA 5GANf 5A0DA 4M75B 4OB2B 2FG0A 1K9AA 2X4WA 1WA7A 2ZPIB 3FB9A 3X28B 2VGNA 1WJRA 3L2VA 1R0CB 3OYMA 2QGGA 3L42A 2C06A 3VV0A 3H0FA 3H8ZA 2BE7D 2COZA 2VASA 4LE9A 2LT4A 2E10A 1YJ9T 4OGEA 1VQ7Q 2DXTA 5A0LA 1MMNA 3QYGB 1VQKT 1QVFP 2I2LA 5KE2A 3JSCA 1RABB 2FRWA 4NL2A 2KDSA 1MGQA 4FYYB 4NS5A 3I56T 2K3BA 1P92A 4BACA 3RMSA 1X69A 1G3TA 2ESWA 4M7DE 3EGXA 3THKA 2PVDB 3N5BB 4M77E 2FPFA 1F1BB 2P0PA 2DEQA 4IUVA 1QWEA 4LDWA 3I55Q 1W1FA 4ORZA 2MIOA 1Y71A 4ZGJB 5GAN2 4M7AD 4DOVA 1QKWA 3HSBA 3F70A 2GBQA 2EJFA 4J7FA 3LLRA 3V7RA 4PFPA 4PJJA 1WIEA 3ZFJA 4M78A 2HSEB 3HPWA 4M77B 2DRKA 1CKBA 1N9RA 2D0NA 3TSWA 1AWWA 3EGXB 3HP9A 1WXUA 4AFUC 3MO8A 5LJ5d 5GMKm 1UB4A 1H92A 1BBZA 4LDVA
chains in the Genus database with same CATH topology
2EWNA 1OZ2A 3OYDA 1YJWA 3CC2A 3WVDB 5CQYA 4XQ3A 4JS4A 4ZGDB 4XU0A 3CEYA 1D3BB 1YIJA 3BDUA 5HY6A 3JCMW 3LW5E 5GMKj 1YBYA 2G3RA 4MZTA 5GAMh 3PIPA 3CMEA 5I2SA 1WJQA 1YI2A 3BDLA 5LJ3e 1QP3A 1S72A 4E7LA 2L89A 3NFCA 2OAUA 1M1KC 4PLIA 4HA8A 3HL8A 3OBYA 3PGGA 5DLQE 3JB9D 3FJPA 4XU1A 5GAOp 2DXCA 3JCMc 5GAN8 1VQOA 1O9SA 3M9QA 1NJIU 2NLUA 1K73U 1VQNT 1QVFS 1YJNA 5IT9E 2RHZA 4VUBA 3OMGA 3BFMA 3CBOA 2P4TA 4B9WA 3PNWC 4C8QD 2GFUA 3QZ9B 4M78C 3OSVA 4BD3A 5CR2A 1VQPT 1W4SA 3L2ZA 3JCMb 5D6XA 2DTOA 3GNGA 3VU3C 3RERA 2GF7A 4XTZA 1N8RU 3X25B 3CCEA 2RHXA 5GMKl 4XTVA 5M9OA 3ME9A 5LJ3g 4F7UF 2LT1A 2XIDA 4EPCA 3OQ5A 3OA6A 3G6EA 1JB0E 1M9SA 1QP2A 2ZPBB 3DLMA 4NOYA 1WJSA 3JB9H 4J6WA 3PT9A 4C8QA 3QKJA 4JLGA 5LJ5e 3CC7A 4HT9A 3CBMA 3S6WA 2OTLA 3E1SA 2P0QA 2M0OA 2YRVA 3QZ5B 4XTXA 3KBGA 3JCMf 5GMKe 4BE0A 2YHTA 5FROA 2DZ9A 2K2VA 3L1AA 1I8FA 5GAN7 4XTWA 4F7UB 3A8LB 2XICA 3CCJT 1K8AC 2O01E 1YITT 2CS7A 2QEXT 4E7JA 4GLKA 3FC3A 1DJ7B 1VQLA 1VQ4A 3JCMP 4J5YA 3OS0A 4M77D 3OY9A 3OYEA 3QDRB 1JRIA 4XTYA 2JOYA 4C92E 3OSSC 3NTKA 2Y90A 2P0KA 1O75A 2E6ZA 2KK4A 2XHCA 2VC8A 3FLGA 3MCAB 5CKHA 2XKOC 1V29B 5D6YA 4C5HA 4ZN3A 1UGRB 2HD0A 3E19A 1N9SA 4IUTA 4A4EA 1GXIE 4A53A 4EMHA 1VQKA 1MHNA 2QQRA 2XDPA 5C0MA 3BY7A 3UDCA 4BE2A 4QVCA 2RO0A 5CKFA 4F7UE 1VQ7T 3GIBA 1Y7XA 2V8IA 1YJ9A 1VIEA 5FRNA 5GAOq 3S3NA 2JTFA 4C92A 4KUIA 3M58A 3OYGA 4M7DF 3OB9A 2JVVA 3A8GB 3LGFA 5J26A 2ZPHB 2BKDN 3VYGA 3CPWA 4HCCA 4KULA 4P5NA 2DXBA 4C92B 4X9DA 4MZPA 3V8KA 3JCMJ 4LDXA 3JCMQ 3RUXA 1BI1A 1PSFA 3CCLT 4RG8A 3SB2A 2KAFA 4E7HA 1HK9A 5HK3A 3CCMT 3QO3A 4KT0E 4IURA 1WQ7A 3QBYA 3C4SA 4OP0A 3M57A 2ZPFB 5AYFA 2EQJA 3V7CA 3VYHB 3TEEA 3OYLA 2MMPA 1KQ1A 3A8OB 3GNFB 5CO7A 2MF2A 4C92C 1KQ2A 2EYQA 4DOWA 1VQ6T 4V2SA 3JCMX 4M77C 2WSEE 1X01A 3LX7A 2E70A 2FYKA 4C5EA 4C8QF 1JJ2A 4M7DG 2GQVA 1ZQ1A 1YCYA 3L2RA 1UEBA 4B9XA 3CCVA 3ASKA 4JRQA 3PFSA 5CK9A 2XD0A 4II1A 2DPPB 4L6V5 1QVGS 4E7IA 1YJNT 3P8DA 2EJ9A 5GMKi 3CCRA 1BIBA 2L5QA 2LNVA 3I55T 3JAME 2KY9A 2R57A 2GFAA 2VGMA 4ME7A 5CAIA 1VQPA 4OVAA 1KC8C 4M75G 3A5ZB 1SSFA 4X34A 3CCRT 2BIVA 5GAN4 2RD1A 3SDZA 4ZTJA 1KHCA 1VQ5T 5CKEA 4N0AC 2DXUA 4A4HA 5LJ5h 2DJZA 1XNIA 2RHIA 1FWZA 2M16A 3URGA 4RCCA 5LL6S 1FXXA 4Y91A 5IN1A 5HK0A 2BUDA 3P8HA 2WACA 1G3SA 4XK8E 4Z02A 5LJ5j 1VQMA 2MWPA 3LWIA 3M56A 1KC8U 4CRIA 3OYJA 3VJPA 3CCUA 4C92F 3VKIA 3H6ZA 2XG8D 3CMET 3L2QA 4FU6A 3TCJA 5GAMd 2O4XA 3PMIA 2PVOB 3J81E 4D6WA 3OYYA 2L8DA 1JJ2S 3GOXA 5FU6B 4CI0C 4PJOC 3TREA 5GAOr 1JBMA 1OI1A 1WPYA 1RL2A 4JLIA 4M75E 4M75C 4N0AA 3JCMe 4DA4A 3MP8A 4FM4B 1I4K1 4QVDA 5J39A 2K5IA 3JCMh 4M75F 1BI3A 4GY5A 1M4ZA 1N27A 3CPFA 3CCSA 4IUQA 1M90C 4MDXA 4OB1B 3V8LA 5DM7R 5GAN6 5LJ3j 2D0QB 4XU2A 5GAN3 5J3BA 1D3BA 1U1TA 5KCOA 4N4GA 1VQ9A 3L2WA 2CZ0B 4EMKB 3CCET 3CCST 3JCMV 5GMKh 2K3YA 3P8BB 4J7IA 2F5KA 2X4XA 4UC4A 2H3JA 2EFIA 3C12A 4PJOA 2E5QA 4A4KA 3CCMA 2CZ7B 3G4SA 3TU4K 4PL6A 1B34A 3OYFA 4BE1A 3OYKA 2RJEA 3UWNA 2PU9B 4EMGA 3OYHA 3PTAA 2FB7A 2K57A 2OTJT 4PJOB 4RCBA 2KMTA 3S3OA 3G6ET 3LGLA 1M1GA 3CD6T 4MMKA 3T9NA 2VXFA 4L59A 5LJ3f 2DTHA 2JTMA 1EIFA 4MDWA 2LDMA 4J8OA 3A8HB 4C0DC 3CMAT 4PJOD 4R55A 1H641 2CKKA 2CZ6B 2JN0A 2QQAA 2XU8A 2ZGWA 3E9FA 3QPHA 5A2QE 3I55A 3JB9F 3RMQA 1W2BA 1OYXA 1XQHA 2VXEA 2PQWA 1I5LA 2E1HA 4EMKC 5GAOn 3OS1A 4M7DB 3CCJA 3HRSA 3LYIA 2JZ2A 1VQLT 3SD4A 1AHJB 2JUFA 2X4JA 4HCZA 4M7AG 4LD9K 4KBMB 5GANj 2RB6A 5KH6A 1IZ6A 2DZCA 4MMLA 2MI6A 3VUBA 1N6AA 2RH2A 3SWNB 2HAXA 4C0DB 4M77G 2FHDA 2ZCFB 3MEAA 4YTLA 4ZN1A 1ZBXA 3RKWA 3CMAA 2VUBA 3CCUT 2LCCA 2RJCA 3M53A 1M1KU 3C95A 3DKMA 2QA4A 2DKGA 2K5LA 2VYTA 1KQSS 2L3RA 5DLOA 4JJNK 4OB3B 4FIBA 2KQWA 2OTJA 1QVGA 2LQ8A 3VUZA 4M7AE 3GF5A 3OYNA 3NTIA 4PJOG 4J6YA 4C92D 5CCAA 1W2BS 3FRNA 2O4XB 5HKCA 3OYAA 1UGSB 3PMTA 4N4HA 2EQUA 2FL7A 1OZ3A 5GAN5 1IREB 5KCHA 3L2UA 4QW2A 4E7KA 1KQSA 5LJ3h 4PLLA 5EG2A 3EAEA 1U8RA 1N8RC 4QQDA 4E47A 5GAMe 2R5MA 1M1FA 4C8QC 4EDUA 4M77F 4BB7A 4EMKA 1YI2T 4X9CA 2RHYA 2B8AA 2DAQA 2JNGA 2X35A 3C94A 3MHXA 4M75D 4QQGA 4BI4A 4A54A 5FLXE 2PUOB 4ELYC 3ZBDA 3OW2A 1RI0A 4FT2A 1VQOT 2YLCA 4JDSA 5GAMg 2QQBA 3KXTA 5CIUA 3G71T 2VV5A 2EKOA 2PVGB 5A0GA 4ZTFA 4JUVA 1BIAA 1Y96B 3CCQT 5DY9A 2K3XA 3JB9I 4BDYA 5GAOm 5LJ5g 1BI0A 1NJIC 1Q82C 2DD5A 