2JN0A

Solution nmr structure of the ygdr protein from escherichia coli. northeast structural genomics target er382a.
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
50
structure length
50
Chain Sequence
DYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQINRDDVSQIIER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of the ygdR protein from Escherichia coli. Northeast Structural Genomics target ER382A.
rcsb
molecule keywords Hypothetical lipoprotein ygdR
molecule tags Membrane protein
source organism Escherichia coli
total genus 7
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2006-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2jn0A00
4M7AF 4PJOF 1H641 5GAMj 2DEQA 2DXUA 1I4K1 3V8KA 4M7DA 2E65A 4XU0A 4M78G 4C92A 4XTXA 1BIBA 4C8QG 3JCMe 4A54A 4QVCA 2VXEA 3M4GA 2DZCA 5LJ5j 5GAMf 1JBMA 2YHTA 4C8QB 3GIBA 3INZA 3V7RA 4M7DG 3V8JA 3SB2A 4C92G 2EAYA 2RD1A 4M75E 4MMLA 5CAIA 4M7AE 4PJOE 1LJOA 3EFRA 1WQWA 4M77E 4C92B 4JUVA 5GMKe 4M7AD 5GMKm 4PJOD 4M77D 4F7UA 4M75C 4M7AC 4PJOC 5GANf 4JRIA 4M77C 2DTOA 4XU3A 3JB9D 4C8QA 1I81A 4WF2A 4M75F 4XTWA 3JCMf 5LJ5g 4F7UG 5GANe 4X9DA 4M77F 3V7SA 4DQ2A 2CGHA 2DZ9A 3RKWA 5GMKj 3JCMX 4F7UB 2DVEA 5GAOn 1HK9A 3JB9F 4M78F 5GAOr 4XTUA 2RM4A 1YCYA 4EMKC 2EJ9A 2HNIA 3QO3A 5GAOp 4A53A 2EJGA 4XQ3A 4M7AA 3JCMV 5LJ3g 1KQ2A 2DXTA 4HT8A 4Y91A 4M7DF 5GAN8 4QVDA 4NL3A 2DTIA 1WNLA 2E41A 5LJ5d 3RKXA 3FIFA 4M75D 1U1TA 4XTYA 5GANj 1M8VA 4M7AG 4M78E 2E10A 3SWNC 1BIAA 2EJFA 3BY7A 2JN0A 4M7AB 1U1SA 5GAOl 5GAMg 3JCMQ 3HFNA 4X9CA 4PJOB 4M7DE 4M78D 3JCMb 4N0AC 3RUXA 3L1AA 3BW1A 5LJ3d 4XU1A 4EMGA 4M78C 5LJ5h 5GAN5 5GAOm 4M7DD 5DY9A 4JLIA 3JB9I 2E64A 1WPYA 3PGGA 3V8LA 4M7DC 2VC8A 4XU2A 4J6WA 4C8QF 3BDUA 4EMKB 2DKGA 2RB6A 4XTVA 1LOJA 3JCMJ 5GAMd 5GANg 2ZGWA 4M75A 3EFSA 3JCMW 4PJOA 2DTHA 2YLCA 5LJ3h 4M77A 4OP0A 4PNOA 4C92F 2E1HA 4J6XA 3JCMg 3HSBA 5I21A 1X01A 5GAN3 3JCMc 5GAN2 5GAOq 2DJZA 2QTXA 4M75G 2YLBA 3SWNB 2I2LA 1D3BB 4PJOG 3FJPA 4J5YA 4C8QE 4M77G 3L2ZA 4M75B 2RA2A 1M5Q1 1I5LA 1B34A 1WQ7A 4RCCA 3RIRA 5GAMh 4M77B 3RERA 5LJ3e 3JB9G 4C8QD 4C92E 5GMKh 4NL2A 2VXFA 4NOYA 4EMKA 5GANd 3AHUA 3QSUA 4EMHA 1Y96B 2FYKA 4M78B 4RCBA 4XTZA 3V7CA 4HT9A 2K57A 4J6YA 4C8QC 3JCMd 1N9RA 5GAN4 2FB7A 1N9SA 4C92D 1MGQA 4F7UF 1B34B 2Y90A 5GMKi 5GMKl 3JCMP 3JB9J 4M7DB 5GAMe 4MMKA 5LJ5f 1JRIA 4C92C 3SWNA 1D3BA 3VU3C 3QHSA 5GANh 1TH7A 5LJ3j 5LJ5e 3QUIA 3RKYA 5GAN7 4N0AA 5GAN6 1I8FA 2EWNA 3JCMh 4F7UE 3FB9A 4V2SA 1LNXA 3BFMA 4JRKA 3HFOA 1Y96A 4M78A 5LJ3f 1KQ1A 3JB9H 3RESA 4HA8A 1HXDA
chains in the Genus database with same CATH superfamily
3E19A 2BZ8A 3LWHA 1ZHIA 4A4EA 1SPKA 3REAB 4BI8B 3MEAA 5A0GA 3UPUA 2EBPA 3M4YA 3CC4A 1W1FA 4BE2A 2KEAA 2EGCA 2DPPB 2HKNA 4BD3A 2KDSA 2NYSA 1K4US 3PVLA 1QCOA 2DERA 2L5QA 1Y71A 2KXCA 4M75F 2X3WD 1T3SA 2ED1A 2KBTA 4OVAA 3SDZA 3OW2S 4XTUA 5M9OA 1BI1A 1WXUA 3HRTA 4O6JA 4XQ3A 4GLMA 3A1PA 2M9UA 1M1KC 1WFWA 1NBEB 1WNLA 3I56Q 1G2BA 3L2WA 3JCMQ 3MEVA 1M2VB 2DIGA 1E7OA 3L1AA 5LJ3d 1K0SA 4XU1A 4FSSA 4OF1A 4IUQA 1NEBA 4XU2A 3TEEA 5GAMd 1KQSS 5GANg 1M1GA 4NS5A 2DTHA 1MMDA 3GNFB 1TWBA 5IH2A 4E7JA 4J5YA 2LQNA 3OSSC 4J9FA 1VQ5Q 2EW3A 4OMFB 4NL2A 2VXFA 3M5AA 2PVGB 4LE9A 4DEYA 1N8RC 3LGLA 1D3BA 2DJQA 3VS6A 1OX9A 3PE0A 3MHXA 4J9HA 2EFIA 1GCQC 1M27C 4AMCA 5KYUA 3VJPA 1YIJQ 4CC3A 1YITT 1BIBA 1TXQA 2PZ1A 1SG5A 2F1LA 1IRXA 1OULA 2BE7D 2LC4A 1UJYA 2GF7A 1ZSZC 2RHIA 2DAQA 1VQMT 2E70A 4PFOA 4E7HA 4M77D 1D1AA 1S72A 1WXTA 1KC8C 5FLXE 2LCCA 2AT1B 1D09B 3CCRA 3P8HA 2JJ9A 4RTZA 1KHCA 5A0DA 2EYWA 3N5BB 1JQQA 2JTFA 1XTDA 2OTLA 2D6FA 2DTIA 3D7SB 2DD4A 1U1TA 2JZ2A 1UHFA 2HD0A 2DO3A 1K8AU 3QXEB 1A0NB 4ZGEB 1UE9A 1K9MU 2GNCA 2O9VA 2DX1A 5GAOm 1VQLT 5DY9A 3VYGA 1R0CB 3EG0A 1IREB 2RB6A 1EIFA 2QA4Q 4LD6A 3JCMW 5LJ3h 3EH1A 3QKJA 2FZGB 2XDBA 3H0IA 4C0GA 1X01A 3QWXX 1UGVA 1VQ8A 1VQ6A 1D3BB 4UC4A 1WX6A 5DM7R 5GAMh 3SD4A 5LJ3e 3L2VA 1X6OA 3QSUA 4HCZA 1JJ2A 2EQKA 4XTZA 1D0YA 2XKOC 1W2BP 1G5VA 4C92D 5FU6C 5KYUB 4F7UF 5I2SA 4C5GA 2M16A 2QTVA 5GAMe 4MMKA 2CS7A 5HKCA 1QLYA 3PNWC 4RTVA 3NPFA 3RKYA 3VRZA 1I8FA 3BFMA 3HFOA 4FW1A 4HXJA 4M78A 2X3XD 4PJOF 1I4K1 4J9BA 2CP5A 4FL6A 1B3QA 2EQJA 4OB0B 3C0CA 1M90U 3GIBA 4M7DG 1H3ZA 1VQPA 1WQWA 3PMTA 1TSFA 3FC3A 3G71T 1EX4A 1FWZA 3QWYA 3A8HB 4KGVB 3AT1B 4M77C 3A5ZB 4OMPA 1I81A 3M55A 5GANe 4RMOA 3CMAA 2CGHA 4D8DA 1HK9A 2ZPGB 2EVRA 3X26B 1U8RA 1MMAA 1TS9A 3VS1A 2EJGA 1YN8A 3NMZC 1YHQA 3REBB 3RMSA 4KH1B 5GAN8 3RKXA 2MWOA 4M7AG 2E10A 2XICA 4QQGA 4AFSC 2EJFA 5DLQE 4M7AB 3URGA 1U1SA 3OYHA 1BI0A 2GTOA 1O75A 2KNBB 1U3OA 4C8QF 1N5ZA 2DKGA 4RTWA 4JJBA 3L2UA 2DLPA 2KAFA 2RPNA 3HSBA 2FZCB 3WXMB 5GAN2 5GAOq 1OU8A 4RKUE 1UDLA 2XU8A 4A63B 3RERA 2DYIA 2LMJA 2B8AA 2M0YA 3HPWA 4M78B 4RCBA 4AFZC 5IN1A 3S3NA 1BKBA 4J7FA 5KYWA 5GMKi 3JCMP 1M1KR 2DETA 4MDXA 2RJDA 3Q1JA 4C92C 4OGEA 1X6BA 1RI9A 1YP5A 4V2SA 2JS2A 2M0OA 1Q86R 3NHNA 3JB9H 2AKKA 1ZBJA 5HK0A 1TUDA 1NPRA 5J3BA 2DXUA 1HD3A 1VQ5T 2EYZA 2A36A 4OMNA 4A54A 2KY9A 2P84A 4OMLA 4M7AE 4J8OA 3CMEQ 3E1SA 1D0XA 4CRIA 1BCMA 2AZVA 2DA9A 5CR2A 5CKHA 3LH5A 5GANf 1AVZC 1X75C 4XTWA 2K5LA 1YIJT 3U23A 1N8RR 1U06A 3OBWA 3EG9B 1AWWA 2P0PA 1Y7XA 3M9QA 3KUFA 2RM4A 4J9CA 2JMAA 2QXFA 3JCMV 4QW2A 3QJ6A 3EGDA 2YUNA 3FIFA 4M78E 2J06A 1SEMA 2E12A 3G4SQ 4ZNXA 4JLGA 3RDVA 2DL7A 4HVUA 1YITA 5IXBA 3OYEA 1V76A 2D1XA 4E7IA 2GBQA 2LRQA 3JCMJ 4OB3B 1VQMA 3OYKA 2YLCA 3FDRA 2MIOA 3X24B 1KC8R 4Z88A 3CXCP 4M75G 4M75B 3SHWA 1I5LA 1VQNQ 2IIMA 1B34A 1ZUUA 2E3IA 2CP6A 2J7IA 3PVQA 2KMTA 3VUZA 3AHUA 4EMHA 2WACA 5HCKA 2CT3A 3R6NA 2YUQA 4AG1C 1JO8A 2GQVA 4LDVA 1WDXA 1YJ9Q 1UEBA 2RQWA 1GL5A 4JDSA 1B7TA 1K8AC 2K3BA 2HL3A 2NUZA 4K11A 1SHFA 2Z0WA 4FW2A 8AT1B 1IXDA 3JV3A 4R0KA 4ZGDB 1H641 4FYYB 3NTHA 1VQLA 4C92A 1V29B 4BE1A 2LX9A 2V8IA 2DRMA 1QMCA 1ZA1B 1RAGB 4BACA 3A8GB 4JUVA 1AEYA 3DB4A 3UA7A 1X43A 1PNJA 2L2PA 4BB7A 3OYCA 3CQTA 4BI3A 4WF2A 2AHJB 1LCKA 1IHWA 3TU4K 2LT1A 2CP7A 2HKQB 3H0FA 1YWPA 2DFUA 1ZQ1A 1KQ2A 1H92A 2QEXT 3CCEA 1ZUKA 2ESWA 1NJIR 1N6AA 4X34A 4DOVA 3QJYA 4BI4A 5GAOl 1YJWT 2X4JA 2CH4A 4EPCA 3GF5A 5CKEA 2QQ9A 2SRCA 1M90C 1Q7YU 4M7DD 3JB9I 2DD5A 1WPYA 3I5SA 1NE8A 2VC8A 1Q95G 4XK8E 3LW5E 3MJXA 4PJOA 3G71A 1SHGA 5KH6A 1NLPC 2OX7A 3EFOA 4IURA 3RIRA 2DYBA 2DMOA 3M56A 3EG1A 2DRKA 2L3QA 5GMKh 4EMKA 2VYTA 3M0UA 4J9IA 1N9SA 3S3MA 1G3WA 2F5KA 2O4XB 3UA6A 3VS2A 4LDYA 1VYVA 3G6EQ 4PKCC 1QKXA 3VU3C 1M4ZA 1VQKT 4PJJA 1PM3A 3M54A 4RUGA 3GNGA 3HKSA 1Q82U 2D9TA 2YRVA 3OW2P 3SEMA 2VXEA 1JXMA 1JBMA 4LUDA 4OMOA 2OTJQ 1EZZB 4J9DA 3CCVQ 4FU6A 4C5EA 1PC0A 2VUBA 2F5TX 2Y4XA 1IHVA 2X35A 4ATOA 1YI2T 4XU3A 4C8QA 2DBMA 4F7UG 2YUPA 2HQHA 4F7UB 4FYXB 2LJ3A 3JB9F 1B07A 1KQSP 3LLRA 2HNIA 3KBGA 1MMGA 1VA7A 2E3HA 5LJ3g 2QQRA 3CMET 3QIIA 4L5GA 1JJ2S 1MV0B 1BIAA 2L0AA 2JTEA 3BY7A 4A4FA 5GAMg 