1FX7A 3M54A 4QVZA 5I2MA 3J80E 3I56A 1X6OA 2YLBA 2RK2A 3OYCA 3JB9G 4M7AA 3X26B 5L8RE 1VQMT 3MEVA 4MZMA 3CXCA 3CCQA 2HQEA 2QEXA 1YITA 1NE8A 3MEUA 3HRUA 5GANh 4PJOF 4A4FA 1Q81U 3CC2T 2XDBA 4IKFA 3J7AF 3GP8A 1X75C 3HHTB 1HXDA 3MP6A 1G5VA 4C92G 3OMCA 4RKUE 2XDDA 4HKEA 3M4GA 3S3MA 1VQ8T 1LOJA 2RJFA 2HBPA 3QXEB 2IG0A 4ZGEB 1Q7YC 4F7UG 2DIQA 3WVEB 4LD6A 4OF1A 2QQSA 2EQMA 2CYZB 1NPRA 2LC4A 1YHQT 1Q81C 4BY6C 4PKCC 4M7AC 4M78G 4LDYA 1WQWA 4FL6A 3HFNA 3CCVT 2DVEA 1VQ7A 3QSUA 2IVWA 5GANd 3QYHB 2E65A 1PSEA 3DB4A 4PNOA 3LWHA 2D6FA 3KUFA 3DB3A 2LX9A 3QHSA 1BKBA 2QQ9A 2K5FA 2QA4T 4HT8A 1Y07A 5GAOl 1VQ9T 2KSSA 5CVIA 1VUBA 2QI2A 2RHUA 2ZZDA 4FSXA 1U1SA 4Y28E 2RK1A 5KE3A 2M9UA 3CC4T 2LRQA 3UPUA 1YIJT 1Y96A 3LH0A 4OB0B 5FU7B 3CCLA 1NZ9A 4C0GA 4HCBA 2ZPEB 3JB9J 1Q86C 4JRIA 3M55A 4BUGA 2HQXA 2Y4YA 2FVUA 3EFRA 4DQ2A 1S72T 4J83A 3X20B 3CC4A 4WF2A 4OGCA 1M90U 1QVFA 2F69A 1KD1U 2AHJB 4FT4A 1QVPA 3OS5A 3CPWS 3RESA 2MAMA 4OMFB 3AHUA 2E12A 2R5AA 3JRZA 2E6NA 3GLXA 3MEWA 1UGPB 3A8MB 4J6XA 2MWOA 2PUKB 3SWNC 4R56A 1G3WA 3MP1A 1Q82U 4O5VA 3FDRA 5CKDA 1M8VA 5FU7C 2CZ1B 3JCMd 1VQ8A 2V8KA 4M7AF 1XTDA 2CGHA 4QQ6A 1KD1C 1B34B 2M1HA 4M7DC 4F7UA 2D9TA 4M78B 1VQ6A 1LNXA 2HNIA 1I81A 3INZA 1WNLA 2WSCE 4C5IA 2EQKA 2V8JA 4JRPA 5GANf 5A0DA 3BW1A 1Q7YU 4M7DD 5FRMA 1M5Q1 4LDUA 4C8QG 2K4YA 3FEOA 2A3LA 4M75B 4OB2B 4ATOA 1G3YA 5LJ5f 3RIRA 1BI2A 2LVMA 2QXFA 4M77A 1VIFA 4L5GA 2X4WA 5CQXA 2ZPIB 2E64A 1ZHIA 2E41A 1R8OB 3FB9A 3QJ6A 3X28B 3O8VA 3CC7T 2WSFE 1VQ5A 2VGNA 3CBPA 4M7DA 1WJRA 1YHQA 1NPPA 3QJYA 2R58A 2GCXA 4M78E 3L2VA 3OYMA 1BYMA 3QIIA 4A4GA 5CKBA 3L42A 3OYIA 2DK3A 2QDYB 4XU3A 2C06A 2XK0A 3Q1JA 3SWNA 5LJ3d 3VV0A 4C8QE 3OYBA 2DO3A 3DLLA 4JS5A 2RM4A 3PIOA 3H8ZA 1K9MU 2KVQG 2RI2A 1H3ZA 2LT4A 3META 1Q86U 4PJOE 2E10A 1YJ9T 4C0FA 4OGEA 2A7YA 1TH7A 2DXTA 5A0LA 3CXCS 2QTXA 3OS2A 5GANe 1QW1A 3QYGB 1LJOA 3R6OA 1VQKT 2RJDA 2DTIA 4BI8B 2I2LA 1UGQB 2EIFA 5FU6C 4N4IA 2EAYA 2DD4A 3JSCA 4BY6B 5KE2A 4NL3A 4M78F 3HFOA 4NL2A 1K9MC 2KDSA 5D6WA 5GAMj 1KHIA 4Q5WA 1MGQA 2Y4XA 4O6JA 2RI5A 4NS5A 2RA2A 3V7SA 5GANg 1P92A 3I56T 4BACA 3RMSA 4C8QB 1G3TA 2X4YA 3CD6A 4M7DE 4M75A 2OTLT 3NTHA 3JCMg 1K73C 4XAXB 3M59A 2EJGA 3E9GA 3QG1A 2PVDB 5GAMf 5I21A 4KUDK 3N5BB 4M77E 2P0PA 2DEQA 4BDZA 4IUVA 4LDWA 3RKXA 3UT1A 3GPLA 1Y71A 3FIFA 1VQ4T 4M78D 4ZGJB 3ER0A 4IUUA 5GAN2 4M7AD 3SFMA 2LCLA 3WXMB 4DOVA 3HKSA 4BI3A 3M4YA 3HSBA 3EFSA 3F70A 1KG1A 2EJFA 3G7ZA 4J7FA 1VQNA 5IAYA 3LLRA 3M5AA 4M7AB 3RKYA 2F5TX 2ZPGB 3OBWA 3V7RA 3QUIA 4RMOA 3ZFJA 1XOVA 4M78A 3ZEHA 3HPWA 4M77B 3OW2S 4ELZC 3HRTA 3G71A 4XTUA 1K8AU 1N9RA 4IUPA 4C5GA 1YJWT 4TVRA 3V8JA 2LTOA 4RG2A 4JRKA 4C0ZA 3HP9A 5C6SA 3MO8A 5LJ5d 2DIGA 5GMKm 2LQKA 3G4ST 2XI9A 1UB4A 1WGSA 4LDVA 3X24B 2RI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWN A;  2CGH A;  1B34 B;  4XQ3 A;  4M7A A;  4M7D C;  4F7U A;  4M7A E;  2EJ9 A;  4M78 B;  4XU0 A;  1BIB A;  1D3B B;  1LNX A;  5GMK i;  2HNI A;  3BDU A;  1I81 A;  3JCM W;  5GMK j;  3INZ A;  4PJO G;  1WNL A;  5GAM h;  5CAI A;  4J6Y A;  4M75 G;  4C92 D;  5GAN f;  3BW1 A;  4M7D D;  5LJ3 e;  1M5Q 1;  5GAN 5;  4C8Q G;  5LJ3 h;  2RD1 A;  5GAN 4;  4M75 B;  4HA8 A;  4N0A C;  5LJ5 f;  3PGG A;  2DXU A;  5LJ5 h;  5GAM e;  2DJZ A;  3FJP A;  4XU1 A;  4C8Q C;  3JCM c;  4M77 A;  4M77 F;  5GAN 8;  5GAO p;  4EMK A;  4RCC A;  4X9C A;  4Y91 A;  3FB9 A;  2E64 A;  2E41 A;  4M75 D;  3BFM A;  5LJ5 j;  4A54 A;  4M7D A;  4C8Q D;  4M78 C;  4C92 F;  4M78 E;  2YLC A;  5GAM g;  3L2Z A;  3JCM b;  5GAM d;  2DTO A;  3RER A;  3VU3 C;  4XTZ A;  4JUV A;  1BIA A;  1Y96 B;  5GMK l;  4XTV A;  4XU3 A;  5DY9 A;  5LJ3 g;  4F7U F;  5LJ5 g;  5GAO m;  3SWN A;  5LJ3 d;  3JB9 I;  4C8Q E;  4PJO C;  2RM4 A;  4NOY A;  1JBM A;  1WPY A;  4JLI A;  4M75 C;  2YLB A;  4J6W A;  4M75 E;  4N0A A;  3JCM e;  3JB9 H;  4C8Q A;  4HT9 A;  4QVD A;  5LJ5 e;  1I4K 1;  4PJO E;  2E10 A;  3JCM h;  4M75 F;  1TH7 A;  4XTX A;  3JCM f;  2DXT A;  4PJO F;  5GMK e;  5GAN h;  2YHT A;  2DZ9 A;  2QTX A;  3L1A A;  1I8F A;  3V8L A;  1LJO A;  4XTW A;  1HXD A;  5GAN e;  5GAN 7;  5GAN 6;  5LJ3 j;  4XU2 A;  4C92 G;  4F7U B;  5GAN 3;  2DTI A;  1D3B A;  3M4G A;  2I2L A;  1U1T A;  3JB9 D;  1LOJ A;  4NL3 A;  2EAY A;  4EMK B;  3JCM V;  5GMK h;  4M78 F;  3HFO A;  4NL2 A;  4F7U G;  5GAM j;  3JCM P;  1MGQ A;  4J5Y A;  4M77 D;  3V7S A;  2RA2 A;  5GAN g;  4PJO A;  1JRI A;  4XTY A;  4C8Q B;  4C92 E;  1B34 A;  4M7A C;  4M75 A;  4M7D E;  4M78 G;  2Y90 A;  3JCM g;  1WQW A;  3HFN A;  2DVE A;  2VC8 A;  4EMG A;  2EJG A;  2FB7 A;  2K57 A;  3QSU A;  4PJO B;  2E65 A;  4PNO A;  4RCB A;  1N9S A;  5GAM f;  5I21 A;  4M77 E;  4A53 A;  4EMH A;  3QHS A;  4HT8 A;  2DEQ A;  4MMK A;  5GAO l;  3RKX A;  3BY7 A;  2VXF A;  5LJ3 f;  2DTH A;  4QVC A;  3GIB A;  4F7U E;  4PJO D;  3FIF A;  4M78 D;  1H64 1;  1U1S A;  5GAO r;  2ZGW A;  2JN0 A;  5GAN 2;  4C92 A;  5GAO q;  4M7A D;  3JB9 F;  4M7D F;  1Y96 A;  2VXE A;  3JB9 G;  3HSB A;  3EFS A;  1I5L A;  2E1H A;  2EJF A;  3JB9 J;  4EMK C;  5GAO n;  4C92 B;  4JRI A;  3RKY A;  4X9D A;  4M7A B;  3EFR A;  4DQ2 A;  4M7D B;  3V7R A;  3V8K A;  3JCM J;  3QUI A;  3JCM Q;  4WF2 A;  3RUX A;  4M78 A;  4M7A G;  3SB2 A;  4M77 B;  2RB6 A;  1HK9 A;  5GAN j;  3RES A;  3QO3 A;  2DZC A;  4MML A;  4XTU A;  3AHU A;  1N9R A;  1WQ7 A;  4OP0 A;  3SWN B;  3V7C A;  4M77 G;  3V8J A;  1KQ1 A;  3RKW A;  4J6X A;  4JRK A;  3SWN C;  4C92 C;  1KQ2 A;  4V2S A;  3JCM X;  1M8V A;  5LJ5 d;  4M77 C;  1X01 A;  2DKG A;  2FYK A;  5GMK m;  4C8Q F;  3JCM d;  3RIR A;  4M7D G;  1YCY A;  4M7A F;  5GAN d; 