4PJOB 2COWA 2CP3A 5D6XA 4N0AC 1VQ5A 1PG5B 3CCUQ 2FEIA 4PFPA 1WHGA 3EFOB 2EYQA 2ECZA 4OGCA 4M7DC 4RG2A 4EMKB 4XTVA 3MP6A 5C0MA 1LOJA 3PTAA 1NEGA 3CPFA 4JJCA 2RHZA 5DLOA 2E6ZA 2ABLA 4CC2A 4C0DC 1QVFA 3FJPA 1KK7A 3G4ST 1QCNA 4IUPA 5IXFA 4N4IA 1YIJA 2CDTA 1HSQA 2XG8D 3CCMQ 1VQ9Q 3I55Q 4BUGA 1MGQA 2F2WA 2O31A 2EGEA 2MWPA 4GBQA 2P4RA 4DOWA 5FRMA 1EFNA 1VOMA 4F7UE 2EWNA 3CCSA 2COYA 3ZBDA 1I5OB 3X25B 2D8HA 3V8KA 1WHHA 4C8QG 2FHDA 3M4GA 2DZCA 2YXYA 4C8QB 2CP0A 3HP9A 1SRLA 1WHLA 4PJOE 3BDLA 1YJ9T 1RACB 2CZ1B 4C0FA 5CKFA 2LQKA 2Y4YA 3HTRA 4JRIA 2BIVA 1PSEA 3R6OA 2EKHA 2GFAA 5GMKj 3PIOA 2RI3A 3CCJQ 4QKUA 2CYZB 4J9EA 2OJ2A 1K8AR 2RNAA 3TSWA 4QVDA 2RO0A 1M1FA 4IUVA 3S3OA 5LJ5d 2H3JA 1K9MR 2FZKB 3SWNC 1XQHA 1F1BB 1VQ7T 2BTTA 2MK5A 2YUOA 2HL5C 2DXCA 4B9WA 1C0MA 5FRNA 3O5ZA 2LCSA 4J6WA 2B86A 3JSCA 3BDUA 2D8JA 1M30A 2LP5A 2RI5A 4C92F 4J6XA 3VKIA 4BY6C 2QTXA 1YWOA 2HSPA 2I2LA 4C8QE 3EH2A 1WQ7A 4AFQC 3EGXA 1VQOT 2RN8A 1UGSB 4MZTA 1RADB 2PVDB 1WXBA 4ZN3A 2X4YA 3C4SA 3JCMd 2JW4A 5D6YA 2Y90A 1XJWB 1UGPB 2QEXA 2ENMA 2K4YA 1PD0A 2DNUA 2I0NA 5KYNA 1Z9QA 1ZA2B 1Q81U 2GTJA 5CKDA 1YJWA 2LVMA 4QQ6A 5HY6A 3IQLA 1ABOA 4PJNA 4PL6A 1QVGA 1Q7YC 4XU0A 4F16A 4JRPA 1NLOC 1OI1A 4LN2A 2YHTA 4JJNK 1KJWA 3INZA 9ATCB 4DBQA 3G6ET 4ZTFA 3OMGA 2DL8A 3H0HA 4AG2C 1J3TA 1MHNA 2KGTA 4M75C 1W70A 1PD1A 2K6DA 5KYYA 1WGSA 3O8VA 4FYVB 2CUDA 3CCLQ 2M1HA 4KRTA 4ME7A 1KD1U 1H8KA 2OTJT 3FEOA 1BB9A 2W0ZA 1GCQA 3CCVT 3OY9A 1RABB 1VQKA 2E41A 3OYGA 3QPHA 4KGZB 2BE9B 4IIMA 4HCKA 5ECAA 1Q82C 2EIFA 5CQXA 2COZA 5LJ5h 3GOXA 1ZSZA 3EGXB 1XNIA 3PGGA 3CPWP 1UB4A 1HJDA 1OQKA 2QI2A 4KT0E 5FU7B 1MUZA 2MAMA 3I35A 2EYXA 3EHQA 1VQ4A 4RTXA 2X4XA 2ZPEB 1VQ8Q 1YI2A 4RG8A 1Z9ZA 5I22A 1Y0MA 1GRIA 2RHUA 5KCOA 4JS4A 1GBRA 1I1JA 2FB7A 2KT1A 1T0HA 4JZ4A 1CKBA 2VGMA 2ZPIB 1SSFA 1I07A 1WZOA 3CMEA 3M58A 3OYMA 3QUIA 1RLPC 3DLMA 3JCMh 3ULRB 2JM9A 3I56T 1KHIA 1G3TA 2DXBA 5LJ3f 2EPDA 5KYXA 2V26A 4DBHA 4M78G 1MV3A 1OZ3A 4PFZA 4QVCA 3JCMe 3CCMT 4ELZC 1K73U 3F70A 5KYYB 5GAMf 3I55T 2XD0A 1VQPQ 3V7RA 3M0SA 2L89A 2JOYA 3EFRA 4GLKA 2HEQA 3UATA 2RQTA 3CPWS 3OYDA 5EG2A 3CC2Q 3G4SA 2BZXA 2E5KA 2EQMA 3QYGB 2ZZDA 5IT9E 2K7AA 1UGRB 2VB6A 4DA4A 2JM8A 2LNVA 5CKBA 2KR3A 1BCOA 4HT8A 3CCQQ 4TVRA 1AOJA 2QAZA 3PFSA 2DVJA 2K79A 1PHTA 1QCFA 1ZBXA 4VUBA 5I2MA 4E2FB 2FPFA 4B9XA 1O9SA 2MCNA 4II1A 2NUTA 2W10A 3V8LA 3CC7Q 2SEMA 1OPLA 3CCJT 1BYMA 5IHKA 1YJ9A 4M77A 4FCYA 5I21A 3EAEA 1QQJA 3DLLA 3OS0A 2RK1A 1RI0A 3CD6Q 2PNIA 4RTUA 4OMQA 4ESRA 2K2MA 1ACMB 5FWBA 1W4SA 3JB9G 2A08A 2R5MA 5I11A 2CZ7B 2CKKA 5GAN4 5GMKl 5KYXB 1K1ZA 2BKDN 4A4HA 3I5RA 4KH0B 4IUTA 2MYSA 1RAIB 3KFVA 3L2RA 2WSCE 2ROLA 5GAN7 5KYWB 5AYFA 1OV3A 4MDWA 4FSXA 1UFFA 2XHCA 1VQ7A 4GY5A 4IUUA 3RESA 2LNHB 3OB9A 4X1VA 5LJ5j 5FU6B 5CIUA 3V8JA 3QYHB 2AIRB 1KSWA 1N27A 2O01E 2A28A 3UWNA 3H6ZA 3M59A 2QA4T 2RMOA 1GBQA 4QT7A 1WA7A 2DTOA 1VQOA 2KSSA 1MNEA 3M57A 3V7SA 2KE9A 2XK0A 2DZ9A 4E7SA 2E5QA 2KXDA 3HL8A 6AT1B 7AT1B 1QVFS 1NPPA 2FG0A 2K9GA 1WIEA 3TQ7P 3VYHB 4M7DF 2DXTA 2KRSA 2GGRA 1Q81C 1E6HA 2NUTB 4XTYA 1VYUA 4LDUA 3KXTA 3L42A 1Q7YR 1R0BG 3DB3A 4OMMA 2GQIA 1W2BA 4HVVA 1SF9A 3EGDB 4FM4B 1YITQ 2HBPA 3S6WA 4RTYA 3OA6A 1PSFA 4LNPA 2IPOB 1G83A 4P5NA 5CVIA 2XI9A 3CCLT 2HAXA 2D0QB 1VQMQ 3G6EA 1M3AA 1D0ZA 3NTIA 2JVVA 5GAN3 3META 2ZAEA 2DJZA 4MZMA 3A98A 1M3CA 4R55A 1RAHB 4DBRA 2FYKA 3VUBA 1KD1C 4HT9A 2OTJA 1B34B 1KG1A 2MI6A 1NZ9A 4BDZA 1OOTA 3CCVA 1GCPA 4FIBA 3CBPA 1TH7A 2K3XA 2R5AA 5GAN6 3QDRB 1GFCA 4JRKA 3EG3A 1W6XA 1X2KA 3DKMA 4LUEA 3H41A 3VRYA 3QBYA 1VQLQ 5FW9A 3G7ZA 4C92G 2EGAA 4MMLA 4M77E 1JJ2P 4C92B 2VGNA 2LX7A 5GMKe 2KVQG 2O9SA 4Y28E 4M7AD 3MO8A 2JS0A 1UG1A 2JTMA 2LJ0A 5GJVB 3OYLA 4LDWA 1NJIU 2X4WA 5D7UA 2X9HA 4M4ZA 2C06A 3JCMX 2JNGA 2NLUA 1E6GA 1VYTA 3QO3A 2P0QA 2FO0A 2DF6A 3CCEQ 2G6FX 1M3BA 1D1CA 4JPBW 3H8ZA 3I56A 2PUKB 1M8MA 1RL2A 3CC2T 3HFNA 2KYMA 4M78D 3JCMb 1JU5C 2J6KA 3PT9A 3CCMA 1K73C 5A2QE 1UHCA 3I55A 1OPKA 1VIEA 2QK0A 2H8HA 4OB1B 1BI2A 4CC7A 2JUFA 4DEXA 1X69A 3CCQT 5J39A 3J81E 1C1AA 4R56A 3GLXA 4HCBA 4PJOG 2V1QA 1YCSB 4AT1B 4F14A 3QG1A 1ARKA 4IIOA 2MPXC 4C92E 2YT6A 3HHTB 1GFDA 3E9FA 2EYYA 4ANJA 1JXOA 1OX8A 2L3SA 3CC7T 1JRIA 2NUPA 1Y57A 2XDDA 1BU1A 3THKA 1AZEA 1K76A 2YRDA 3NFCA 4N4HA 2PU9B 3X20B 4D8KA 2RQRA 4XAXB 3CD6T 1YJNQ 1VIFA 2FL7A 2DEQA 1QKWA 2RH2A 4WCIA 3M0TA 4KUDK 5L8RE 4XTXA 4OB2B 1R77A 5D6WA 3OSVA 2F2VA 2RK2A 1QWFA 2MF2A 3CCJA 2EAYA 3ZEHA 5FU7C 1SRMA 5CK9A 5J26A 5GMKm 1BBZA 1RAEB 4C5HA 2DL4A 4M7AC 3G1JA 1Y07A 5IHNA 3JB9D 3NGPA 2QASA 1Q86C 3CEYA 5LJ5g 1VQNT 3NTKA 4M77F 4DQ2A 2YSQA 3M0QA 1XOVA 5GAOr 3CC4Q 2DEUA 3CXCA 2VKNA 1YCYA 3LYIA 3MKDA 3HRSA 1TU0B 4Z8AA 1OEBA 4PJLA 4M75D 1LVKA 3MEWA 4CC4B 1RAFB 1G3YA 4FYWB 2KRNA 4EMGA 4M78C 1UECA 3QDFA 3QZ5B 4N4GA 2WSFE 4E7ZA 2QG9B 3A8MB 1U5SA 2XMFA 2ZGWA 3EFSA 2CH4W 2QA4A 4PNOA 5GJWB 2E1HA 3OYYA 3JCMg 1AWJA 3UDCA 2NUPB 1TG0A 1RLQC 4E6RA 1M5Q1 2EQIA 2RA2A 1D1BA 2KYBA 3OS1A 2K3YA 1CSKA 4NOYA 5HK3A 5GANd 1G3SA 2MMPA 2YWWA 3VS5A 2K57A 4PK4A 3JB9J 1WJSA 1Q81R 2OAWA 2P0KA 2HCKA 3TCJA 2LQWA 2HBWA 1TUGB 1UUEA 4N0AA 4BDYA 3ASKA 3CCSQ 2NWMA 2P4TA 1WHJA 2ZPFB 1KQ1A 5CCAA 4IKFA 2LZ6B 1HXDA 2KRMA 3MEUA 1SKUB 4LXCA 4M7DA 4D6WA 1FYNA 1ZX6A 2CZ6B 4JS5A 1NYGA 2DBKA 2RI2A 1X2QA 2V8KA 3CCLA 1WJRA 5CQYA 4EIKA 5KE2A 3LX7A 1LJOA 2ZPBB 4A4GA 4KUIA 1WHKA 3LGFA 4PJMA 2VASA 3RMQA 1MNDA 4J9GA 4A4KA 5C6SA 3C95A 5L23A 1M90R 1KD1R 1K0XA 5IAYA 1OZ2A 4X9DA 4RTTA 3RKWA 2YRCA 4ELYC 1AWOA 3T9NA 5GAOp 2VWFA 3LH0A 2KI7A 4M7AA 3TVTA 3A8OB 3CBOA 3UF4A 1M8VA 3FJ5A 2J6FA 1TUCA 1S72Q 4X9CA 4E7KA 4FT2A 3BW1A 3CCRQ 1IO6A 4QQDA 2F2XA 5GAN5 3MCAB 4KULA 3P8BB 1YBYA 4EDUA 1M2OA 2BZYA 1PWTA 3VV0A 2OTLQ 1CKAA 2CZ0B 4HVWA 1UGQB 1T0JA 1WI7A 2HQXA 2QQAA 3CCET 3TREA 2DL5A 3OW2A 3MPUB 1PKSA 1NJIC 2A7YA 1NG2A 2RHYA 3FRNA 1OYXA 4C5IA 3V7CA 1GXIE 3M53A 4JZ3A 2C0IA 2LJ1A 5IHIA 4M7DB 3OYIA 2QEXQ 3SWNA 5KE3A 1PCXA 2DL3A 3WVEB 1KIKA 5GANh 3ZL7C 5LJ5e 1YJWQ 3JRZA 4C0DB 3CC2A 1FXXA 3P8DA 1VQ6Q 3J7AF 1K73R 1KQSA 5A0LA 2E65A 3WVDB 3OYBA 3OYFA 8ATCB 2GFUA 3CCUT 3OS2A 2CT4A 5CAIA 4QVZA 1W2BS 4PLLA 1K9AA 3TSZA 3RBBB 4Z89A 2RF0A 3CCQA 4FT4A 4PJOD 4C0ZA 2F69A 1WLPB 2BUDA 3EG9A 4AFUC 3EHRA 2CSQA 3FLGA 3MP8A 2L3RA 1YJNT 2LCLA 2A0FB 3RR6A 2JMCA 3OYNA 1VQ9T 1IZ6A 3CC7A 1FMWA 2FVUA 4KBMB 2CUBA 4B6MA 4Y91A 4ZN1A 1VQKQ 4NL3A 1KFZA 2JT4A 1PRLC 2RHXA 2JN0A 3VS4A 3CD6A 4LD9K 1AHJB 4M7DE 2PVOB 3CMAQ 4E47A 2E64A 2RJEA 3RNJA 2PTKA 3CC4T 3HRUA 4ZTJA 3VS3A 3EGUA 1YHQQ 1AZGB 4M75A 1VQ4Q 1IB8A 1ZSZB 5KCHA 1P92A 3JCMc 1YI2Q 2ZCFB 2AK5A 3M0RA 4J83A 3SWNB 4RCCA 2VVKA 2QDLA 2J05A 1VQNA 4BE0A 2E6NA 2CSIA 4C8QD 1WYXA 2H3EB 3JAME 2A37A 3OS5A 2L8DA 1S1NA 4O5VA 2HSEB 1T3LA 5LJ5f 1LPLA 2DILA 3BE3A 3H9NA 5LJ3j 1M1KU 2LDMA 5AT1B 4BY6B 4ORZA 2A3LA 3FB9A 1VUBA 2MOXA 1ABQA 3C12A 5GAMj 2DE0X 3PIPA 1Q86U 3VS7A 2ATCB 2D0NA 1QVFP 5LL6S 1AWXA 2JXBA 1TOVA 2QQSA 2FRWA 3MP1A 1QP2A 2ROTA 1X6GA 1H3HA 4PLIA 2K5FA 2OAUA 5FROA 2LTOA 2R57A 3CCST 4PJOC 3OYAA 3JCMf 2RJCA 3I9QA 1IGUA 2FPEA 1MMNA 2QGGA 5GAOn 1OU9A 4EMKC 2V8JA 2EJ9A 4J7IA 4YTLA 1TTHB 2DIQA 1N8RU 3LWIA 1QWEA 5GANj 1NM7A 2QDYB 1NYFA 2KK4A 2M51A 1UTIA 2QQBA 2L3PA 2VV5A 4WTOB 3ZFJA 2V1RA 4JLIA 2PUOB 3EG2A 3SFMA 1M9SA 1QW1A 2EKOA 3M0PA 2KQWA 3E2UA 2AKLA 2K5IA 2HZYA 3ER0A 1FMVA 3GP8A 5FWCA 1WJQA 4M77G 1K9MC 2QGFB 3L2ZA 3VS0A 1S72T 3ME9A 2PQWA 2O4XA 4M77B 1KC8U 2C0OA 1I0CA 3CCRT 2O88A 2HQEA 4C8QC 1N9RA 4JJDA 2IVWA 3QZ9B 4ZGJB 3UT1A 1JB0E 2C0TA 4F17A 2OTLT 1BK2A 4HKEA 3QHSA 1VQ7Q 1LNXA 1Y96A 1RUWA 3CXCS 1C6VX 4JRQA 2HDAA 4M7AF 5CO7A 1ZLMA 2OI3A 3A8LB 1QVPA 3GPLA 1FMKA 2RQVA 4M75E 2RD1A 2DM1A 3SB2A 2X51A 2KROA 3OMCA 2XDPA 1UJ0A 1Q82R 4F7UA 3E9GA 1VQOQ 1VQ8T 1VQ6T 1IGQA 3CPWA 4CI0C 2ED0A 2DVEA 4M78F 2ZPHB 1QVGP 2GCXA 4A53A 1JEGA 4Q5WA 2EQUA 1HYOA 2XIDA 1AT1B 3CBMA 4L59A 1X27A 2YDLA 3OBYA 4HCCA 1WHMA 2M02A 3RUXA 2G3RA 2O2OA 2R58A 1PKTA 3OQ5A 3PMIA 1YFNA 3L2QA 2HMAA 4LDXA 5EC7A 3CCUA 4F04B 2LT4A 4E7LA 1FX7A 1SSHA 4Y92A 1PRMC 2RJFA 1VQPT 2DK3A 2RQUA 4KGXB 4OP0A 1ZSGA 1M2VA 1DJ7B 2CREA 2YLBA 3OYJA 2CP2A 1G8XA 4Z02A 3C94A 1YJNA 1V1CA 2K2VA 2AZSA 1Y96B 2IG0A 3CMAT 2KT8A 1VQ9A 4J6YA 2WSEE 3GBQA 1R8OB 1ZUYA 2FRYA 4L6V5 1BI3A 1QP3A 1YNZA 1YHQT 1QVGS 2J6OA 1AD5A 1RAAB 4DBFA 1VQ4T 3G71Q 3J80E 4MZPA 2E4HA 2LQ8A 2QYZA 3X28B 4HA8A 2FPDA
chains in the Genus database with same CATH topology
3E19A 3MEUA 4ZGDB 1H641 3LWHA 1ZHIA 4D6WA 4A4EA 4M7DA 2CZ6B 3NTHA 4M78G 1V29B 4BI8B 1OZ3A 4C92A 4JS5A 4BE1A 3MEAA 4QVCA 3JCMe 2LX9A 2RI2A 2V8IA 4ELZC 3F70A 5A0GA 3CCMT 5GAMf 3UPUA 2V8KA 3M4YA 1WJRA 3I55T 5CQYA 3CCLA 2XD0A 3CC4A 5KE2A 3V7RA 4BE2A 2L89A 2JOYA 3LX7A 4BACA 1LJOA 3EFRA 2ZPBB 3A8GB 4GLKA 2DPPB 4JUVA 4A4GA 4BD3A 4KUIA 2KDSA 3CPWS 3DB4A 3OYDA 3LGFA 5EG2A 3G4SA 3RMQA 4A4KA 4BB7A 2L5QA 3OYCA 1Y71A 5C6SA 3C95A 4BI3A 2EQMA 5IAYA 4WF2A 3QYGB 4M75F 1OZ2A 2ZZDA 5IT9E 5CCAA 4X9DA 2AHJB 3RKWA 1UGRB 4OVAA 3SDZA 1VQLA 4ELYC 3OW2S 3TU4K 3T9NA 4XTUA 2LT1A 4DA4A 5GAOp 5M9OA 1BI1A 2LNVA 3HRTA 3LH0A 4O6JA 4XQ3A 5CKBA 4M7AA 1ZQ1A 1KQ2A 2M9UA 4HT8A 3A8OB 1M1KC 2QEXT 3CCEA 3CBOA 4TVRA 1WNLA 3PFSA 1M8VA 1N6AA 4X34A 4DOVA 3L2WA 3QJYA 4BI4A 5GAOl 1YJWT 1ZBXA 3MEVA 4VUBA 4X9CA 3JCMQ 5I2MA 4E7KA 2X4JA 4EPCA 3L1AA 2DIGA 3BW1A 3GF5A 4FT2A 5CKEA 2QQ9A 5LJ3d 4B9XA 1O9SA 4QQDA 4XU1A 5GAN5 3MCAB 4KULA 1Q7YU 1M90C 4M7DD 3P8BB 3JB9I 1YBYA 2DD5A 4EDUA 1WPYA 4OF1A 4II1A 1NE8A 3V8LA 4IUQA 2VC8A 3VV0A 4XU2A 2CZ0B 4XK8E 1UGQB 3LW5E 3TEEA 3CCJT 1BYMA 5GAMd 1KQSS 5GANg 1M1GA 1YJ9A 2HQXA 2QQAA 4NS5A 4PJOA 2DTHA 4M77A 3CCET 3TREA 3G71A 5I21A 3GNFB 4E7JA 3EAEA 3OW2A 3DLLA 3OS0A 2RK1A 1RI0A 5KH6A 4J5YA 1NJIC 2A7YA 3OSSC 4IURA 3RIRA 3M56A 2RHYA 3JB9G 1W4SA 3FRNA 4OMFB 4NL2A 2VXFA 4EMKA 5GMKh 2VYTA 1OYXA 4C5IA 2R5MA 3V7CA 2CZ7B 3M5AA 2PVGB 2CKKA 1GXIE 3M53A 5GAN4 5GMKl 1N9SA 3S3MA 1G3WA 2F5KA 2O4XB 2BKDN 1N8RC 3OYIA 4A4HA 4M7DB 4IUTA 4LDYA 3LGLA 3SWNA 1D3BA 4PKCC 3L2RA 5KE3A 3VU3C 3WVEB 5GANh 2WSCE 5LJ5e 5GAN7 1M4ZA 5AYFA 1VQKT 3MHXA 4MDWA 3JRZA 4FSXA 2EFIA 2XHCA 4C0DB 1FXXA 3M54A 3P8DA 1VQ7A 3CC2A 3J7AF 4GY5A 4IUUA 3RESA 3GNGA 3VJPA 1KQSA 3HKSA 3OB9A 5A0LA 1Q82U 2E65A 2D9TA 2YRVA 3WVDB 1YITT 1BIBA 3OYBA 2VXEA 3OYFA 2GFUA 5LJ5j 1JBMA 3CCUT 3OS2A 5FU6B 5CIUA 3V8JA 3QYHB 2LC4A 5CAIA 4QVZA 1W2BS 4PLLA 1N27A 2GF7A 2RHIA 2O01E 3UWNA 2DAQA 4FU6A 1VQMT 3H6ZA 3M59A 3CCQA 2QA4T 2E70A 4C5EA 4FT4A 4PJOD 2VUBA 4E7HA 4M77D 2F5TX 4C0ZA 2F69A 2Y4XA 2BUDA 1S72A 2X35A 4ATOA 1YI2T 3S3NA 2DTOA 4XU3A 3FLGA 4C8QA 5FLXE 4EMKC 1VQOA 2LCCA 2KSSA 3MP8A 2L3RA 3CCRA 4F7UG 1YJNT 3P8HA 2LCLA 3M57A 3V7SA 2XK0A 1KHCA 2DZ9A 5A0DA 4F7UB 2E5QA 3N5BB 3OYNA 3HL8A 2JTFA 1VQ9T 1IZ6A 3JCMd 3JB9F 1XTDA 3CC7A 1QVFS 1NPPA 3LLRA 2HNIA 3KBGA 2OTLA 2FVUA 4KBMB 5LJ3g 3VYHB 4M7DF 2DXTA 4Y91A 4ZN1A 2D6FA 2QQRA 4NL3A 1Q81C 2DTIA 3CMET 3QIIA 4L5GA 1JJ2S 2DD4A 1U1TA 2JZ2A 4XTYA 2HD0A 4LDUA 1BIAA 2DO3A 3KXTA 3L42A 2RHXA 1K8AU 3BY7A 3QXEB 2JN0A 3CD6A 4A4FA 3DB3A 5GAMg 4PJOB 4LD9K 1AHJB 1W2BA 4ZGEB 4M7DE 2PVOB 4FM4B 2HBPA 4N0AC 5D6XA 1VQ5A 1K9MU 3S6WA 3OA6A 1PSFA 5GAOm 1VQLT 4E47A 5DY9A 3VYGA 4P5NA 2E64A 2RJEA 5CVIA 2EYQA 2XI9A 4OGCA 3CCLT 4M7DC 4RG2A 2HAXA 1IREB 3CC4T 4EMKB 3HRUA 2RB6A 1EIFA 1LOJA 2D0QB 3MP6A 4XTVA 5C0MA 3G6EA 3PTAA 4LD6A 4M75A 3JCMW 4ZTJA 3CPFA 2RHZA 5LJ3h 5DLOA 3QKJA 2E6ZA 2XDBA 3NTIA 5KCHA 2JVVA 4C0GA 1P92A 1X01A 5GAN3 3META 3JCMc 4C0DC 2ZCFB 2DJZA 4MZMA 4J83A 3SWNB 1VQ8A 1VQ6A 1D3BB 4UC4A 3FJPA 3G4ST 1QVFA 4IUPA 4R55A 1KC8C 4RCCA 4N4IA 5DM7R 5GAMh 1YIJA 3SD4A 1VQNA 5LJ3e 4BE0A 2E6NA 1X6OA 3L2VA 4C8QD 2XG8D 3QSUA 4HCZA 3JAME 2FYKA 1JJ2A 2EQKA 3OS5A 2L8DA 4XTZA 3VUBA 1KD1C 4HT9A 2XKOC 4BUGA 4O5VA 2OTJA 1G5VA 4C92D 5FU6C 1MGQA 4F7UF 1B34B 4C5GA 5I2SA 2M16A 1NZ9A 2MI6A 2MWPA 1KG1A 5GAMe 4MMKA 5LJ5f 2CS7A 4BDZA 5HKCA 3CCVA 4FIBA 4DOWA 5FRMA 3CBPA 1TH7A 3PNWC 2K3XA 5LJ3j 1M1KU 3RKYA 2LDMA 2R5AA 5GAN6 4BY6B 1I8FA 2EWNA 3QDRB 2A3LA 3FB9A 1VUBA 3BFMA 4JRKA 4F7UE 3HFOA 3CCSA 3C12A 4M78A 3ZBDA 3DKMA 3X25B 4PJOF 5GAMj 3QBYA 1I4K1 3V8KA 3PIPA 3G7ZA 1Q86U 4FL6A 2EQJA 4C8QG 2FHDA 3M4GA 4OB0B 2DZCA 1M90U 5LL6S 3HP9A 4C8QB 1K73U 3GIBA 4M7DG 2QQSA 1H3ZA 4C92G 1VQPA 4MMLA 4PJOE 3MP1A 1WQWA 1QP2A 3PMTA 4M77E 2VGNA 4C92B 5GMKe 2KVQG 3BDLA 4PLIA 4Y28E 1YJ9T 4M7AD 2K5FA 3MO8A 2CZ1B 2JTMA 2OAUA 5FROA 4C0FA 5CKFA 3FC3A 2LQKA 3G71T 2LTOA 2Y4YA 1FWZA 2R57A 3A8HB 3CCST 4PJOC 3OYLA 4LDWA 4JRIA 2BIVA 1PSEA 3A5ZB 4M77C 3R6OA 3OYAA 1NJIU 2X4WA 1I81A 3JCMf 2RJCA 3M55A 5GANe 4RMOA 2GFAA 3CMAA 2CGHA 5GMKj 3PIOA 2C06A 3JCMX 5GAOn 1HK9A 2JNGA 2NLUA 2ZPGB 2RI3A 3X26B 2V8JA 2EJ9A 2CYZB 2P0QA 3QO3A 4J7IA 2EJGA 4YTLA 2DIQA 1U8RA 1N8RU 1YHQA 3RMSA 5GAN8 4QVDA 2RO0A 1M1FA 4IUVA 3S3OA 5LJ5d 3LWIA 2H3JA 3RKXA 5GANj 3H8ZA 3I56A 2MWOA 2PUKB 2E10A 2XICA 4QQGA 4M7AG 3SWNC 2EJFA 1XQHA 5DLQE 4M7AB 1RL2A 1U1SA 2QDYB 2KK4A 3URGA 3HFNA 3OYHA 1VQ7T 3CC2T 1BI0A 2QQBA 4M78D 3JCMb 1O75A 2VV5A 3PT9A 3ZFJA 3CCMA 2DXCA 5A2QE 1K73C 3I55A 4JLIA 4B9WA 5FRNA 1VIEA 4OB1B 4J6WA 4C8QF 3BDUA 1BI2A 2DKGA 2PUOB 3JSCA 3SFMA 1M9SA 3L2UA 1QW1A 2EKOA 2KAFA 2KQWA 2RI5A 3HSBA 2JUFA 4C92F 2K5IA 4J6XA 3VKIA 4BY6C 3CCQT 3WXMB 5J39A 3ER0A 5GAN2 5GAOq 3J81E 3GP8A 2QTXA 4R56A 1WJQA 3GLXA 4HCBA 2I2LA 4PJOG 4RKUE 4C8QE 4M77G 1K9MC 3L2ZA 2XU8A 1S72T 3ME9A 2PQWA 1WQ7A 2O4XA 3QG1A 4M77B 3RERA 1KC8U 1VQOT 4C92E 1UGSB 4MZTA 2B8AA 3HHTB 3CCRT 3HPWA 2PVDB 3E9FA 4M78B 4RCBA 2HQEA 5IN1A 4C8QC 2X4YA 3C4SA 1N9RA 4ZN3A 2IVWA 1BKBA 3QZ9B 4J7FA 5D6YA 1JB0E 2Y90A 3UT1A 4ZGJB 5GMKi 3JCMP 4MDXA 2RJDA 3CC7T 3Q1JA 1UGPB 1JRIA 4C92C 2OTLT 4OGEA 2QEXA 2XDDA 4HKEA 2K4YA 3QHSA 3NFCA 1Q81U 4N4HA 2PU9B 