#chains in the Genus database with same CATH topology
 1OZ2 A;  3CC2 A;  3UA6 A;  2ECZ A;  4XU0 A;  1YIJ A;  3JCM W;  3LW5 E;  1YBY A;  1GRI A;  5GAM h;  3PIP A;  5KYY A;  3CME A;  5IHI A;  1YI2 A;  1D0X A;  2RN8 A;  4E7L A;  3H41 A;  3CCJ Q;  2L89 A;  1AVZ C;  2OAU A;  2FZG B;  3HL8 A;  2HMA A;  3FJP A;  5GAO p;  3JCM c;  3M9Q A;  1AWX A;  2DYB A;  1K73 U;  1QVF S;  3CBO A;  2O2O A;  3PNW C;  3QZ9 B;  1AEY A;  3OSV A;  1W4S A;  3L2Z A;  3JCM b;  5D6X A;  3GNG A;  1IRX A;  3RER A;  1RUW A;  4XTV A;  2DRM A;  3ME9 A;  5M9O A;  3OA6 A;  2DIL A;  1QP2 A;  2V1R A;  3VS7 A;  1PRM C;  1D1B A;  3UAT A;  2FZC B;  4C8Q A;  5LJ5 e;  3CC7 A;  2YWW A;  1I0C A;  2DM1 A;  1YNZ A;  2J05 A;  2DZ9 A;  3AT1 B;  1Q82 R;  2XIC A;  1K8A C;  1DJ7 B;  1VQL A;  2DMO A;  1YFN A;  1IGQ A;  4C92 E;  1Y57 A;  1KFZ A;  1NYG A;  2E6Z A;  2KK4 A;  2VC8 A;  3MCA B;  5D6Y A;  4ZN3 A;  4C5H A;  1V29 B;  4Y92 A;  5EC7 A;  4EMH A;  5C0M A;  1T3L A;  5CKF A;  2AKK A;  2A28 A;  2V8I A;  1VQM Q;  5FRN A;  5GAO q;  2JTF A;  3OB9 A;  3A8G B;  3LGF A;  5J26 A;  2ZPH B;  4KUL A;  4X9D A;  2O9V A;  3QWY A;  4LDX A;  3JCM Q;  2O9S A;  3MJX A;  1PSF A;  2DBK A;  2L2P A;  3QO3 A;  1GFD A;  4IUR A;  3QBY A;  3C4S A;  1I5O B;  2EQJ A;  3UF4 A;  3TEE A;  1TUG B;  3A8O B;  2EYQ A;  3JCM X;  1JJ2 A;  4AT1 B;  5FWB A;  3RBB B;  2GQV A;  3L2R A;  1UEB A;  4JRQ A;  1SF9 A;  4II1 A;  2DPP B;  1OPK A;  1BIB A;  2DL7 A;  5IH2 A;  1M3A A;  3U23 A;  2E3I A;  5CAI A;  1RAE B;  3A5Z B;  2RD1 A;  2RHI A;  3D7S B;  3URG A;  5HK0 A;  2WAC A;  1G3S A;  4XK8 E;  1VQM A;  3MPU B;  3M56 A;  4CRI A;  4RTT A;  3CCU A;  2YUO A;  3H6Z A;  2O4X A;  5FW9 A;  2RQV A;  1JJ2 S;  5IXB A;  4PJO C;  1AWJ A;  4LD9 K;  3HTR A;  3JCM e;  3MP8 A;  4FM4 B;  2COY A;  2MOX A;  2K5I A;  3JCM h;  1BI3 A;  2J06 A;  2EYX A;  4MDX A;  1YWO A;  2QK0 A;  3V8L A;  5FWC A;  4Z88 A;  5DM7 R;  5J3B A;  1U1T A;  1UG1 A;  3P8B B;  1CSK A;  2F5K A;  2H3J A;  4A4K A;  2EQI A;  3G4S A;  3TU4 K;  3OYK A;  3I9Q A;  2FB7 A;  3CCE Q;  4RCB A;  2V26 A;  3S3O A;  4D8K A;  2OJ2 A;  3T9N A;  1M2V A;  1EIF A;  1TG0 A;  4J8O A;  3A8H B;  1QCF A;  1H64 1;  2CKK A;  1MNE A;  1D1A A;  2CZ6 B;  2JN0 A;  3E9F A;  1OYX A;  2PQW A;  4EMK C;  5GAO n;  3CCJ A;  1VQL T;  4HCZ A;  2JS2 A;  4KBM B;  2ATC B;  5GAN j;  4MML A;  2MI6 A;  1N6A A;  3SWN B;  1WLP B;  1M2O A;  4YTL A;  3CMA A;  2OI3 A;  3C95 A;  2KR3 A;  2KQW A;  4GLM A;  4CC4 B;  1MV0 B;  2KBT A;  3NTI A;  2O88 A;  1ABO A;  4C92 D;  2XMF A;  5HKC A;  1ACM B;  1VYV A;  1M1K C;  5GAN 5;  5LJ3 h;  1HJD A;  3EAE A;  1M1F A;  4EDU A;  4BB7 A;  2RHY A;  3C94 A;  3EG0 A;  3M0R A;  4QQG A;  4BI4 A;  2M02 A;  5FLX E;  2PUO B;  4PFO A;  4ELY C;  1R0B G;  1MMG A;  2X3X D;  1E6H A;  1PD0 A;  4JUV A;  1Y96 B;  5DY9 A;  2K3X A;  1D1C A;  5LJ5 g;  1X43 A;  2DD5 A;  3J80 E;  3I56 A;  1X6O A;  2YLB A;  3OYC A;  3X26 B;  4KRT A;  1NE8 A;  1Q81 U;  1S1N A;  4A4F A;  2JM8 A;  4F04 B;  2FO0 A;  1PHT A;  4C92 G;  2BE9 B;  4HKE A;  1PG5 B;  4LN2 A;  1LOJ A;  2HBP A;  4F7U G;  1QWF A;  4OF1 A;  2QQS A;  2EQM A;  1NPR A;  3VS5 A;  3CCV T;  1WQW A;  4ANJ A;  2H3E B;  1VQ7 A;  2IVW A;  2JMC A;  2HKQ B;  2EYZ A;  3KUF A;  2LX9 A;  1K73 R;  2K5F A;  5GAO l;  1VUB A;  2QI2 A;  2DF6 A;  1N5Z A;  4FSX A;  2M9U A;  3LH0 A;  2F2V A;  4OB0 B;  5FU7 B;  1NZ9 A;  4C0G A;  1RI9 A;  3JB9 J;  2VWF A;  2JJ9 A;  3EFR A;  2FVU A;  3X20 B;  1NYF A;  1ABQ A;  4OGC A;  2F69 A;  2AHJ B;  1QVP A;  3OS5 A;  3CPW S;  4OMF B;  1VQN Q;  2E4H A;  3MEW A;  1Q82 U;  1VQ8 A;  4M4Z A;  1XTD A;  1K76 A;  4QQ6 A;  2PTK A;  4F7U A;  2D9T A;  1VQ6 A;  1JJ2 P;  4C5I A;  4M7D D;  5FRM A;  1M5Q 1;  4LDU A;  1SG5 A;  2A3L A;  3EGD B;  1SSH A;  2FEI A;  5LJ5 f;  2YDL A;  4M77 A;  2E64 A;  1ZHI A;  1R8O B;  3O8V A;  2WSF E;  4M7D A;  1YHQ A;  1NPP A;  4M78 E;  2GCX A;  2EGC A;  2CP5 A;  3QII A;  1NLO C;  2DK3 A;  2ENM A;  2XK0 A;  5LJ3 d;  3OYB A;  1YWP A;  1OQK A;  2RM4 A;  3M0S A;  4PJO E;  3EHQ A;  2EPD A;  2AKL A;  2ROL A;  3CXC S;  2VVK A;  2QTX A;  2RJD A;  2DTI A;  5FU6 C;  4N4I A;  1YIJ Q;  2DD4 A;  1BCO A;  1M1K R;  2J7I A;  3HFO A;  1K9M C;  5D6W A;  4QKU A;  1KHI A;  2KT8 A;  2Y4X A;  4O6J A;  2EGE A;  1K73 C;  3M59 A;  4KH0 B;  3QG1 A;  5GAM f;  5I21 A;  2K2M