4V2SA 5CKDA 1LNXA 2M0OA 3X20B 1YJWA 1Y96A 2LVMA 3JB9H 4QQ6A 3CXCS 4JRQA 5HY6A 5HK0A 4XAXB 3CD6T 1NPRA 4M7AF 1VIFA 2FL7A 5CO7A 2DEQA 2DXUA 4PL6A 2RH2A 5J3BA 1Q7YC 1QVGA 1VQ5T 4XU0A 4KUDK 5L8RE 4XTXA 3A8LB 4OB2B 1QVPA 4JRPA 4A54A 1OI1A 2KY9A 3OSVA 5D6WA 3GPLA 2RK2A 2YHTA 4JJNK 2MF2A 3INZA 3CCJA 3SB2A 2EAYA 2RD1A 4M75E 5FU7C 3ZEHA 4M7AE 4J8OA 3E1SA 3G6ET 3OMCA 5CK9A 4ZTFA 4CRIA 3OMGA 5J26A 5GMKm 2XDPA 4C5HA 5CR2A 1MHNA 5CKHA 4M75C 4F7UA 4M7AC 3E9GA 1Y07A 5GANf 1VQ8T 3JB9D 1VQ6T 1X75C 1Q86C 3CPWA 1WGSA 3CEYA 3O8VA 4XTWA 5LJ5g 2K5LA 4CI0C 1YIJT 1VQNT 3NTKA 4M77F 4DQ2A 3OBWA 2DVEA 1XOVA 2M1HA 2P0PA 4M78F 1Y7XA 4ME7A 5GAOr 3M9QA 1KD1U 2ZPHB 3KUFA 2RM4A 1YCYA 3CXCA 3FEOA 2OTJT 2GCXA 2QXFA 4A53A 3LYIA 3JCMV 4QW2A 3HRSA 3CCVT 3QJ6A 4Q5WA 3OY9A 1VQKA 2E41A 3OYGA 2EQUA 3FIFA 3QPHA 4M75D 2XIDA 4M78E 3CBMA 4L59A 2E12A 4JLGA 3MEWA 1Q82C 3OBYA 4HCCA 1G3YA 3RUXA 1YITA 2EIFA 2G3RA 2R58A 3OQ5A 5CQXA 4EMGA 5LJ5h 4M78C 3PMIA 3GOXA 3OYEA 3L2QA 4N4GA 3QZ5B 3CCUA 4LDXA 4E7IA 2WSFE 2LRQA 1XNIA 2LT4A 3PGGA 4E7LA 1FX7A 1UB4A 3A8MB 3JCMJ 2RJFA 2QI2A 4KT0E 4OB3B 2ZGWA 2DK3A 2MAMA 3EFSA 5FU7B 1VQPT 2QA4A 3OYKA 1VQMA 2YLCA 4OP0A 3FDRA 4PNOA 1VQ4A 2E1HA 3OYYA 3JCMg 3UDCA 3X24B 2X4XA 2ZPEB 1DJ7B 4M75G 2YLBA 4RG8A 1YI2A 3OYJA 4M75B 1M5Q1 2RA2A 1I5LA 1B34A 4Z02A 3C94A 1YJNA 2K2VA 3OS1A 2K3YA 2KMTA 4NOYA 2RHUA 3VUZA 5KCOA 5HK3A 5GANd 4JS4A 4EMHA 3AHUA 1G3SA 1Y96B 2WACA 2MMPA 2IG0A 3CMAT 1VQ9A 2K57A 4J6YA 2WSEE 2FB7A 3JB9J 1R8OB 1WJSA 2GQVA 4LDVA 2VGMA 2P0KA 2ZPIB 1SSFA 4L6V5 1BI3A 3TCJA 1QP3A 3M58A 1UEBA 3CMEA 3OYMA 1YHQT 1QVGS 1VQ4T 3QUIA 4JDSA 3J80E 1K8AC 4N0AA 3DLMA 4MZPA 4BDYA 3JCMh 2LQ8A 3ASKA 3I56T 2P4TA 2ZPFB 1KHIA 1G3TA 2DXBA 5LJ3f 1KQ1A 3X28B 4IKFA 4HA8A 1HXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7A F;  4PJO F;  1H64 1;  5GAM j;  2DEQ A;  2DXU A;  1I4K 1;  3V8K A;  4M7D A;  2E65 A;  4XU0 A;  4M78 G;  4C92 A;  4XTX A;  1BIB A;  4C8Q G;  3JCM e;  4A54 A;  4QVC A;  2VXE A;  3M4G A;  2DZC A;  5LJ5 j;  5GAM f;  1JBM A;  2YHT A;  4C8Q B;  3GIB A;  3INZ A;  3V7R A;  4M7D G;  3V8J A;  3SB2 A;  4C92 G;  2EAY A;  2RD1 A;  4M75 E;  4MML A;  5CAI A;  4M7A E;  4PJO E;  1LJO A;  3EFR A;  1WQW A;  4M77 E;  4C92 B;  4JUV A;  5GMK e;  4M7A D;  5GMK m;  4PJO D;  4M77 D;  4F7U A;  4M75 C;  4M7A C;  4PJO C;  5GAN f;  4JRI A;  4M77 C;  2DTO A;  4XU3 A;  3JB9 D;  4C8Q A;  1I81 A;  4WF2 A;  4M75 F;  4XTW A;  3JCM f;  5LJ5 g;  4F7U G;  5GAN e;  4X9D A;  4M77 F;  3V7S A;  4DQ2 A;  2CGH A;  2DZ9 A;  3RKW A;  5GMK j;  3JCM X;  4F7U B;  2DVE A;  5GAO n;  1HK9 A;  3JB9 F;  4M78 F;  5GAO r;  4XTU A;  2RM4 A;  1YCY A;  4EMK C;  2EJ9 A;  2HNI A;  3QO3 A;  5GAO p;  4A53 A;  2EJG A;  4XQ3 A;  4M7A A;  3JCM V;  5LJ3 g;  1KQ2 A;  2DXT A;  4HT8 A;  4Y91 A;  4M7D F;  5GAN 8;  4QVD A;  4NL3 A;  2DTI A;  1WNL A;  2E41 A;  5LJ5 d;  3RKX A;  3FIF A;  4M75 D;  1U1T A;  4XTY A;  5GAN j;  1M8V A;  4M7A G;  4M78 E;  2E10 A;  3SWN C;  1BIA A;  2EJF A;  3BY7 A;  2JN0 A;  4M7A B;  1U1S A;  5GAO l;  5GAM g;  3JCM Q;  3HFN A;  4X9C A;  4PJO B;  4M7D E;  4M78 D;  3JCM b;  4N0A C;  3RUX A;  3L1A A;  3BW1 A;  5LJ3 d;  4XU1 A;  4EMG A;  4M78 C;  5LJ5 h;  5GAN 5;  5GAO m;  4M7D D;  5DY9 A;  4JLI A;  3JB9 I;  2E64 A;  1WPY A;  3PGG A;  3V8L A;  4M7D C;  2VC8 A;  4XU2 A;  4J6W A;  4C8Q F;  3BDU A;  4EMK B;  2DKG A;  2RB6 A;  4XTV A;  1LOJ A;  3JCM J;  5GAM d;  5GAN g;  2ZGW A;  4M75 A;  3EFS A;  3JCM W;  4PJO A;  2DTH A;  2YLC A;  5LJ3 h;  4M77 A;  4OP0 A;  4PNO A;  4C92 F;  2E1H A;  4J6X A;  3JCM g;  3HSB A;  5I21 A;  1X01 A;  5GAN 3;  3JCM c;  5GAN 2;  5GAO q;  2DJZ A;  2QTX A;  4M75 G;  2YLB A;  3SWN B;  2I2L A;  1D3B B;  4PJO G;  3FJP A;  4J5Y A;  4C8Q E;  4M77 G;  3L2Z A;  4M75 B;  2RA2 A;  1M5Q 1;  1I5L A;  1B34 A;  1WQ7 A;  4RCC A;  3RIR A;  5GAM h;  4M77 B;  3RER A;  5LJ3 e;  3JB9 G;  4C8Q D;  4C92 E;  5GMK h;  4NL2 A;  2VXF A;  4NOY A;  4EMK A;  5GAN d;  3AHU A;  3QSU A;  4EMH A;  1Y96 B;  2FYK A;  4M78 B;  4RCB A;  4XTZ A;  3V7C A;  4HT9 A;  2K57 A;  4J6Y A;  4C8Q C;  3JCM d;  1N9R A;  5GAN 4;  2FB7 A;  1N9S A;  4C92 D;  1MGQ A;  4F7U F;  1B34 B;  2Y90 A;  5GMK i;  5GMK l;  3JCM P;  3JB9 J;  4M7D B;  5GAM e;  4MMK A;  5LJ5 f;  1JRI A;  4C92 C;  3SWN A;  1D3B A;  3VU3 C;  3QHS A;  5GAN h;  1TH7 A;  5LJ3 j;  5LJ5 e;  3QUI A;  3RKY A;  5GAN 7;  4N0A A;  5GAN 6;  1I8F A;  2EWN A;  3JCM h;  4F7U E;  3FB9 A;  4V2S A;  1LNX A;  3BFM A;  4JRK A;  3HFO A;  1Y96 A;  4M78 A;  5LJ3 f;  1KQ1 A;  3JB9 H;  3RES A;  4HA8 A;  1HXD A; 
#chains in the Genus database with same CATH topology
 3E19 A;  2BZ8 A;  3LWH A;  1ZHI A;  4A4E A;  1SPK A;  3REA B;  4BI8 B;  3MEA A;  5A0G A;  3UPU A;  2EBP A;  3M4Y A;  3CC4 A;  1W1F A;  4BE2 A;  2KEA A;  2EGC A;  2DPP B;  2HKN A;  4BD3 A;  2KDS A;  2NYS A;  1K4U S;  3PVL A;  1QCO A;  2DER A;  2L5Q A;  1Y71 A;  2KXC A;  4M75 F;  2X3W D;  1T3S A;  2ED1 A;  2KBT A;  4OVA A;  3SDZ A;  3OW2 S;  4XTU A;  5M9O A;  1BI1 A;  1WXU A;  3HRT A;  4O6J A;  4XQ3 A;  4GLM A;  3A1P A;  2M9U A;  1M1K C;  1WFW A;  1NBE B;  1WNL A;  3I56 Q;  1G2B A;  3L2W A;  3JCM Q;  3MEV A;  1M2V B;  2DIG A;  1E7O A;  3L1A A;  5LJ3 d;  1K0S A;  4XU1 A;  4FSS A;  4OF1 A;  4IUQ A;  1NEB A;  4XU2 A;  3TEE A;  5GAM d;  1KQS S;  5GAN g;  1M1G A;  4NS5 A;  2DTH A;  1MMD A;  3GNF B;  1TWB A;  5IH2 A;  4E7J A;  4J5Y A;  2LQN A;  3OSS C;  4J9F A;  1VQ5 Q;  2EW3 A;  4OMF B;  4NL2 A;  2VXF A;  3M5A A;  2PVG B;  4LE9 A;  4DEY A;  1N8R C;  3LGL A;  1D3B A;  2DJQ A;  3VS6 A;  1OX9 A;  3PE0 A;  3MHX A;  4J9H A;  2EFI A;  1GCQ C;  1M27 C;  4AMC A;  5KYU A;  3VJP A;  1YIJ Q;  4CC3 A;  1YIT T;  1BIB A;  1TXQ A;  2PZ1 A;  1SG5 A;  2F1L A;  1IRX A;  1OUL A;  2BE7 D;  2LC4 A;  1UJY A;  2GF7 A;  1ZSZ C;  2RHI A;  2DAQ A;  1VQM T;  2E70 A;  4PFO A;  4E7H A;  4M77 D;  1D1A A;  1S72 A;  1WXT A;  1KC8 C;  5FLX E;  2LCC A;  2AT1 B;  1D09 B;  3CCR A;  3P8H A;  2JJ9 A;  4RTZ A;  1KHC A;  5A0D A;  2EYW A;  3N5B B;  1JQQ A;  2JTF A;  1XTD A;  2OTL A;  2D6F A;  2DTI A;  3D7S B;  2DD4 A;  1U1T A;  2JZ2 A;  1UHF A;  2HD0 A;  2DO3 A;  1K8A U;  3QXE B;  1A0N B;  4ZGE B;  1UE9 A;  1K9M U;  2GNC A;  2O9V A;  2DX1 A;  5GAO m;  1VQL T;  5DY9 A;  3VYG A;  1R0C B;  3EG0 A;  1IRE B;  2RB6 A;  1EIF A;  2QA4 Q;  4LD6 A;  3JCM W;  5LJ3 h;  3EH1 A;  3QKJ A;  2FZG B;  2XDB A;  3H0I A;  4C0G A;  1X01 A;  3QWX X;  1UGV A;  1VQ8 A;  1VQ6 A;  1D3B B;  4UC4 A;  1WX6 A;  5DM7 R;  5GAM h;  3SD4 A;  5LJ3 e;  3L2V A;  1X6O A;  3QSU A;  4HCZ A;  1JJ2 A;  2EQK A;  4XTZ A;  1D0Y A;  2XKO C;  1W2B P;  1G5V A;  4C92 D;  5FU6 C;  5KYU B;  4F7U F;  5I2S A;  4C5G A;  2M16 A;  2QTV A;  5GAM e;  4MMK A;  2CS7 A;  5HKC A;  1QLY A;  3PNW C;  4RTV A;  3NPF A;  3RKY A;  3VRZ A;  1I8F A;  3BFM A;  3HFO A;  4FW1 A;  4HXJ A;  4M78 A;  2X3X D;  4PJO F;  1I4K 1;  4J9B A;  2CP5 A;  4FL6 A;  1B3Q A;  2EQJ A;  4OB0 B;  3C0C A;  1M90 U;  3GIB A;  4M7D G;  1H3Z A;  1VQP A;  1WQW A;  3PMT A;  1TSF A;  3FC3 A;  3G71 T;  1EX4 A;  1FWZ A;  3QWY A;  3A8H B;  4KGV B;  3AT1 B;  4M77 C;  3A5Z B;  4OMP A;  1I81 A;  3M55 A;  5GAN e;  4RMO A;  3CMA A;  2CGH A;  4D8D A;  1HK9 A;  2ZPG B;  2EVR A;  3X26 B;  1U8R A;  1MMA A;  1TS9 A;  3VS1 A;  2EJG A;  1YN8 A;  3NMZ C;  1YHQ A;  3REB B;  3RMS A;  4KH1 B;  5GAN 8;  3RKX A;  2MWO A;  4M7A G;  2E10 A;  2XIC A;  4QQG A;  4AFS C;  2EJF A;  5DLQ E;  4M7A B;  3URG A;  1U1S A;  3OYH A;  1BI0 A;  2GTO A;  1O75 A;  2KNB B;  1U3O A;  4C8Q F;  1N5Z A;  2DKG A;  4RTW A;  4JJB A;  3L2U A;  2DLP A;  2KAF A;  2RPN A;  3HSB A;  2FZC B;  3WXM B;  5GAN 2;  5GAO q;  1OU8 A;  4RKU E;  1UDL A;  2XU8 A;  4A63 B;  3RER A;  2DYI A;  2LMJ A;  2B8A A;  2M0Y A;  3HPW A;  4M78 B;  4RCB A;  4AFZ C;  5IN1 A;  3S3N A;  1BKB A;  4J7F A;  5KYW A;  5GMK i;  3JCM P;  1M1K R;  2DET A;  4MDX A;  2RJD A;  3Q1J A;  4C92 C;  4OGE A;  1X6B A;  1RI9 A;  1YP5 A;  4V2S A;  2JS2 A;  2M0O A;  1Q86 R;  3NHN A;  3JB9 H;  2AKK A;  1ZBJ A;  5HK0 A;  1TUD A;  1NPR A;  5J3B A;  2DXU A;  1HD3 A;  1VQ5 T;  2EYZ A;  2A36 A;  4OMN A;  4A54 A;  2KY9 A;  2P84 A;  4OML A;  4M7A E;  4J8O A;  3CME Q;  3E1S A;  1D0X A;  4CRI A;  1BCM A;  2AZV A;  2DA9 A;  5CR2 A;  5CKH A;  3LH5 A;  5GAN f;  1AVZ C;  1X75 C;  4XTW A;  2K5L A;  1YIJ T;  3U23 A;  1N8R R;  1U06 A;  3OBW A;  3EG9 B;  1AWW A;  2P0P A;  1Y7X A;  3M9Q A;  3KUF A;  2RM4 A;  4J9C A;  2JMA A;  2QXF A;  3JCM V;  4QW2 A;  3QJ6 A;  3EGD A;  2YUN A;  3FIF A;  4M78 E;  2J06 A;  1SEM A;  2E12 A;  3G4S Q;  4ZNX A;  4JLG A;  3RDV A;  2DL7 A;  4HVU A;  1YIT A;  5IXB A;  3OYE A;  1V76 A;  2D1X A;  4E7I A;  2GBQ A;  2LRQ A;  3JCM J;  4OB3 B;  1VQM A;  3OYK A;  2YLC A;  3FDR A;  2MIO A;  3X24 B;  1KC8 R;  4Z88 A;  3CXC P;  4M75 G;  4M75 B;  3SHW A;  1I5L A;  1VQN Q;  2IIM A;  1B34 A;  1ZUU A;  2E3I A;  2CP6 A;  2J7I A;  3PVQ A;  2KMT A;  3VUZ A;  3AHU A;  4EMH A;  2WAC A;  5HCK A;  2CT3 A;  3R6N A;  2YUQ A;  4AG1 C;  1JO8 A;  2GQV A;  4LDV A;  1WDX A;  1YJ9 Q;  1UEB A;  2RQW A;  1GL5 A;  4JDS A;  1B7T A;  1K8A C;  2K3B A;  2HL3 A;  2NUZ A;  4K11 A;  1SHF A;  2Z0W A;  4FW2 A;  8AT1 B;  1IXD A;  3JV3 A;  4R0K A;  4ZGD B;  1H64 1;  4FYY B;  3NTH A;  1VQL A;  4C92 A;  1V29 B;  4BE1 A;  2LX9 A;  2V8I A;  2DRM A;  1QMC A;  1ZA1 B;  1RAG B;  4BAC A;  3A8G B;  4JUV A;  1AEY A;  3DB4 A;  3UA7 A;  1X43 A;  1PNJ A;  2L2P A;  4BB7 A;  3OYC A;  3CQT A;  4BI3 A;  4WF2 A;  2AHJ B;  1LCK A;  1IHW A;  3TU4 K;  2LT1 A;  2CP7 A;  2HKQ B;  3H0F A;  1YWP A;  2DFU A;  1ZQ1 A;  1KQ2 A;  1H92 A;  2QEX T;  3CCE A;  1ZUK A;  2ESW A;  1NJI R;  1N6A A;  4X34 A;  4DOV A;  3QJY A;  4BI4 A;  5GAO l;  1YJW T;  2X4J A;  2CH4 A;  4EPC A;  3GF5 A;  5CKE A;  2QQ9 A;  2SRC A;  1M90 C;  1Q7Y U;  4M7D D;  3JB9 I;  2DD5 A;  1WPY A;  3I5S A;  1NE8 A;  2VC8 A;  1Q95 G;  4XK8 E;  3LW5 E;  3MJX A;  4PJO A;  3G71 A;  1SHG A;  5KH6 A;  1NLP C;  2OX7 A;  3EFO A;  4IUR A;  3RIR A;  2DYB A;  2DMO A;  3M56 A;  3EG1 A;  2DRK A;  2L3Q A;  5GMK h;  4EMK A;  2VYT A;  3M0U A;  4J9I A;  1N9S A;  3S3M A;  1G3W A;  2F5K A;  2O4X B;  3UA6 A;  3VS2 A;  4LDY A;  1VYV A;  3G6E Q;  4PKC C;  1QKX A;  3VU3 C;  1M4Z A;  1VQK T;  4PJJ A;  1PM3 A;  3M54 A;  4RUG A;  3GNG A;  3HKS A;  1Q82 U;  2D9T A;  2YRV A;  3OW2 P;  3SEM A;  2VXE A;  1JXM A;  1JBM A;  4LUD A;  4OMO A;  2OTJ Q;  1EZZ B;  4J9D A;  3CCV Q;  4FU6 A;  4C5E A;  1PC0 A;  2VUB A;  2F5T X;  2Y4X A;  1IHV A;  2X35 A;  4ATO A;  1YI2 T;  4XU3 A;  4C8Q A;  2DBM A;  4F7U G;  2YUP A;  2HQH A;  4F7U B;  4FYX B;  2LJ3 A;  3JB9 F;  1B07 A;  1KQS P;  3LLR A;  2HNI A;  3KBG A;  1MMG A;  1VA7 A;  2E3H A;  5LJ3 g;  2QQR A;  3CME T;  3QII A;  4L5G A;  1JJ2 S;  1MV0 B;  1BIA A;  2L0A A;  2JTE A;  3BY7 A;  4A4F A;  5GAM g;  4PJO B;  2COW A;  2CP3 A;  5D6X A;  4N0A C;  1VQ5 A;  1PG5 B;  3CCU Q;  2FEI A;  4PFP A;  1WHG A;  3EFO B;  2EYQ A;  2ECZ A;  4OGC A;  4M7D C;  4RG2 A;  4EMK B;  4XTV A;  3MP6 A;  5C0M A;  1LOJ A;  3PTA A;  1NEG A;  3CPF A;  4JJC A;  2RHZ A;  5DLO A;  2E6Z A;  2ABL A;  4CC2 A;  4C0D C;  1QVF A;  3FJP A;  1KK7 A;  3G4S T;  1QCN A;  4IUP A;  5IXF A;  4N4I A;  1YIJ A;  2CDT A;  1HSQ A;  2XG8 D;  3CCM Q;  1VQ9 Q;  3I55 Q;  4BUG A;  1MGQ A;  2F2W A;  2O31 A;  2EGE A;  2MWP A;  4GBQ A;  2P4R A;  4DOW A;  5FRM A;  1EFN A;  1VOM A;  4F7U E;  2EWN A;  3CCS A;  2COY A;  3ZBD A;  1I5O B;  3X25 B;  2D8H A;  3V8K A;  1WHH A;  4C8Q G;  2FHD A;  3M4G A;  2DZC A;  2YXY A;  4C8Q B;  2CP0 A;  3HP9 A;  1SRL A;  1WHL A;  4PJO E;  3BDL A;  1YJ9 T;  1RAC B;  2CZ1 B;  4C0F A;  5CKF A;  2LQK A;  2Y4Y A;  3HTR A;  4JRI A;  2BIV A;  1PSE A;  3R6O A;  2EKH A;  2GFA A;  5GMK j;  3PIO A;  2RI3 A;  3CCJ Q;  4QKU A;  2CYZ B;  4J9E A;  2OJ2 A;  1K8A R;  2RNA A;  3TSW A;  4QVD A;  2RO0 A;  1M1F A;  4IUV A;  3S3O A;  5LJ5 d;  2H3J A;  1K9M R;  2FZK B;  3SWN C;  1XQH A;  1F1B B;  1VQ7 T;  2BTT A;  2MK5 A;  2YUO A;  2HL5 C;  2DXC A;  4B9W A;  1C0M A;  5FRN A;  3O5Z A;  2LCS A;  4J6W A;  2B86 A;  3JSC A;  3BDU A;  2D8J A;  1M30 A;  2LP5 A;  2RI5 A;  4C92 F;  4J6X A;  3VKI A;  4BY6 C;  2QTX A;  1YWO A;  2HSP A;  2I2L A;  4C8Q E;  3EH2 A;  1WQ7 A;  4AFQ C;  3EGX A;  1VQO T;  2RN8 A;  1UGS B;  4MZT A;  1RAD B;  2PVD B;  1WXB A;  4ZN3 A;  2X4Y A;  3C4S A;  3JCM d;  2JW4 A;  5D6Y A;  2Y90 A;  1XJW B;  1UGP B;  2QEX A;  2ENM A;  2K4Y A;  1PD0 A;  2DNU A;  2I0N A;  5KYN A;  1Z9Q A;  1ZA2 B;  1Q81 U;  2GTJ A;  5CKD A;  1YJW A;  2LVM A;  4QQ6 A;  5HY6 A;  3IQL A;  1ABO A;  4PJN A;  4PL6 A;  1QVG A;  1Q7Y C;  4XU0 A;  4F16 A;  4JRP A;  1NLO C;  1OI1 A;  4LN2 A;  2YHT A;  4JJN K;  1KJW A;  3INZ A;  9ATC B;  4DBQ A;  3G6E T;  4ZTF A;  3OMG A;  2DL8 A;  3H0H A;  4AG2 C;  1J3T A;  1MHN A;  2KGT A;  4M75 C;  1W70 A;  1PD1 A;  2K6D A;  5KYY A;  1WGS A;  3O8V A;  4FYV B;  2CUD A;  3CCL Q;  2M1H A;  4KRT A;  4ME7 A;  1KD1 U;  1H8K A;  2OTJ T;  3FEO A;  1BB9 A;  2W0Z A;  1GCQ A;  3CCV T;  3OY9 A;  1RAB B;  1VQK A;  2E41 A;  3OYG A;  3QPH A;  4KGZ B;  2BE9 B;  4IIM A;  4HCK A;  5ECA A;  1Q82 C;  2EIF A;  5CQX A;  2COZ A;  5LJ5 h;  3GOX A;  1ZSZ A;  3EGX B;  1XNI A;  3PGG A;  3CPW P;  1UB4 A;  1HJD A;  1OQK A;  2QI2 A;  4KT0 E;  5FU7 B;  1MUZ A;  2MAM A;  3I35 A;  2EYX A;  3EHQ A;  1VQ4 A;  4RTX A;  2X4X A;  2ZPE B;  1VQ8 Q;  1YI2 A;  4RG8 A;  1Z9Z A;  5I22 A;  1Y0M A;  1GRI A;  2RHU A;  5KCO A;  4JS4 A;  1GBR A;  1I1J A;  2FB7 