A;  2QAZ A;  3VS1 A;  2F2X A;  5IHK A;  4IUU A;  2KGT A;  5L23 A;  4BI3 A;  3M4Y A;  1KG1 A;  1BK2 A;  3TQ7 P;  3G7Z A;  1VQN A;  2F5T X;  3OBW A;  3OW2 P;  2LQN A;  1XOV A;  2NUP B;  4ELZ C;  2CP2 A;  1SKU B;  1YJW T;  2DNU A;  2V1Q A;  4RG2 A;  4JRK A;  3KFV A;  3G4S T;  3C12 A;  1M8M A;  5GAN d;  2EWN A;  3OYD A;  1VQ4 Q;  1X6G A;  4ZGD B;  3CEY A;  2DBM A;  5HY6 A;  4RTV A;  5GMK j;  1TWB A;  2AIR B;  1OUL A;  1WJQ A;  1MMD A;  4HA8 A;  5GJV B;  5DLQ E;  1VQ8 T;  1O9S A;  2NLU A;  1KQS P;  1VQN T;  4VUB A;  3OMG A;  4M78 C;  1PCX A;  4D8D A;  1E7O A;  4R0K A;  4BD3 A;  5CR2 A;  1VQP T;  3RNJ A;  2CUB A;  2GF7 A;  1TS9 A;  2DVJ A;  4PJM A;  4F7U F;  2LT1 A;  1WI7 A;  1JB0 E;  3DLM A;  3JB9 H;  4HT9 A;  2MYS A;  1VYU A;  4LUD A;  2OTL A;  1JO8 A;  3E1S A;  2YRV A;  2JXB A;  1HYO A;  5GMK e;  3KBG A;  3L1A A;  1QQJ A;  1I8F A;  4XTW A;  2L3Q A;  3A8L B;  1MUZ A;  1VQ5 Q;  1SHF A;  2O01 E;  1YIT T;  3FC3 A;  3JCM P;  2BZY A;  1Z9Q A;  3OY9 A;  3EH1 A;  3NTK A;  2JM9 A;  2K6D A;  2Y90 A;  2ED1 A;  3FLG A;  1O75 A;  3CMA T;  1GXI E;  2DJQ A;  1RAI B;  4AFZ C;  1K0S A;  4E2F B;  1MHN A;  2XDP A;  2O31 A;  3BY7 A;  4BE2 A;  1D0Y A;  4F7U E;  1TOV A;  2Z0W A;  2I0N A;  3S3N A;  3TSZ A;  1TUC A;  2FPD A;  4DEX A;  2BKD N;  4HCC A;  4FCY A;  2CP7 A;  4C92 B;  4MZP A;  3V8K A;  3JCM J;  2EKH A;  1EFN A;  5HK3 A;  2PZ1 A;  1Q81 R;  2K9G A;  1W6X A;  4FSS A;  1WQ7 A;  4OP0 A;  4ATO A;  3M57 A;  1K9M R;  2CH4 A;  3GNF B;  1UHF A;  2MF2 A;  4OMP A;  4A63 B;  1LCK A;  4WCI A;  4C5E A;  2WSE E;  2AT1 B;  2E70 A;  4C8Q F;  4KGV B;  1YCY A;  4EIK A;  3EG2 A;  3CCV A;  2KRS A;  5CK9 A;  1QVG S;  4E7I A;  1YJN T;  2EJ9 A;  3JAM E;  2YUP A;  2KY9 A;  4M75 G;  3BE3 A;  2DE0 X;  1ZSZ B;  2BIV A;  1VQ5 T;  4F14 A;  4ZTJ A;  1XNI A;  4RCC A;  4Y91 A;  5IN1 A;  1YJN Q;  1R77 A;  1RAD B;  3H9N A;  3P8H A;  3LWI A;  1KC8 U;  3OYJ A;  1UGV A;  3VKI A;  3CME T;  3L2Q A;  4FU6 A;  4Z8A A;  1GBR A;  3PMI A;  3J81 E;  3CC2 Q;  2L8D A;  2JMA A;  3GOX A;  2X9H A;  1WPY A;  4DA4 A;  4M75 F;  4GY5 A;  3CPF A;  3CCS A;  1MV3 A;  5GAN 3;  2FZK B;  5KCO A;  4N4G A;  2CZ0 B;  5GMK h;  1IGU A;  1X27 A;  2EFI A;  2A0F B;  3CCM A;  1VA7 A;  2RJE A;  3UWN A;  4EMG A;  3OYH A;  2OTJ T;  1WZO A;  2K57 A;  2KMT A;  3NPF A;  3VS3 A;  2NUP A;  3CD6 T;  4L59 A;  5LJ3 f;  2JTM A;  4C0D C;  1AOJ A;  1TTH B;  3REB B;  2YUN A;  2ZGW A;  3PVL A;  5A2Q E;  3JB9 F;  2E3H A;  2MCN A;  3H0I A;  2EYY A;  3HRS A;  5ECA A;  3G71 Q;  1PRL C;  1AHJ B;  1ZSZ C;  3CXC P;  4M7A G;  8AT1 B;  2DZC A;  3VUB A;  2HAX A;  2KYM A;  2FHD A;  2ZCF B;  2YUQ A;  1WHM A;  3RKW A;  1G83 A;  2RJC A;  3M53 A;  3H0H A;  1M1K U;  3DKM A;  2IPO B;  1YP5 A;  2VYT A;  1GCP A;  4FIB A;  2OTJ A;  3CC7 Q;  3VUZ A;  1IO6 A;  1K0X A;  2HEQ A;  2KXC A;  2RQR A;  4J6Y A;  2JW4 A;  3FRN A;  2O4X B;  3PMT A;  1OZ3 A;  5KCH A;  4QW2 A;  4AG2 C;  1JU5 C;  3A1P A;  5EG2 A;  4IIM A;  4QQD A;  4E47 A;  4C8Q C;  2B8A A;  2DAQ A;  2JNG A;  2RPN A;  3MHX A;  4A54 A;  3OW2 A;  1VQO T;  1RLP C;  1W2B P;  1LPL A;  2HQH A;  5A0G A;  3NMZ C;  4E7Z A;  1YJW Q;  3JB9 I;  1NJI C;  1Q82 C;  2A36 A;  1FX7 A;  4M7A A;  2RK2 A;  3E2U A;  1WX6 A;  3JV3 A;  2QEX A;  3CC2 T;  5GAN h;  2XDB A;  4HXJ A;  3CME Q;  1M30 A;  2XDD A;  2RJF A;  1T0J A;  2C0O A;  2DIQ A;  1D09 B;  2CYZ B;  4IIO A;  1ZLM A;  1Q81 C;  4M78 G;  2QTV A;  1GCQ C;  1FYN A;  2D6F A;  2BTT A;  3DB3 A;  3QHS A;  1BKB A;  2QQ9 A;  1UFF A;  2KSS A;  5CVI A;  5HCK A;  2RHU A;  5KE3 A;  2RK1 A;  2OAW A;  2CSI A;  3C0C A;  1Q86 C;  1WFW A;  4JRI A;  4DQ2 A;  2HQX A;  2Y4Y A;  1S72 T;  2K79 A;  3CC4 A;  1X6B A;  1H3H A;  1RAA B;  2MAM A;  3NGP A;  3AHU A;  2E12 A;  2E6N A;  4RTU A;  5GJW B;  3GLX A;  1UGP B;  3A8M B;  2MWO A;  1ZUU A;  3MP1 A;  1IHV A;  1PM3 A;  2CGH A;  3M0P A;  2OTJ Q;  2M1H A;  1OU8 A;  4RTZ A;  3INZ A;  3CD6 Q;  3RDV A;  1M2V B;  4CC2 A;  1WHJ A;  2KXD A;  4C8Q G;  4OML A;  3G4S Q;  1BI2 A;  1VIF A;  1KK7 A;  1M3B A;  4L5G A;  5CQX A;  3CC7 T;  2E41 A;  2EBP A;  1JXM A;  1VQ5 A;  2LX7 A;  2BZ8 A;  2DLP A;  5KYW B;  1RAF B;  4XU3 A;  3Q1J A;  3SWN A;  4JS5 A;  4C8Q E;  1NG2 A;  1X2Q A;  5I22 A;  1K9M U;  1B07 A;  2KVQ G;  2RI2 A;  4F17 A;  4JJC A;  2DL5 A;  3GBQ A;  1WHH A;  3R6O A;  1KJW A;  4BI8 B;  2ROT A;  4BY6 B;  3JB9 D;  4NL3 A;  2QGF B;  2CT3 A;  1NBE B;  4B6M A;  1JXO A;  4Q5W A;  4DBF A;  1PKT A;  3I56 Q;  4CC7 A;  3EG9 A;  4RUG A;  3CD6 A;  4M75 A;  3A98 A;  1OV3 A;  4XAX B;  2EJG A;  3O5Z A;  4KUD K;  2LQW A;  4BDZ A;  1VOM A;  2A08 A;  3UT1 A;  2P84 A;  1QKX A;  2KRO A;  4HVV A;  3GPL A;  1KC8 R;  3FIF A;  1VQ4 T;  4M78 D;  1PNJ A;  3ER0 A;  3HKS A;  3SHW A;  3EFS A;  5KYX A;  2DL8 A;  5IAY A;  3M5A A;  3RKY A;  2ZPG B;  3QUI A;  2DX1 A;  4FW2 A;  3ZEH A;  2KEA A;  4ESR A;  3G71 A;  2SEM A;  1WXB A;  4XTU A;  4IUP A;  4C5G A;  