A;  2KT1 A;  1T0H A;  4JZ4 A;  1CKB A;  2VGM A;  2ZPI B;  1SSF A;  1I07 A;  1WZO A;  3CME A;  3M58 A;  3OYM A;  3QUI A;  1RLP C;  3DLM A;  3JCM h;  3ULR B;  2JM9 A;  3I56 T;  1KHI A;  1G3T A;  2DXB A;  5LJ3 f;  2EPD A;  5KYX A;  2V26 A;  4DBH A;  4M78 G;  1MV3 A;  1OZ3 A;  4PFZ A;  4QVC A;  3JCM e;  3CCM T;  4ELZ C;  1K73 U;  3F70 A;  5KYY B;  5GAM f;  3I55 T;  2XD0 A;  1VQP Q;  3V7R A;  3M0S A;  2L89 A;  2JOY A;  3EFR A;  4GLK A;  2HEQ A;  3UAT A;  2RQT A;  3CPW S;  3OYD A;  5EG2 A;  3CC2 Q;  3G4S A;  2BZX A;  2E5K A;  2EQM A;  3QYG B;  2ZZD A;  5IT9 E;  2K7A A;  1UGR B;  2VB6 A;  4DA4 A;  2JM8 A;  2LNV A;  5CKB A;  2KR3 A;  1BCO A;  4HT8 A;  3CCQ Q;  4TVR A;  1AOJ A;  2QAZ A;  3PFS A;  2DVJ A;  2K79 A;  1PHT A;  1QCF A;  1ZBX A;  4VUB A;  5I2M A;  4E2F B;  2FPF A;  4B9X A;  1O9S A;  2MCN A;  4II1 A;  2NUT A;  2W10 A;  3V8L A;  3CC7 Q;  2SEM A;  1OPL A;  3CCJ T;  1BYM A;  5IHK A;  1YJ9 A;  4M77 A;  4FCY A;  5I21 A;  3EAE A;  1QQJ A;  3DLL A;  3OS0 A;  2RK1 A;  1RI0 A;  3CD6 Q;  2PNI A;  4RTU A;  4OMQ A;  4ESR A;  2K2M A;  1ACM B;  5FWB A;  1W4S A;  3JB9 G;  2A08 A;  2R5M A;  5I11 A;  2CZ7 B;  2CKK A;  5GAN 4;  5GMK l;  5KYX B;  1K1Z A;  2BKD N;  4A4H A;  3I5R A;  4KH0 B;  4IUT A;  2MYS A;  1RAI B;  3KFV A;  3L2R A;  2WSC E;  2ROL A;  5GAN 7;  5KYW B;  5AYF A;  1OV3 A;  4MDW A;  4FSX A;  1UFF A;  2XHC A;  1VQ7 A;  4GY5 A;  4IUU A;  3RES A;  2LNH B;  3OB9 A;  4X1V A;  5LJ5 j;  5FU6 B;  5CIU A;  3V8J A;  3QYH B;  2AIR B;  1KSW A;  1N27 A;  2O01 E;  2A28 A;  3UWN A;  3H6Z A;  3M59 A;  2QA4 T;  2RMO A;  1GBQ A;  4QT7 A;  1WA7 A;  2DTO A;  1VQO A;  2KSS A;  1MNE A;  3M57 A;  3V7S A;  2KE9 A;  2XK0 A;  2DZ9 A;  4E7S A;  2E5Q A;  2KXD A;  3HL8 A;  6AT1 B;  7AT1 B;  1QVF S;  1NPP A;  2FG0 A;  2K9G A;  1WIE A;  3TQ7 P;  3VYH B;  4M7D F;  2DXT A;  2KRS A;  2GGR A;  1Q81 C;  1E6H A;  2NUT B;  4XTY A;  1VYU A;  4LDU A;  3KXT A;  3L42 A;  1Q7Y R;  1R0B G;  3DB3 A;  4OMM A;  2GQI A;  1W2B A;  4HVV A;  1SF9 A;  3EGD B;  4FM4 B;  1YIT Q;  2HBP A;  3S6W A;  4RTY A;  3OA6 A;  1PSF A;  4LNP A;  2IPO B;  1G83 A;  4P5N A;  5CVI A;  2XI9 A;  3CCL T;  2HAX A;  2D0Q B;  1VQM Q;  3G6E A;  1M3A A;  1D0Z A;  3NTI A;  2JVV A;  5GAN 3;  3MET A;  2ZAE A;  2DJZ A;  4MZM A;  3A98 A;  1M3C A;  4R55 A;  1RAH B;  4DBR A;  2FYK A;  3VUB A;  1KD1 C;  4HT9 A;  2OTJ A;  1B34 B;  1KG1 A;  2MI6 A;  1NZ9 A;  4BDZ A;  1OOT A;  3CCV A;  1GCP A;  4FIB A;  3CBP A;  1TH7 A;  2K3X A;  2R5A A;  5GAN 6;  3QDR B;  1GFC A;  4JRK A;  3EG3 A;  1W6X A;  1X2K A;  3DKM A;  4LUE A;  3H41 A;  3VRY A;  3QBY A;  1VQL Q;  5FW9 A;  3G7Z A;  4C92 G;  2EGA A;  4MML A;  4M77 E;  1JJ2 P;  4C92 B;  2VGN A;  2LX7 A;  5GMK e;  2KVQ G;  2O9S A;  4Y28 E;  4M7A D;  3MO8 A;  2JS0 A;  1UG1 A;  2JTM A;  2LJ0 A;  5GJV B;  3OYL A;  4LDW A;  1NJI U;  2X4W A;  5D7U A;  2X9H A;  4M4Z A;  2C06 A;  3JCM X;  2JNG A;  2NLU A;  1E6G A;  1VYT A;  3QO3 A;  2P0Q A;  2FO0 A;  2DF6 A;  3CCE Q;  2G6F X;  1M3B A;  1D1C A;  4JPB W;  3H8Z A;  3I56 A;  2PUK B;  1M8M A;  1RL2 A;  3CC2 T;  3HFN A;  2KYM A;  4M78 D;  3JCM b;  1JU5 C;  2J6K A;  3PT9 A;  3CCM A;  1K73 C;  5A2Q E;  1UHC A;  3I55 A;  1OPK A;  1VIE A;  2QK0 A;  2H8H A;  4OB1 B;  1BI2 A;  4CC7 A;  2JUF A;  4DEX A;  1X69 A;  3CCQ T;  5J39 A;  3J81 E;  1C1A A;  4R56 A;  3GLX A;  4HCB A;  4PJO G;  2V1Q A;  1YCS B;  4AT1 B;  4F14 A;  3QG1 A;  1ARK A;  4IIO A;  2MPX C;  4C92 E;  2YT6 A;  3HHT B;  1GFD A;  3E9F A;  2EYY A;  4ANJ A;  1JXO A;  1OX8 A;  2L3S A;  3CC7 T;  1JRI A;  2NUP A;  1Y57 A;  2XDD A;  1BU1 A;  3THK A;  1AZE A;  1K76 A;  2YRD A;  3NFC A;  4N4H A;  2PU9 B;  3X20 B;  4D8K A;  2RQR A;  4XAX B;  3CD6 T;  1YJN Q;  1VIF A;  2FL7 A;  2DEQ A;  1QKW A;  2RH2 A;  4WCI A;  3M0T A;  4KUD K;  5L8R E;  4XTX A;  4OB2 B;  1R77 A;  5D6W A;  3OSV A;  2F2V A;  2RK2 A;  1QWF A;  2MF2 A;  3CCJ A;  2EAY A;  3ZEH A;  5FU7 C;  1SRM A;  5CK9 A;  5J26 A;  5GMK m;  1BBZ A;  1RAE B;  4C5H A;  2DL4 A;  4M7A C;  3G1J A;  1Y07 A;  5IHN A;  3JB9 D;  3NGP A;  2QAS A;  1Q86 C;  3CEY A;  5LJ5 g;  1VQN T;  3NTK A;  4M77 F;  4DQ2 A;  2YSQ A;  3M0Q A;  1XOV A;  5GAO r;  3CC4 Q;  2DEU A;  3CXC A;  2VKN A;  1YCY A;  3LYI A;  3MKD A;  3HRS A;  1TU0 B;  4Z8A A;  1OEB A;  4PJL A;  4M75 D;  1LVK A;  3MEW A;  4CC4 B;  1RAF B;  1G3Y A;  4FYW B;  2KRN A;  4EMG A;  4M78 C;  1UEC A;  3QDF A;  3QZ5 B;  4N4G A;  2WSF E;  4E7Z A;  2QG9 B;  3A8M B;  1U5S A;  2XMF A;  2ZGW A;  3EFS A;  2CH4 W;  2QA4 A;  4PNO A;  5GJW B;  2E1H A;  3OYY A;  3JCM g;  1AWJ A;  3UDC A;  2NUP B;  1TG0 A;  1RLQ C;  4E6R A;  1M5Q 1;  2EQI A;  2RA2 A;  1D1B A;  2KYB A;  3OS1 A;  2K3Y A;  1CSK A;  4NOY A;  5HK3 A;  5GAN d;  1G3S A;  2MMP A;  2YWW A;  3VS5 A;  2K57 A;  4PK4 A;  3JB9 J;  1WJS A;  1Q81 R;  2OAW A;  2P0K A;  2HCK A;  3TCJ A;  2LQW A;  2HBW A;  1TUG B;  1UUE A;  4N0A A;  4BDY A;  3ASK A;  3CCS Q;  2NWM A;  2P4T A;  1WHJ A;  2ZPF B;  1KQ1 A;  5CCA A;  4IKF A;  2LZ6 B;  1HXD A;  2KRM A;  3MEU A;  1SKU B;  4LXC A;  4M7D A;  4D6W A;  1FYN A;  1ZX6 A;  2CZ6 B;  4JS5 A;  1NYG A;  2DBK A;  2RI2 A;  1X2Q A;  2V8K A;  3CCL A;  1WJR A;  5CQY A;  4EIK A;  5KE2 A;  3LX7 A;  1LJO A;  2ZPB B;  4A4G A;  4KUI A;  1WHK A;  3LGF A;  4PJM A;  2VAS A;  3RMQ A;  1MND A;  4J9G A;  4A4K A;  5C6S A;  3C95 A;  5L23 A;  1M90 R;  1KD1 R;  1K0X A;  5IAY A;  1OZ2 A;  4X9D A;  4RTT A;  3RKW A;  2YRC A;  4ELY C;  1AWO A;  3T9N A;  5GAO p;  2VWF A;  3LH0 A;  2KI7 A;  4M7A A;  3TVT A;  3A8O B;  3CBO A;  3UF4 A;  1M8V A;  3FJ5 A;  2J6F A;  1TUC A;  1S72 Q;  4X9C A;  4E7K A;  4FT2 A;  3BW1 A;  3CCR Q;  1IO6 A;  4QQD A;  2F2X A;  5GAN 5;  3MCA B;  4KUL A;  3P8B B;  1YBY A;  4EDU A;  1M2O A;  2BZY A;  1PWT A;  3VV0 A;  2OTL Q;  1CKA A;  2CZ0 B;  4HVW A;  1UGQ B;  1T0J A;  1WI7 A;  2HQX A;  2QQA A;  3CCE T;  3TRE A;  2DL5 A;  3OW2 A;  3MPU B;  1PKS A;  1NJI C;  2A7Y A;  1NG2 A;  2RHY A;  3FRN A;  1OYX A;  4C5I A;  3V7C A;  1GXI E;  3M53 A;  4JZ3 A;  2C0I A;  2LJ1 A;  5IHI A;  4M7D B;  3OYI A;  2QEX Q;  3SWN A;  5KE3 A;  1PCX A;  2DL3 A;  3WVE B;  1KIK A;  5GAN h;  3ZL7 C;  5LJ5 e;  1YJW Q;  3JRZ A;  4C0D B;  3CC2 A;  1FXX A;  3P8D A;  1VQ6 Q;  3J7A F;  1K73 R;  1KQS A;  5A0L A;  2E65 A;  3WVD B;  3OYB A;  3OYF A;  8ATC B;  2GFU A;  3CCU T;  3OS2 A;  2CT4 A;  5CAI A;  4QVZ A;  1W2B S;  4PLL A;  1K9A A;  3TSZ A;  3RBB B;  4Z89 A;  2RF0 A;  3CCQ A;  4FT4 A;  4PJO D;  4C0Z A;  2F69 A;  1WLP B;  2BUD A;  3EG9 A;  4AFU C;  3EHR A;  2CSQ A;  3FLG A;  3MP8 A;  2L3R A;  1YJN T;  2LCL A;  2A0F B;  3RR6 A;  2JMC A;  3OYN A;  1VQ9 T;  1IZ6 A;  3CC7 A;  1FMW A;  2FVU A;  4KBM B;  2CUB A;  4B6M A;  4Y91 A;  