3EFO B;  1T0H A;  4HVU A;  4TVR A;  3I35 A;  1UTI A;  3V8J A;  2LTO A;  2X3W D;  2DER A;  1UJ0 A;  1G2B A;  3RIR A;  1WGS A;  3CQT A;  3X24 B;  5CQY A;  4JS4 A;  1D3B B;  2X51 A;  4AFQ C;  4MZT A;  5I2S A;  1YN8 A;  3BDL A;  5LJ3 e;  1S72 A;  3NFC A;  4PLI A;  2GNC A;  1KIK A;  3PGG A;  2DXC A;  3EH2 A;  1AZE A;  1YJN A;  2RHZ A;  3BFM A;  4DEY A;  1SPK A;  1UDL A;  2P4T A;  4C8Q D;  1ZX6 A;  1NEB A;  2DTO A;  1GL5 A;  3VU3 C;  4XTZ A;  1N8R U;  3X25 B;  3CCE A;  2XID A;  3G6E A;  3OQ5 A;  2ZPB B;  2YSQ A;  4J6W A;  3PT9 A;  3QKJ A;  4JLG A;  5KYU A;  1KD1 R;  2P0Q A;  2M0O A;  4BE0 A;  2YHT A;  5FRO A;  1WYX A;  2LP5 A;  1VQP Q;  4F7U B;  1M3C A;  2M51 A;  1ZA2 B;  3R6N A;  2QEX T;  1VQ4 A;  2OTL Q;  3OS0 A;  1YHQ Q;  1FMK A;  3QDR B;  2DL3 A;  1VQ8 Q;  2H8H A;  2XHC A;  5CKH A;  2CP3 A;  4A4E A;  1VQK A;  3VRZ A;  1VQ6 Q;  1ARK A;  2HDA A;  3UDC A;  4QVC A;  2RO0 A;  1VQ7 T;  2QG9 B;  1YJ9 A;  1VIE A;  4J9B A;  1JQQ A;  4C92 A;  4KUI A;  1SRM A;  3M58 A;  3OYG A;  2JVV A;  3IQL A;  4FW1 A;  1W70 A;  1BI1 A;  3SB2 A;  4E7H A;  4KT0 E;  3V7C A;  5AYF A;  2HZY A;  1WHK A;  1KQ1 A;  5CO7 A;  4DOW A;  1X01 A;  3LX7 A;  2FYK A;  4QT7 A;  1ZQ1 A;  2RQU A;  3MKD A;  3PFS A;  4X1V A;  4L6V 5;  2L0A A;  2L5Q A;  1D0Z A;  2LCS A;  2R57 A;  1VQP A;  1KC8 C;  4X34 A;  3CCR T;  5GAN 4;  2DYI A;  2GGR A;  1VQK Q;  5CKE A;  4N0A C;  4A4H A;  5LJ5 h;  1FWZ A;  2M16 A;  2DFU A;  1YCS B;  2D1X A;  4Z02 A;  5LJ5 j;  1YJ9 Q;  2COW A;  2MWP A;  1OOT A;  2XG8 D;  5GAM d;  3TCJ A;  2ABL A;  1UEC A;  1RLQ C;  2DA9 A;  2NWM A;  5FU6 B;  3TRE A;  4JLI A;  1RL2 A;  4M75 E;  4M75 C;  4N0A A;  1I4K 1;  3G1J A;  1M4Z A;  1N27 A;  1M90 C;  2L3S A;  1K8A R;  5GAN 6;  4XU2 A;  3UA7 A;  3CCE T;  3CCS T;  3JCM V;  2K3Y A;  1IB8 A;  1J3T A;  1QCO A;  2E5Q A;  2YT6 A;  4PL6 A;  1B34 A;  3OYF A;  4DBR A;  2VKN A;  2QYZ A;  3PTA A;  2PU9 B;  4PJO B;  1NM7 A;  3LGL A;  1M1G A;  2VXF A;  1B7T A;  2DTH A;  4MDW A;  2LDM A;  4J9C A;  1UUE A;  1NEG A;  4PJN A;  4R55 A;  4OMN A;  1EZZ B;  2QQA A;  2XU8 A;  4FYW B;  1NJI R;  2VXE A;  1PC0 A;  1I5L A;  4OMQ A;  3OS1 A;  2EYW A;  2PNI A;  2OX7 A;  1E6G A;  2JUF A;  3EGU A;  3CC4 Q;  2RH2 A;  4LXC A;  4M77 G;  1ZBX A;  2VUB A;  3CCU T;  2LCC A;  3LH5 A;  4JJD A;  2DKG A;  1U5S A;  1KQS S;  2L3R A;  5DLO A;  4JJN K;  1QVG A;  2G6F X;  4LUE A;  3OYN A;  3EGD A;  1EX4 A;  3OYA A;  2FL7 A;  1KQS A;  4E7K A;  4PLL A;  2R5M A;  4EMK A;  2W0Z A;  4X9C A;  5KYU B;  3ZBD A;  1RI0 A;  2YLC A;  2NUT B;  3KXT A;  1TU0 B;  2VV5 A;  2EKO A;  4ZTF A;  2ZAE A;  1BIA A;  4BDY A;  2KYB A;  5GAO m;  3TVT A;  1BI0 A;  1ZSG A;  2CSQ A;  3VRY A;  2HSP A;  5L8R E;  1VQM T;  3MEV A;  3CXC A;  3MEU A;  2P4R A;  3HRU A;  4PJO F;  1X2K A;  2MPX C;  3GP8 A;  1X75 C;  1G5V A;  3OMC A;  4RKU E;  3S3M A;  3QXE B;  1TUD A;  2BZX A;  1U3O A;  3WVE B;  4LD6 A;  2GTJ A;  2AK5 A;  2LNH B;  4PKC C;  4FL6 A;  4PK4 A;  3CCS Q;  1PSE A;  3DB4 A;  3CCV Q;  3VS2 A;  2QA4 T;  4HT8 A;  2AZS A;  2W10 A;  1UHC A;  2CT4 A;  4Y28 E;  1YIJ T;  3UPU A;  1IHW A;  1Y96 A;  1N8R R;  4F16 A;  2F1L A;  2HCK A;  2HKN A;  3M55 A;  4BUG A;  1RAC B;  1UJY A;  1M90 U;  2J6K A;  1CKA A;  1KD1 U;  3RES A;  3JRZ A;  2R5A A;  1VQL Q;  2KRN A;  1RAH B;  4J9E A;  1Z9Z A;  2L3P A;  3EG1 A;  4J6X A;  3SWN C;  2CUD A;  2PUK B;  1RAG B;  1G3W A;  1KSW A;  2MK5 A;  3CCR Q;  4M7A F;  3RR6 A;  4HVW A;  4M78 B;  1H8K A;  1LNX A;  2LJ1 A;  1WNL A;  2WSC E;  3G6E Q;  2CRE A;  2LJ3 A;  4JZ3 A;  4JRP A;  3BW1 A;  1Q7Y U;  2K4Y A;  3FEO A;  2RQW A;  1QMC A;  2YXY A;  1G3Y A;  2LVM A;  2QXF A;  2IIM A;  3QJ6 A;  1V1C A;  1YIT Q;  3CCM Q;  3CBP A;  1I1J A;  1BCM A;  2R58 A;  3QJY A;  5KYY B;  1BYM A;  2DET A;  4A4G A;  5CKB A;  3OYI A;  3CPW P;  2QDY B;  3DLL A;  2DO3 A;  3PIO A;  2AZV A;  4DBH A;  1C1A A;  4PFZ A;  1H3Z A;  3MET A;  4OMO A;  1Q86 U;  4C0F A;  2A7Y A;  1TH7 A;  4J9G A;  3OS2 A;  5GAN e;  1QW1 A;  1LJO A;  4KH1 B;  1UGQ B;  2EIF A;  2EAY A;  4J9H A;  4M78 F;  9ATC B;  5GAM j;  1MMA A;  2RI5 A;  3V7S A;  2RA2 A;  5GAN g;  2QDL A;  4C8Q B;  2X4Y A;  4JPB W;  2OTL T;  3NTH A;  3JCM g;  2QEX Q;  3E9G A;  2KNB B;  3FJ5 A;  2NYS A;  4JJB A;  2DL4 A;  3RKX A;  2LJ0 A;  3CCU Q;  1AT1 B;  1LVK A;  2RQT A;  5KYX B;  4AG1 C;  5D7U A;  3SFM A;  2LCL A;  3WXM B;  3EHR A;  3VS0 A;  4M7A B;  4RMO A;  1QCN A;  3OW2 S;  3HRT A;  1K8A U;  4C0Z A;  5C6S A;  1ZBJ A;  2DIG A;  2LQK A;  2XI9 A;  4D6W A;  2RI3 A;  1YJW A;  3WVD B;  4XQ3 A;  2RNA A;  3QDF A;  3BDU A;  1ZSZ A;  2G3R A;  2HL5 C;  1QP3 A;  1C0M A;  1MND A;  4AMC A;  3OBY A;  2FPE A;  4XU1 A;  1VQO A;  5GAN 8;  1NJI U;  1ZUK A;  5IT9 E;  4B9W A;  2GFU A;  3I5R A;  2JT4 A;  1A0N B;  2RF0 A;  2RHX A;  5GMK l;  3PE0 A;  5LJ3 g;  4EPC A;  1M9S A;  4NOY A;  1WJS A;  2A37 A;  3EG9 B;  1GBQ A;  2EW3 A;  2M0Y A;  3CBM A;  3S6W A;  4PJL A;  1Q95 G;  3QZ5 B;  4XTX A;  3JCM f;  2CP6 A;  2K2V A;  5GAN 7;  1QLY A;  4HCK A;  5KYN A;  5IHN A;  3CCJ T;  5I11 A;  2CS7 A;  4E7J A;  4GLK A;  1XJW B;  4Z89 A;  2NUZ A;  4J5Y A;  4M77 D;  3OYE A;  4WTO B;  1JRI A;  4XTY A;  2JOY A;  3OSS C;  1BB9 A;  1C6V X;  2J6O A;  2P0K A;  2XKO C;  3CMA Q;  1UGR B;  2HD0 A;  3E19 A;  1N9S A;  4IUT A;  4RTW A;  4A53 A;  2QQR A;  1HSQ A;  2HL3 A;  3GIB A;  4E6R A;  1Y7X A;  1ZUY A;  5KYW A;  1TXQ A;  4M7D F;  2QAS A;  1SHG A;  3VYG A;  3CPW A;  1WHL A;  4P5N A;  2DXB A;  2EVR A;  3I5S A;  1GCQ A;  4RTY A;  3RUX A;  3CCL T;  4RG8 A;  2KAF A;  1HK9 A;  3CCM T;  5J39 A;  2ZPF B;  3VYH B;  3OYL A;  1YI2 Q;  2MMP A;  1PWT A;  4C92 C;  1KQ2 A;  1VQ6 T;  4V2S A;  4M77 C;  4M7D G;  4B9X A;  3ASK A;  2GTO A;  2CDT A;  3P8D A;  5GMK i;  3CCR A;  2LNV A;  3I55 T;  2D8H A;  2VGM A;  2GFA A;  4ME7 A;  4OVA A;  4RTX A;  1SSF A;  3EG3 A;  3SDZ A;  1KHC A;  2GQI A;  2DXU A;  2DJZ A;  2HBW A;  4K11 A;  5LL6 S;  1FXX A;  1ZA1 B;  2BUD A;  2YRC A;  4CC3 A;  3VJP A;  4C92 F;  1K1Z A;  2KI7 A;  1M90 R;  2JTE A;  2PVO B;  3PVQ A;  1WHG A;  3OYY A;  2LMJ A;  3M0T A;  4CI0 C;  2FRY A;  2KT1 A;  2YRD A;  1JBM A;  1OI1 A;  5GAO r;  4QVD A;  3SEM A;  4LNP A;  4J9F A;  2B86 A;  4IUQ A;  4OB1 B;  5LJ3 j;  2D0Q B;  1D3B A;  1M27 C;  2KRM A;  3L2W A;  4EMK B;  4KGZ B;  1VQ9 A;  1JEG A;  1VYT A;  2C0I A;  4UC4 A;  2X4X A;  1B3Q A;  1AZG B;  4J7I A;  1FMW A;  1Q7Y R;  4PJO A;  2CZ7 B;  4BE1 A;  3ULR B;  1PKS A;  4E7S A;  3G6E T;  4MMK A;  4AFS C;  4PJO D;  1TSF A;  3QPH A;  3I55 A;  3RMQ A;  1W2B A;  1XQH A;  1IXD A;  2E1H A;  3VS4 A;  4M7D B;  3LYI A;  2JZ2 A;  2F2W A;  3SD4 A;  1Q86 R;  2X4J A;  1VQO Q;  2CH4 W;  2RB6 A;  2E5K A;  1IZ6 A;  5KH6 A;  4DBQ A;  1AWO A;  4C0D B;  3MEA A;  4ZN1 A;  1GFC A;  5AT1 B;  7AT1 B;  2QA4 A;  2K5L A;  1SEM A;  2EGA A;  4OB3 B;  2LQ8 A;  4M7A E;  3GF5 A;  1V76 A;  2C0T A;  1VQ9 Q;  4PJO G;  1QVG P;  1UE9 A;  5CCA A;  1W2B S;  1UGS B;  4N4H A;  2EQU A;  5IXF A;  3L2U A;  2XD0 A;  1IRE B;  4JZ4 A;  1OEB A;  1U8R A;  1N8R C;  5GAM e;  4M77 F;  1G8X A;  1YI2 T;  1OPL A;  2X35 A;  4M75 D;  4KGX B;  3CCL Q;  4FT2 A;  4JDS A;  5GAM g;  2SRC A;  2QQB A;  3ZL7 C;  5CIU A;  3G71 T;  2PVG B;  3CCQ T;  1NLP C;  3REA B;  1K4U S;  3M54 A;  4QVZ A;  3JB9 G;  5I2M A;  1OX9 A;  1OU9 A;  1WXT A;  1OX8 A;  3CCQ A;  4MZM A;  1YIT A;  2HQE A;  1WDX A;  4IKF A;  2ED0 A;  3J7A F;  2K7A A;  4OMM A;  3HHT B;  1HXD A;  3MP6 A;  2JS0 A;  6AT1 B;  3M4G A;  4ZGE B;  2IG0 A;  1Q7Y C;  1SRL A;  2LC4 A;  1YHQ T;  1T3S A;  4BY6 C;  4M7A C;  2VB6 A;  4LDY A;  3HFN A;  2DVE A;  3QSU A;  3QYH B;  4ZNX A;  2E65 A;  1PD1 A;  4PNO A;  1Y0M A;  4GBQ A;  3LWH A;  1Y07 A;  1VQ9 T;  2D8J A;  3M0Q A;  2ZZD A;  4FYX B;  1U1S A;  2J6F A;  3CC4 T;  2LRQ A;  4FYV B;  4J9I A;  4HCB A;  3CCL A;  2ZPE B;  8ATC B;  1U06 A;  4J9D A;  3VS6 A;  4J83 A;  3M0U A;  2KE9 A;  1S72 Q;  4WF2 A;  1QVF A;  3EFO A;  4FT4 A;  2LZ6 B;  1AD5 A;  1FMV A;  3CCQ Q;  4R56 A;  2CP0 A;  4O5V A;  3FDR A;  5CKD A;  2QA4 Q;  1M8V A;  5FU7 C;  2CZ1 B;  3JCM d;  1I07 A;  3QWX X;  2V8K A;  2DEU A;  1KD1 C;  3NHN A;  1B34 B;  2RMO A;  4M7D C;  1HD3 A;  1BU1 A;  2HNI A;  1I81 A;  2EQK A;  2NUT A;  2V8J A;  5GAN f;  5A0D A;  4M75 B;  4OB2 B;  2FG0 A;  1K9A A;  2X4W A;  1WA7 A;  2ZPI B;  3FB9 A;  3X28 B;  2VGN A;  1WJR A;  3L2V A;  1R0C B;  3OYM A;  2QGG A;  3L42 A;  2C06 A;  3VV0 A;  3H0F A;  3H8Z A;  2BE7 D;  2COZ A;  2VAS A;  4LE9 A;  2LT4 A;  2E10 A;  1YJ9 T;  4OGE A;  1VQ7 Q;  2DXT A;  5A0L A;  1MMN A;  3QYG B;  1VQK T;  1QVF P;  2I2L A;  5KE2 A;  3JSC A;  1RAB B;  2FRW A;  4NL2 A;  2KDS A;  1MGQ A;  4FYY B;  4NS5 A;  3I56 T;  2K3B A;  1P92 A;  4BAC A;  3RMS A;  1X69 A;  1G3T A;  2ESW A;  4M7D E;  3EGX A;  3THK A;  2PVD B;  3N5B B;  4M77 E;  2FPF A;  1F1B B;  2P0P A;  2DEQ A;  4IUV A;  1QWE A;  4LDW A;  3I55 Q;  1W1F A;  4ORZ A;  2MIO A;  1Y71 A;  4ZGJ B;  5GAN 2;  4M7A D;  4DOV A;  1QKW A;  3HSB A;  3F70 A;  2GBQ A;  2EJF A;  4J7F A;  3LLR A;  3V7R A;  4PFP A;  4PJJ A;  1WIE A;  3ZFJ A;  4M78 A;  2HSE B;  3HPW A;  4M77 B;  2DRK A;  1CKB A;  1N9R A;  2D0N A;  3TSW A;  1AWW A;  3EGX B;  3HP9 A;  1WXU A;  4AFU C;  3MO8 A;  5LJ5 d;  5GMK m;  1UB4 A;  1H92 A;  1BBZ A;  4LDV A; 
#chains in the Genus database with same CATH homology