4ZN1 A;  1VQK Q;  4NL3 A;  1KFZ A;  2JT4 A;  1PRL C;  2RHX A;  2JN0 A;  3VS4 A;  3CD6 A;  4LD9 K;  1AHJ B;  4M7D E;  2PVO B;  3CMA Q;  4E47 A;  2E64 A;  2RJE A;  3RNJ A;  2PTK A;  3CC4 T;  3HRU A;  4ZTJ A;  3VS3 A;  3EGU A;  1YHQ Q;  1AZG B;  4M75 A;  1VQ4 Q;  1IB8 A;  1ZSZ B;  5KCH A;  1P92 A;  3JCM c;  1YI2 Q;  2ZCF B;  2AK5 A;  3M0R A;  4J83 A;  3SWN B;  4RCC A;  2VVK A;  2QDL A;  2J05 A;  1VQN A;  4BE0 A;  2E6N A;  2CSI A;  4C8Q D;  1WYX A;  2H3E B;  3JAM E;  2A37 A;  3OS5 A;  2L8D A;  1S1N A;  4O5V A;  2HSE B;  1T3L A;  5LJ5 f;  1LPL A;  2DIL A;  3BE3 A;  3H9N A;  5LJ3 j;  1M1K U;  2LDM A;  5AT1 B;  4BY6 B;  4ORZ A;  2A3L A;  3FB9 A;  1VUB A;  2MOX A;  1ABQ A;  3C12 A;  5GAM j;  2DE0 X;  3PIP A;  1Q86 U;  3VS7 A;  2ATC B;  2D0N A;  1QVF P;  5LL6 S;  1AWX A;  2JXB A;  1TOV A;  2QQS A;  2FRW A;  3MP1 A;  1QP2 A;  2ROT A;  1X6G A;  1H3H A;  4PLI A;  2K5F A;  2OAU A;  5FRO A;  2LTO A;  2R57 A;  3CCS T;  4PJO C;  3OYA A;  3JCM f;  2RJC A;  3I9Q A;  1IGU A;  2FPE A;  1MMN A;  2QGG A;  5GAO n;  1OU9 A;  4EMK C;  2V8J A;  2EJ9 A;  4J7I A;  4YTL A;  1TTH B;  2DIQ A;  1N8R U;  3LWI A;  1QWE A;  5GAN j;  1NM7 A;  2QDY B;  1NYF A;  2KK4 A;  2M51 A;  1UTI A;  2QQB A;  2L3P A;  2VV5 A;  4WTO B;  3ZFJ A;  2V1R A;  4JLI A;  2PUO B;  3EG2 A;  3SFM A;  1M9S A;  1QW1 A;  2EKO A;  3M0P A;  2KQW A;  3E2U A;  2AKL A;  2K5I A;  2HZY A;  3ER0 A;  1FMV A;  3GP8 A;  5FWC A;  1WJQ A;  4M77 G;  1K9M C;  2QGF B;  3L2Z A;  3VS0 A;  1S72 T;  3ME9 A;  2PQW A;  2O4X A;  4M77 B;  1KC8 U;  2C0O A;  1I0C A;  3CCR T;  2O88 A;  2HQE A;  4C8Q C;  1N9R A;  4JJD A;  2IVW A;  3QZ9 B;  4ZGJ B;  3UT1 A;  1JB0 E;  2C0T A;  4F17 A;  2OTL T;  1BK2 A;  4HKE A;  3QHS A;  1VQ7 Q;  1LNX A;  1Y96 A;  1RUW A;  3CXC S;  1C6V X;  4JRQ A;  2HDA A;  4M7A F;  5CO7 A;  1ZLM A;  2OI3 A;  3A8L B;  1QVP A;  3GPL A;  1FMK A;  2RQV A;  4M75 E;  2RD1 A;  2DM1 A;  3SB2 A;  2X51 A;  2KRO A;  3OMC A;  2XDP A;  1UJ0 A;  1Q82 R;  4F7U A;  3E9G A;  1VQO Q;  1VQ8 T;  1VQ6 T;  1IGQ A;  3CPW A;  4CI0 C;  2ED0 A;  2DVE A;  4M78 F;  2ZPH B;  1QVG P;  2GCX A;  4A53 A;  1JEG A;  4Q5W A;  2EQU A;  1HYO A;  2XID A;  1AT1 B;  3CBM A;  4L59 A;  1X27 A;  2YDL A;  3OBY A;  4HCC A;  1WHM A;  2M02 A;  3RUX A;  2G3R A;  2O2O A;  2R58 A;  1PKT A;  3OQ5 A;  3PMI A;  1YFN A;  3L2Q A;  2HMA A;  4LDX A;  5EC7 A;  3CCU A;  4F04 B;  2LT4 A;  4E7L A;  1FX7 A;  1SSH A;  4Y92 A;  1PRM C;  2RJF A;  1VQP T;  2DK3 A;  2RQU A;  4KGX B;  4OP0 A;  1ZSG A;  1M2V A;  1DJ7 B;  2CRE A;  2YLB A;  3OYJ A;  2CP2 A;  1G8X A;  4Z02 A;  3C94 A;  1YJN A;  1V1C A;  2K2V A;  2AZS A;  1Y96 B;  2IG0 A;  3CMA T;  2KT8 A;  1VQ9 A;  4J6Y A;  2WSE E;  3GBQ A;  1R8O B;  1ZUY A;  2FRY A;  4L6V 5;  1BI3 A;  1QP3 A;  1YNZ A;  1YHQ T;  1QVG S;  2J6O A;  1AD5 A;  1RAA B;  4DBF A;  1VQ4 T;  3G71 Q;  3J80 E;  4MZP A;  2E4H A;  2LQ8 A;  2QYZ A;  3X28 B;  4HA8 A;  2FPD A; 
#chains in the Genus database with same CATH homology
 3E19 A;  3MEU A;  4ZGD B;  1H64 1;  3LWH A;  1ZHI A;  4D6W A;  4A4E A;  4M7D A;  2CZ6 B;  3NTH A;  4M78 G;  1V29 B;  4BI8 B;  1OZ3 A;  4C92 A;  4JS5 A;  4BE1 A;  3MEA A;  4QVC A;  3JCM e;  2LX9 A;  2RI2 A;  2V8I A;  4ELZ C;  3F70 A;  5A0G A;  3CCM T;  5GAM f;  3UPU A;  2V8K A;  3M4Y A;  1WJR A;  3I55 T;  5CQY A;  3CCL A;  2XD0 A;  3CC4 A;  5KE2 A;  3V7R A;  4BE2 A;  2L89 A;  2JOY A;  3LX7 A;  4BAC A;  1LJO A;  3EFR A;  2ZPB B;  3A8G B;  4GLK A;  2DPP B;  4JUV A;  4A4G A;  4BD3 A;  4KUI A;  2KDS A;  3CPW S;  3DB4 A;  3OYD A;  3LGF A;  5EG2 A;  3G4S A;  3RMQ A;  4A4K A;  4BB7 A;  2L5Q A;  3OYC A;  1Y71 A;  5C6S A;  3C95 A;  4BI3 A;  2EQM A;  5IAY A;  4WF2 A;  3QYG B;  4M75 F;  1OZ2 A;  2ZZD A;  5IT9 E;  5CCA A;  4X9D A;  2AHJ B;  3RKW A;  1UGR B;  4OVA A;  3SDZ A;  1VQL A;  4ELY C;  3OW2 S;  3TU4 K;  3T9N A;  4XTU A;  2LT1 A;  4DA4 A;  5GAO p;  5M9O A;  1BI1 A;  2LNV A;  3HRT A;  3LH0 A;  4O6J A;  4XQ3 A;  5CKB A;  4M7A A;  1ZQ1 A;  1KQ2 A;  2M9U A;  4HT8 A;  3A8O B;  1M1K C;  2QEX T;  3CCE A;  3CBO A;  4TVR A;  1WNL A;  3PFS A;  1M8V A;  1N6A A;  4X34 A;  4DOV A;  3L2W A;  3QJY A;  4BI4 A;  5GAO l;  1YJW T;  1ZBX A;  3MEV A;  4VUB A;  4X9C A;  3JCM Q;  5I2M A;  4E7K A;  2X4J A;  4EPC A;  3L1A A;  2DIG A;  3BW1 A;  3GF5 A;  4FT2 A;  5CKE A;  2QQ9 A;  5LJ3 d;  4B9X A;  1O9S A;  4QQD A;  4XU1 A;  5GAN 5;  3MCA B;  4KUL A;  1Q7Y U;  1M90 C;  4M7D D;  3P8B B;  3JB9 I;  1YBY A;  2DD5 A;  4EDU A;  1WPY A;  4OF1 A;  4II1 A;  1NE8 A;  3V8L A;  4IUQ A;  2VC8 A;  3VV0 A;  4XU2 A;  2CZ0 B;  4XK8 E;  1UGQ B;  3LW5 E;  3TEE A;  3CCJ T;  1BYM A;  5GAM d;  1KQS S;  5GAN g;  1M1G A;  1YJ9 A;  2HQX A;  2QQA A;  4NS5 A;  4PJO A;  2DTH A;  4M77 A;  3CCE T;  3TRE A;  3G71 A;  5I21 A;  3GNF B;  4E7J A;  3EAE A;  3OW2 A;  3DLL A;  3OS0 A;  2RK1 A;  1RI0 A;  5KH6 A;  4J5Y A;  1NJI C;  2A7Y A;  3OSS C;  4IUR A;  3RIR A;  3M56 A;  2RHY A;  3JB9 G;  1W4S A;  3FRN A;  4OMF B;  4NL2 A;  2VXF A;  4EMK A;  5GMK h;  2VYT A;  1OYX A;  4C5I A;  2R5M A;  3V7C A;  2CZ7 B;  3M5A A;  2PVG B;  2CKK A;  1GXI E;  3M53 A;  5GAN 4;  5GMK l;  1N9S A;  3S3M A;  1G3W A;  2F5K A;  2O4X B;  2BKD N;  1N8R C;  3OYI A;  4A4H A;  4M7D B;  4IUT A;  4LDY A;  3LGL A;  3SWN A;  1D3B A;  4PKC C;  3L2R A;  5KE3 A;  3VU3 C;  3WVE B;  5GAN h;  2WSC E;  5LJ5 e;  5GAN 7;  1M4Z A;  5AYF A;  1VQK T;  3MHX A;  4MDW A;  3JRZ A;  4FSX A;  2EFI A;  2XHC A;  4C0D B;  1FXX A;  3M54 A;  3P8D A;  1VQ7 A;  3CC2 A;  3J7A F;  4GY5 A;  4IUU A;  3RES A;  3GNG A;  3VJP A;  1KQS A;  3HKS A;  3OB9 A;  5A0L A;  1Q82 U;  2E65 A;  2D9T A;  2YRV A;  3WVD B;  1YIT T;  1BIB A;  3OYB A;  2VXE A;  3OYF A;  2GFU A;  5LJ5 j;  1JBM A;  3CCU T;  3OS2 A;  5FU6 B;  5CIU A;  3V8J A;  3QYH B;  2LC4 A;  5CAI A;  4QVZ A;  1W2B S;  4PLL A;  1N27 A;  2GF7 A;  2RHI A;  2O01 E;  3UWN A;  2DAQ A;  4FU6 A;  1VQM T;  3H6Z A;  3M59 A;  3CCQ A;  2QA4 T;  2E70 A;  4C5E A;  4FT4 A;  4PJO D;  2VUB A;  4E7H A;  4M77 D;  2F5T X;  4C0Z A;  2F69 A;  2Y4X A;  2BUD A;  1S72 A;  2X35 A;  4ATO A;  1YI2 T;  3S3N A;  2DTO A;  4XU3 A;  3FLG A;  4C8Q A;  5FLX E;  4EMK C;  1VQO A;  2LCC A;  2KSS A;  3MP8 A;  2L3R A;  3CCR A;  4F7U G;  1YJN T;  3P8H A;  2LCL A;  3M57 A;  3V7S A;  2XK0 A;  1KHC A;  2DZ9 A;  5A0D A;  4F7U B;  2E5Q A;  3N5B B;  3OYN A;  3HL8 A;  2JTF A;  1VQ9 T;  1IZ6 A;  3JCM d;  3JB9 F;  1XTD A;  3CC7 A;  1QVF S;  1NPP A;  3LLR A;  2HNI A;  3KBG A;  2OTL A;  2FVU A;  4KBM B;  5LJ3 g;  3VYH B;  4M7D F;  2DXT A;  4Y91 A;  4ZN1 A;  2D6F A;  2QQR A;  4NL3 A;  1Q81 C;  2DTI A;  3CME T;  3QII A;  4L5G A;  1JJ2 S;  2DD4 A;  1U1T A;  2JZ2 A;  4XTY A;  2HD0 A;  4LDU A;  1BIA A;  2DO3 A;  