 2EWN A;  1OZ2 A;  3OYD A;  1YJW A;  3CC2 A;  3WVD B;  5CQY A;  4XQ3 A;  4JS4 A;  4ZGD B;  4XU0 A;  3CEY A;  1D3B B;  1YIJ A;  3BDU A;  5HY6 A;  3JCM W;  3LW5 E;  5GMK j;  1YBY A;  2G3R A;  4MZT A;  5GAM h;  3PIP A;  3CME A;  5I2S A;  1WJQ A;  1YI2 A;  3BDL A;  5LJ3 e;  1QP3 A;  1S72 A;  4E7L A;  2L89 A;  3NFC A;  2OAU A;  1M1K C;  4PLI A;  4HA8 A;  3HL8 A;  3OBY A;  3PGG A;  5DLQ E;  3JB9 D;  3FJP A;  4XU1 A;  5GAO p;  2DXC A;  3JCM c;  5GAN 8;  1VQO A;  1O9S A;  3M9Q A;  1NJI U;  2NLU A;  1K73 U;  1VQN T;  1QVF S;  1YJN A;  5IT9 E;  2RHZ A;  4VUB A;  3OMG A;  3BFM A;  3CBO A;  2P4T A;  4B9W A;  3PNW C;  4C8Q D;  2GFU A;  3QZ9 B;  4M78 C;  3OSV A;  4BD3 A;  5CR2 A;  1VQP T;  1W4S A;  3L2Z A;  3JCM b;  5D6X A;  2DTO A;  3GNG A;  3VU3 C;  3RER A;  2GF7 A;  4XTZ A;  1N8R U;  3X25 B;  3CCE A;  2RHX A;  5GMK l;  4XTV A;  5M9O A;  3ME9 A;  5LJ3 g;  4F7U F;  2LT1 A;  2XID A;  4EPC A;  3OQ5 A;  3OA6 A;  3G6E A;  1JB0 E;  1M9S A;  1QP2 A;  2ZPB B;  3DLM A;  4NOY A;  1WJS A;  3JB9 H;  4J6W A;  3PT9 A;  4C8Q A;  3QKJ A;  4JLG A;  5LJ5 e;  3CC7 A;  4HT9 A;  3CBM A;  3S6W A;  2OTL A;  3E1S A;  2P0Q A;  2M0O A;  2YRV A;  3QZ5 B;  4XTX A;  3KBG A;  3JCM f;  5GMK e;  4BE0 A;  2YHT A;  5FRO A;  2DZ9 A;  2K2V A;  3L1A A;  1I8F A;  5GAN 7;  4XTW A;  4F7U B;  3A8L B;  2XIC A;  3CCJ T;  1K8A C;  2O01 E;  1YIT T;  2CS7 A;  2QEX T;  4E7J A;  4GLK A;  3FC3 A;  1DJ7 B;  1VQL A;  1VQ4 A;  3JCM P;  4J5Y A;  3OS0 A;  4M77 D;  3OY9 A;  3OYE A;  3QDR B;  1JRI A;  4XTY A;  2JOY A;  4C92 E;  3OSS C;  3NTK A;  2Y90 A;  2P0K A;  1O75 A;  2E6Z A;  2KK4 A;  2XHC A;  2VC8 A;  3FLG A;  3MCA B;  5CKH A;  2XKO C;  1V29 B;  5D6Y A;  4C5H A;  4ZN3 A;  1UGR B;  2HD0 A;  3E19 A;  1N9S A;  4IUT A;  4A4E A;  1GXI E;  4A53 A;  4EMH A;  1VQK A;  1MHN A;  2QQR A;  2XDP A;  5C0M A;  3BY7 A;  3UDC A;  4BE2 A;  4QVC A;  2RO0 A;  5CKF A;  4F7U E;  1VQ7 T;  3GIB A;  1Y7X A;  2V8I A;  1YJ9 A;  1VIE A;  5FRN A;  5GAO q;  3S3N A;  2JTF A;  4C92 A;  4KUI A;  3M58 A;  3OYG A;  4M7D F;  3OB9 A;  2JVV A;  3A8G B;  3LGF A;  5J26 A;  2ZPH B;  2BKD N;  3VYG A;  3CPW A;  4HCC A;  4KUL A;  4P5N A;  2DXB A;  4C92 B;  4X9D A;  4MZP A;  3V8K A;  3JCM J;  4LDX A;  3JCM Q;  3RUX A;  1BI1 A;  1PSF A;  3CCL T;  4RG8 A;  3SB2 A;  2KAF A;  4E7H A;  1HK9 A;  5HK3 A;  3CCM T;  3QO3 A;  4KT0 E;  4IUR A;  1WQ7 A;  3QBY A;  3C4S A;  4OP0 A;  3M57 A;  2ZPF B;  5AYF A;  2EQJ A;  3V7C A;  3VYH B;  3TEE A;  3OYL A;  2MMP A;  1KQ1 A;  3A8O B;  3GNF B;  5CO7 A;  2MF2 A;  4C92 C;  1KQ2 A;  2EYQ A;  4DOW A;  1VQ6 T;  4V2S A;  3JCM X;  4M77 C;  2WSE E;  1X01 A;  3LX7 A;  2E70 A;  2FYK A;  4C5E A;  4C8Q F;  1JJ2 A;  4M7D G;  2GQV A;  1ZQ1 A;  1YCY A;  3L2R A;  1UEB A;  4B9X A;  3CCV A;  3ASK A;  4JRQ A;  3PFS A;  5CK9 A;  2XD0 A;  4II1 A;  2DPP B;  4L6V 5;  1QVG S;  4E7I A;  1YJN T;  3P8D A;  2EJ9 A;  5GMK i;  3CCR A;  1BIB A;  2L5Q A;  2LNV A;  3I55 T;  3JAM E;  2KY9 A;  2R57 A;  2GFA A;  2VGM A;  4ME7 A;  5CAI A;  1VQP A;  4OVA A;  1KC8 C;  4M75 G;  3A5Z B;  1SSF A;  4X34 A;  3CCR T;  2BIV A;  5GAN 4;  2RD1 A;  3SDZ A;  4ZTJ A;  1KHC A;  1VQ5 T;  5CKE A;  4N0A C;  2DXU A;  4A4H A;  5LJ5 h;  2DJZ A;  1XNI A;  2RHI A;  1FWZ A;  2M16 A;  3URG A;  4RCC A;  5LL6 S;  1FXX A;  4Y91 A;  5IN1 A;  5HK0 A;  2BUD A;  3P8H A;  2WAC A;  1G3S A;  4XK8 E;  4Z02 A;  5LJ5 j;  1VQM A;  2MWP A;  3LWI A;  3M56 A;  1KC8 U;  4CRI A;  3OYJ A;  3VJP A;  3CCU A;  4C92 F;  3VKI A;  3H6Z A;  2XG8 D;  3CME T;  3L2Q A;  4FU6 A;  3TCJ A;  5GAM d;  2O4X A;  3PMI A;  2PVO B;  3J81 E;  4D6W A;  3OYY A;  2L8D A;  1JJ2 S;  3GOX A;  5FU6 B;  4CI0 C;  4PJO C;  3TRE A;  5GAO r;  1JBM A;  1OI1 A;  1WPY A;  1RL2 A;  4JLI A;  4M75 E;  4M75 C;  4N0A A;  3JCM e;  4DA4 A;  3MP8 A;  4FM4 B;  1I4K 1;  4QVD A;  5J39 A;  2K5I A;  3JCM h;  4M75 F;  1BI3 A;  4GY5 A;  1M4Z A;  1N27 A;  3CPF A;  3CCS A;  4IUQ A;  1M90 C;  4MDX A;  4OB1 B;  3V8L A;  5DM7 R;  5GAN 6;  5LJ3 j;  2D0Q B;  4XU2 A;  5GAN 3;  5J3B A;  1D3B A;  1U1T A;  5KCO A;  4N4G A;  1VQ9 A;  3L2W A;  2CZ0 B;  4EMK B;  3CCE T;  3CCS T;  3JCM V;  5GMK h;  2K3Y A;  3P8B B;  4J7I A;  2F5K A;  2X4X A;  4UC4 A;  2H3J A;  2EFI A;  3C12 A;  4PJO A;  2E5Q A;  4A4K A;  3CCM A;  2CZ7 B;  3G4S A;  3TU4 K;  4PL6 A;  1B34 A;  3OYF A;  4BE1 A;  3OYK A;  2RJE A;  3UWN A;  2PU9 B;  4EMG A;  3OYH A;  3PTA A;  2FB7 A;  2K57 A;  2OTJ T;  4PJO B;  4RCB A;  2KMT A;  3S3O A;  3G6E T;  3LGL A;  1M1G A;  3CD6 T;  4MMK A;  3T9N A;  2VXF A;  4L59 A;  5LJ3 f;  2DTH A;  2JTM A;  1EIF A;  4MDW A;  2LDM A;  4J8O A;  3A8H B;  4C0D C;  3CMA T;  4PJO D;  4R55 A;  1H64 1;  2CKK A;  2CZ6 B;  2JN0 A;  2QQA A;  2XU8 A;  2ZGW A;  3E9F A;  3QPH A;  5A2Q E;  3I55 A;  3JB9 F;  3RMQ A;  1W2B A;  1OYX A;  1XQH A;  2VXE A;  2PQW A;  1I5L A;  2E1H A;  4EMK C;  5GAO n;  3OS1 A;  4M7D B;  3CCJ A;  3HRS A;  3LYI A;  2JZ2 A;  1VQL T;  3SD4 A;  1AHJ B;  2JUF A;  2X4J A;  4HCZ A;  4M7A G;  4LD9 K;  4KBM B;  5GAN j;  2RB6 A;  5KH6 A;  1IZ6 A;  2DZC A;  4MML A;  2MI6 A;  3VUB A;  1N6A A;  2RH2 A;  3SWN B;  2HAX A;  4C0D B;  4M77 G;  2FHD A;  2ZCF B;  3MEA A;  4YTL A;  4ZN1 A;  1ZBX A;  3RKW A;  3CMA A;  2VUB A;  3CCU T;  2LCC A;  2RJC A;  3M53 A;  1M1K U;  3C95 A;  3DKM A;  2QA4 A;  2DKG A;  2K5L A;  2VYT A;  1KQS S;  2L3R A;  5DLO A;  4JJN K;  4OB3 B;  4FIB A;  2KQW A;  2OTJ A;  1QVG A;  2LQ8 A;  3VUZ A;  4M7A E;  3GF5 A;  3OYN A;  3NTI A;  4PJO G;  4J6Y