3KXT A;  3L42 A;  2RHX A;  1K8A U;  3BY7 A;  3QXE B;  2JN0 A;  3CD6 A;  4A4F A;  3DB3 A;  5GAM g;  4PJO B;  4LD9 K;  1AHJ B;  1W2B A;  4ZGE B;  4M7D E;  2PVO B;  4FM4 B;  2HBP A;  4N0A C;  5D6X A;  1VQ5 A;  1K9M U;  3S6W A;  3OA6 A;  1PSF A;  5GAO m;  1VQL T;  4E47 A;  5DY9 A;  3VYG A;  4P5N A;  2E64 A;  2RJE A;  5CVI A;  2EYQ A;  2XI9 A;  4OGC A;  3CCL T;  4M7D C;  4RG2 A;  2HAX A;  1IRE B;  3CC4 T;  4EMK B;  3HRU A;  2RB6 A;  1EIF A;  1LOJ A;  2D0Q B;  3MP6 A;  4XTV A;  5C0M A;  3G6E A;  3PTA A;  4LD6 A;  4M75 A;  3JCM W;  4ZTJ A;  3CPF A;  2RHZ A;  5LJ3 h;  5DLO A;  3QKJ A;  2E6Z A;  2XDB A;  3NTI A;  5KCH A;  2JVV A;  4C0G A;  1P92 A;  1X01 A;  5GAN 3;  3MET A;  3JCM c;  4C0D C;  2ZCF B;  2DJZ A;  4MZM A;  4J83 A;  3SWN B;  1VQ8 A;  1VQ6 A;  1D3B B;  4UC4 A;  3FJP A;  3G4S T;  1QVF A;  4IUP A;  4R55 A;  1KC8 C;  4RCC A;  4N4I A;  5DM7 R;  5GAM h;  1YIJ A;  3SD4 A;  1VQN A;  5LJ3 e;  4BE0 A;  2E6N A;  1X6O A;  3L2V A;  4C8Q D;  2XG8 D;  3QSU A;  4HCZ A;  3JAM E;  2FYK A;  1JJ2 A;  2EQK A;  3OS5 A;  2L8D A;  4XTZ A;  3VUB A;  1KD1 C;  4HT9 A;  2XKO C;  4BUG A;  4O5V A;  2OTJ A;  1G5V A;  4C92 D;  5FU6 C;  1MGQ A;  4F7U F;  1B34 B;  4C5G A;  5I2S A;  2M16 A;  1NZ9 A;  2MI6 A;  2MWP A;  1KG1 A;  5GAM e;  4MMK A;  5LJ5 f;  2CS7 A;  4BDZ A;  5HKC A;  3CCV A;  4FIB A;  4DOW A;  5FRM A;  3CBP A;  1TH7 A;  3PNW C;  2K3X A;  5LJ3 j;  1M1K U;  3RKY A;  2LDM A;  2R5A A;  5GAN 6;  4BY6 B;  1I8F A;  2EWN A;  3QDR B;  2A3L A;  3FB9 A;  1VUB A;  3BFM A;  4JRK A;  4F7U E;  3HFO A;  3CCS A;  3C12 A;  4M78 A;  3ZBD A;  3DKM A;  3X25 B;  4PJO F;  5GAM j;  3QBY A;  1I4K 1;  3V8K A;  3PIP A;  3G7Z A;  1Q86 U;  4FL6 A;  2EQJ A;  4C8Q G;  2FHD A;  3M4G A;  4OB0 B;  2DZC A;  1M90 U;  5LL6 S;  3HP9 A;  4C8Q B;  1K73 U;  3GIB A;  4M7D G;  2QQS A;  1H3Z A;  4C92 G;  1VQP A;  4MML A;  4PJO E;  3MP1 A;  1WQW A;  1QP2 A;  3PMT A;  4M77 E;  2VGN A;  4C92 B;  5GMK e;  2KVQ G;  3BDL A;  4PLI A;  4Y28 E;  1YJ9 T;  4M7A D;  2K5F A;  3MO8 A;  2CZ1 B;  2JTM A;  2OAU A;  5FRO A;  4C0F A;  5CKF A;  3FC3 A;  2LQK A;  3G71 T;  2LTO A;  2Y4Y A;  1FWZ A;  2R57 A;  3A8H B;  3CCS T;  4PJO C;  3OYL A;  4LDW A;  4JRI A;  2BIV A;  1PSE A;  3A5Z B;  4M77 C;  3R6O A;  3OYA A;  1NJI U;  2X4W A;  1I81 A;  3JCM f;  2RJC A;  3M55 A;  5GAN e;  4RMO A;  2GFA A;  3CMA A;  2CGH A;  5GMK j;  3PIO A;  2C06 A;  3JCM X;  5GAO n;  1HK9 A;  2JNG A;  2NLU A;  2ZPG B;  2RI3 A;  3X26 B;  2V8J A;  2EJ9 A;  2CYZ B;  2P0Q A;  3QO3 A;  4J7I A;  2EJG A;  4YTL A;  2DIQ A;  1U8R A;  1N8R U;  1YHQ A;  3RMS A;  5GAN 8;  4QVD A;  2RO0 A;  1M1F A;  4IUV A;  3S3O A;  5LJ5 d;  3LWI A;  2H3J A;  3RKX A;  5GAN j;  3H8Z A;  3I56 A;  2MWO A;  2PUK B;  2E10 A;  2XIC A;  4QQG A;  4M7A G;  3SWN C;  2EJF A;  1XQH A;  5DLQ E;  4M7A B;  1RL2 A;  1U1S A;  2QDY B;  2KK4 A;  3URG A;  3HFN A;  3OYH A;  1VQ7 T;  3CC2 T;  1BI0 A;  2QQB A;  4M78 D;  3JCM b;  1O75 A;  2VV5 A;  3PT9 A;  3ZFJ A;  3CCM A;  2DXC A;  5A2Q E;  1K73 C;  3I55 A;  4JLI A;  4B9W A;  5FRN A;  1VIE A;  4OB1 B;  4J6W A;  4C8Q F;  3BDU A;  1BI2 A;  2DKG A;  2PUO B;  3JSC A;  3SFM A;  1M9S A;  3L2U A;  1QW1 A;  2EKO A;  2KAF A;  2KQW A;  2RI5 A;  3HSB A;  2JUF A;  4C92 F;  2K5I A;  4J6X A;  3VKI A;  4BY6 C;  3CCQ T;  3WXM B;  5J39 A;  3ER0 A;  5GAN 2;  5GAO q;  3J81 E;  3GP8 A;  2QTX A;  4R56 A;  1WJQ A;  3GLX A;  4HCB A;  2I2L A;  4PJO G;  4RKU E;  4C8Q E;  4M77 G;  1K9M C;  3L2Z A;  2XU8 A;  1S72 T;  3ME9 A;  2PQW A;  1WQ7 A;  2O4X A;  3QG1 A;  4M77 B;  3RER A;  1KC8 U;  1VQO T;  4C92 E;  1UGS B;  4MZT A;  2B8A A;  3HHT B;  3CCR T;  3HPW A;  2PVD B;  3E9F A;  4M78 B;  4RCB A;  2HQE A;  5IN1 A;  4C8Q C;  2X4Y A;  3C4S A;  1N9R A;  4ZN3 A;  2IVW A;  1BKB A;  3QZ9 B;  4J7F A;  5D6Y A;  1JB0 E;  2Y90 A;  3UT1 A;  4ZGJ B;  5GMK i;  3JCM P;  4MDX A;  2RJD A;  3CC7 T;  3Q1J A;  1UGP B;  1JRI A;  4C92 C;  2OTL T;  4OGE A;  2QEX A;  2XDD A;  4HKE A;  2K4Y A;  3QHS A;  3NFC A;  1Q81 U;  4N4H A;  2PU9 B;  4V2S A;  5CKD A;  1LNX A;  2M0O A;  3X20 B;  1YJW A;  1Y96 A;  2LVM A;  3JB9 H;  4QQ6 A;  3CXC S;  4JRQ A;  5HY6 A;  5HK0 A;  4XAX B;  3CD6 T;  1NPR A;  4M7A F;  1VIF A;  2FL7 A;  5CO7 A;  2DEQ A;  2DXU A;  4PL6 A;  2RH2 A;  5J3B A;  1Q7Y C;  1QVG A;  1VQ5 T;  4XU0 A;  4KUD K;  5L8R E;  4XTX A;  3A8L B;  4OB2 B;  1QVP A;  4JRP A;  4A54 A;  1OI1 A;  2KY9 A;  3OSV A;  5D6W A;  3GPL A;  2RK2 A;  2YHT A;  4JJN K;  2MF2 A;  3INZ A;  3CCJ A;  3SB2 A;  2EAY A;  2RD1 A;  4M75 E;  5FU7 C;  3ZEH A;  4M7A E;  4J8O A;  3E1S A;  3G6E T;  3OMC A;  5CK9 A;  4ZTF A;  4CRI A;  3OMG A;  5J26 A;  5GMK m;  2XDP A;  4C5H A;  5CR2 A;  1MHN A;  5CKH A;  4M75 C;  4F7U A;  4M7A C;  3E9G A;  1Y07 A;  5GAN f;  1VQ8 T;  3JB9 D;  1VQ6 T;  1X75 C;  1Q86 C;  3CPW A;  1WGS A;  3CEY A;  3O8V A;  4XTW A;  5LJ5 g;  2K5L A;  4CI0 C;  1YIJ T;  1VQN T;  3NTK A;  4M77 F;  4DQ2 A;  3OBW A;  2DVE A;  1XOV A;  2M1H A;  2P0P A;  4M78 F;  1Y7X A;  4ME7 A;  5GAO r;  3M9Q A;  1KD1 U;  2ZPH B;  3KUF A;  2RM4 A;  1YCY A;  3CXC A;  3FEO A;  2OTJ T;  2GCX A;  2QXF A;  4A53 A;  3LYI A;  3JCM V;  4QW2 A;  3HRS A;  3CCV T;  3QJ6 A;  4Q5W A;  3OY9 A;  1VQK A;  2E41 A;  3OYG A;  2EQU A;  3FIF A;  3QPH A;  4M75 D;  2XID A;  4M78 E;  3CBM A;  4L59 A;  2E12 A;  4JLG A;  3MEW A;  1Q82 C;  3OBY A;  4HCC A;  1G3Y A;  3RUX A;  1YIT A;  2EIF A;  2G3R A;  2R58 A;  3OQ5 A;  5CQX A;  4EMG A;  5LJ5 h;  4M78 C;  3PMI A;  3GOX A;  3OYE A;  3L2Q A;  4N4G A;  3QZ5 B;  3CCU A;  4LDX A;  4E7I A;  2WSF E;  2LRQ A;  1XNI A;  2LT4 A;  3PGG A;  4E7L A;  1FX7 A;  1UB4 A;  3A8M B;  3JCM J;  2RJF A;  2QI2 A;  4KT0 E;  4OB3 B;  2ZGW A;  2DK3 A;  2MAM A;  3EFS A;  5FU7 B;  1VQP T;  2QA4 A;  3OYK A;  1VQM A;  2YLC A;  4OP0 A;  3FDR A;  4PNO A;  1VQ4 A;  2E1H A;  3OYY A;  3JCM g;  3UDC A;  3X24 B;  2X4X A;  2ZPE B;  1DJ7 B;  4M75 G;  2YLB A;  4RG8 A;  1YI2 A;  3OYJ A;  4M75 B;  1M5Q 1;  2RA2 A;  1I5L A;  1B34 A;  4Z02 A;  3C94 A;  1YJN A;  2K2V A;  3OS1 A;  2K3Y A;  2KMT A;  4NOY A;  2RHU A;  3VUZ A;  5KCO A;  5HK3 A;  5GAN d;  4JS4 A;  4EMH A;  3AHU A;  1G3S A;  1Y96 B;  2WAC A;  2MMP A;  2IG0 A;  3CMA T;  1VQ9 A;  2K57 A;  4J6Y A;  2WSE E;  2FB7 A;  3JB9 J;  1R8O B;  1WJS A;  2GQV A;  4LDV A;  2VGM A;  2P0K A;  2ZPI B;  1SSF A;  4L6V 5;  1BI3 A;  3TCJ A;  1QP3 A;  3M58 A;  1UEB A;  3CME A;  3OYM A;  1YHQ T;  1QVG S;  1VQ4 T;  3QUI A;  4JDS A;  3J80 E;  1K8A C;  4N0A A;  3DLM A;  4MZP A;  4BDY A;  3JCM h;  2LQ8 A;  3ASK A;  3I56 T;  2P4T A;  2ZPF B;  1KHI A;  1G3T A;  2DXB A;  5LJ3 f;  1KQ1 A;  3X28 B;  4IKF A;  4HA8 A;  1HXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...