A;  4C92 D;  5CCA A;  1W2B S;  3FRN A;  2O4X B;  5HKC A;  3OYA A;  1UGS B;  3PMT A;  4N4H A;  2EQU A;  2FL7 A;  1OZ3 A;  5GAN 5;  1IRE B;  5KCH A;  3L2U A;  4QW2 A;  4E7K A;  1KQS A;  5LJ3 h;  4PLL A;  5EG2 A;  3EAE A;  1U8R A;  1N8R C;  4QQD A;  4E47 A;  5GAM e;  2R5M A;  1M1F A;  4C8Q C;  4EDU A;  4M77 F;  4BB7 A;  4EMK A;  1YI2 T;  4X9C A;  2RHY A;  2B8A A;  2DAQ A;  2JNG A;  2X35 A;  3C94 A;  3MHX A;  4M75 D;  4QQG A;  4BI4 A;  4A54 A;  5FLX E;  2PUO B;  4ELY C;  3ZBD A;  3OW2 A;  1RI0 A;  4FT2 A;  1VQO T;  2YLC A;  4JDS A;  5GAM g;  2QQB A;  3KXT A;  5CIU A;  3G71 T;  2VV5 A;  2EKO A;  2PVG B;  5A0G A;  4ZTF A;  4JUV A;  1BIA A;  1Y96 B;  3CCQ T;  5DY9 A;  2K3X A;  3JB9 I;  4BDY A;  5GAO m;  5LJ5 g;  1BI0 A;  1NJI C;  1Q82 C;  2DD5 A;  1FX7 A;  3M54 A;  4QVZ A;  5I2M A;  3J80 E;  3I56 A;  1X6O A;  2YLB A;  2RK2 A;  3OYC A;  3JB9 G;  4M7A A;  3X26 B;  5L8R E;  1VQM T;  3MEV A;  4MZM A;  3CXC A;  3CCQ A;  2HQE A;  2QEX A;  1YIT A;  1NE8 A;  3MEU A;  3HRU A;  5GAN h;  4PJO F;  4A4F A;  1Q81 U;  3CC2 T;  2XDB A;  4IKF A;  3J7A F;  3GP8 A;  1X75 C;  3HHT B;  1HXD A;  3MP6 A;  1G5V A;  4C92 G;  3OMC A;  4RKU E;  2XDD A;  4HKE A;  3M4G A;  3S3M A;  1VQ8 T;  1LOJ A;  2RJF A;  2HBP A;  3QXE B;  2IG0 A;  4ZGE B;  1Q7Y C;  4F7U G;  2DIQ A;  3WVE B;  4LD6 A;  4OF1 A;  2QQS A;  2EQM A;  2CYZ B;  1NPR A;  2LC4 A;  1YHQ T;  1Q81 C;  4BY6 C;  4PKC C;  4M7A C;  4M78 G;  4LDY A;  1WQW A;  4FL6 A;  3HFN A;  3CCV T;  2DVE A;  1VQ7 A;  3QSU A;  2IVW A;  5GAN d;  3QYH B;  2E65 A;  1PSE A;  3DB4 A;  4PNO A;  3LWH A;  2D6F A;  3KUF A;  3DB3 A;  2LX9 A;  3QHS A;  1BKB A;  2QQ9 A;  2K5F A;  2QA4 T;  4HT8 A;  1Y07 A;  5GAO l;  1VQ9 T;  2KSS A;  5CVI A;  1VUB A;  2QI2 A;  2RHU A;  2ZZD A;  4FSX A;  1U1S A;  4Y28 E;  2RK1 A;  5KE3 A;  2M9U A;  3CC4 T;  2LRQ A;  3UPU A;  1YIJ T;  1Y96 A;  3LH0 A;  4OB0 B;  5FU7 B;  3CCL A;  1NZ9 A;  4C0G A;  4HCB A;  2ZPE B;  3JB9 J;  1Q86 C;  4JRI A;  3M55 A;  4BUG A;  2HQX A;  2Y4Y A;  2FVU A;  3EFR A;  4DQ2 A;  1S72 T;  4J83 A;  3X20 B;  3CC4 A;  4WF2 A;  4OGC A;  1M90 U;  1QVF A;  2F69 A;  1KD1 U;  2AHJ B;  4FT4 A;  1QVP A;  3OS5 A;  3CPW S;  3RES A;  2MAM A;  4OMF B;  3AHU A;  2E12 A;  2R5A A;  3JRZ A;  2E6N A;  3GLX A;  3MEW A;  1UGP B;  3A8M B;  4J6X A;  2MWO A;  2PUK B;  3SWN C;  4R56 A;  1G3W A;  3MP1 A;  1Q82 U;  4O5V A;  3FDR A;  5CKD A;  1M8V A;  5FU7 C;  2CZ1 B;  3JCM d;  1VQ8 A;  2V8K A;  4M7A F;  1XTD A;  2CGH A;  4QQ6 A;  1KD1 C;  1B34 B;  2M1H A;  4M7D C;  4F7U A;  2D9T A;  4M78 B;  1VQ6 A;  1LNX A;  2HNI A;  1I81 A;  3INZ A;  1WNL A;  2WSC E;  4C5I A;  2EQK A;  2V8J A;  4JRP A;  5GAN f;  5A0D A;  3BW1 A;  1Q7Y U;  4M7D D;  5FRM A;  1M5Q 1;  4LDU A;  4C8Q G;  2K4Y A;  3FEO A;  2A3L A;  4M75 B;  4OB2 B;  4ATO A;  1G3Y A;  5LJ5 f;  3RIR A;  1BI2 A;  2LVM A;  2QXF A;  4M77 A;  1VIF A;  4L5G A;  2X4W A;  5CQX A;  2ZPI B;  2E64 A;  1ZHI A;  2E41 A;  1R8O B;  3FB9 A;  3QJ6 A;  3X28 B;  3O8V A;  3CC7 T;  2WSF E;  1VQ5 A;  2VGN A;  3CBP A;  4M7D A;  1WJR A;  1YHQ A;  1NPP A;  3QJY A;  2R58 A;  2GCX A;  4M78 E;  3L2V A;  3OYM A;  1BYM A;  3QII A;  4A4G A;  5CKB A;  3L42 A;  3OYI A;  2DK3 A;  2QDY B;  4XU3 A;  2C06 A;  2XK0 A;  3Q1J A;  3SWN A;  5LJ3 d;  3VV0 A;  4C8Q E;  3OYB A;  2DO3 A;  3DLL A;  4JS5 A;  2RM4 A;  3PIO A;  3H8Z A;  1K9M U;  2KVQ G;  2RI2 A;  1H3Z A;  2LT4 A;  3MET A;  1Q86 U;  4PJO E;  2E10 A;  1YJ9 T;  4C0F A;  4OGE A;  2A7Y A;  1TH7 A;  2DXT A;  5A0L A;  3CXC S;  2QTX A;  3OS2 A;  5GAN e;  1QW1 A;  3QYG B;  1LJO A;  3R6O A;  1VQK T;  2RJD A;  2DTI A;  4BI8 B;  2I2L A;  1UGQ B;  2EIF A;  5FU6 C;  4N4I A;  2EAY A;  2DD4 A;  3JSC A;  4BY6 B;  5KE2 A;  4NL3 A;  4M78 F;  3HFO A;  4NL2 A;  1K9M C;  2KDS A;  5D6W A;  5GAM j;  1KHI A;  4Q5W A;  1MGQ A;  2Y4X A;  4O6J A;  2RI5 A;  4NS5 A;  2RA2 A;  3V7S A;  5GAN g;  1P92 A;  3I56 T;  4BAC A;  3RMS A;  4C8Q B;  1G3T A;  2X4Y A;  3CD6 A;  4M7D E;  4M75 A;  2OTL T;  3NTH A;  3JCM g;  1K73 C;  4XAX B;  3M59 A;  2EJG A;  3E9G A;  3QG1 A;  2PVD B;  5GAM f;  5I21 A;  4KUD K;  3N5B B;  4M77 E;  2P0P A;  2DEQ A;  4BDZ A;  4IUV A;  4LDW A;  3RKX A;  3UT1 A;  3GPL A;  1Y71 A;  3FIF A;  1VQ4 T;  4M78 D;  4ZGJ B;  3ER0 A;  4IUU A;  5GAN 2;  4M7A D;  3SFM A;  2LCL A;  3WXM B;  4DOV A;  3HKS A;  4BI3 A;  3M4Y A;  3HSB A;  3EFS A;  3F70 A;  1KG1 A;  2EJF A;  3G7Z A;  4J7F A;  1VQN A;  5IAY A;  3LLR A;  3M5A A;  4M7A B;  3RKY A;  2F5T X;  2ZPG B;  3OBW A;  3V7R A;  3QUI A;  4RMO A;  3ZFJ A;  1XOV A;  4M78 A;  3ZEH A;  3HPW A;  4M77 B;  3OW2 S;  4ELZ C;  3HRT A;  3G71 A;  4XTU A;  1K8A U;  1N9R A;  4IUP A;  4C5G A;  1YJW T;  4TVR A;  3V8J A;  2LTO A;  4RG2 A;  4JRK A;  4C0Z A;  3HP9 A;  5C6S A;  3MO8 A;  5LJ5 d;  2DIG A;  5GMK m;  2LQK A;  3G4S T;  2XI9 A;  1UB4 A;  1WGS A;  4LDV A;  3X24 B;  2RI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...