2JN7A

Northeast structural genomics consortium target er411
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
105
structure length
105
Chain Sequence
MSNTTWGLQRDITPRLGARLVQEGNQLHYLADRASITGKFSDAECPKLDVVFPHFISQIESMLTTGELNPRHAQCVTLYHNGFTCEADTLGSCGYVYIAVYPTQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of E.Coli hypothetical protein YFJZ
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords protein yfjZ
total genus 9
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06154 CbeA_antitoxin CbeA_antitoxin, type IV, cytoskeleton bundling-enhancing factor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2jn7A01
1Y28A 3OLOA 1XFNA 4HJ3A 2INWA 3A0RA 1LT0A 1NWZA 2YKHA 3LYXA 3MR0A 4JGPA 1S4SA 2PR6A 4GHIB 4HI4A 3T50A 4HJ6A 2PYRA 1T1CA 3H7WA 2WKPA 1TS0A 3H82A 1N9OA 3IBRA 3F1NB 4I3JA 4WL9A 5HDCA 1UWPX 4RQ9A 3BY9A 4BBUA 1N9NA 4NXFA 2D01A 5F68A 1G28A 2I9VA 4EETB 3LICA 4LRXC 5I5LA 4YWZA 2ZOHA 1V9ZA 5EFWA 5HWVA 3ZQ5A 2V9AA 1TS8A 2KDKA 4HH2A 1OTDA 4L9FA 5HWTA 2PR5A 1MZUA 1XJ3A 2A24A 3D72A 2PDRA 3CLOA 3IS2B 4HJ4A 2V0WA 2W0NA 1OJ5A 3C8CA 3LIAA 4HIAA 2Z6DA 4JGQA 5TBMB 1OTAA 1XJ4A 4I38A 1T19A 2QJ5A 4H6JB 4MN5A 5F69A 4EEPA 3E4PA 3FG8A 4WN5A 2ZOIA 3MQOA 1S1YA 2EA9A 2V1BA 1DP8A 3RTYA 3VOLA 1OTEA 2R78A 4LRZE 3UB6A 3P7NA 3VE3A 1OT6A 1TS6A 3BY8A 5A8BA 2JN7A 5TBMA 4JGOA 3LIDA 3C2WA 3GDIA 5HWWA 3MJQA 4HQAA 3K3DA 2J80A 3H7WB 3H82B 1D7EA 2L4RA 1LSVA 3NOPC 2W27A 5DJUA 4LLOB 2QWSA 3MXQA 5HD5A 4F3LB 1GSXA 5J4EA 1GSVA 1WA9A 3VE4A 2QHKA 1TS7A 2V1AA 1DRMA 2GJ3A 2WKRA 3B33A 4HH3A 4WLAA 5DJTA 4EEUA 5HZHA 1DP9A 3HJKA 2K7SA 2OWHA 5AVFA 3LI9A 3LIFA 3E4OA 4GHIA 4BBTA 4MN6A 4HY8A 1XJ6A 2VV6A 3NJAA 4BBVA 3A0VA 5G4YA 5HDDA 3NOTC 2WKQA 1ODVA 4NXGA 1S66L 1EW0A 3CAXA 3PHYA 4F3LA 5HSQA 3UB7A 5J3WA 2D02A 4PKYA 2B02A 4I3AA 4L9GA 1OJGA 3MFXA 4WUJA 1LSXA 3UB8A 4DJ2A 3LI8A 2QJ7A 2VEAA 3LIEA 4EW7A 5HD3A 4R3AA 5F6AA 1F9IA 3ICYA 3RH8B 1OTIA 4HHDA 3UMEA 1T18A 4R70A 3F1NA 4EERA 5IS1A 5G4ZA 1XJ2A 4HP9A 4XT2A 1KOUA 3F1OA 5IU1A 4I3IA 3UMDA 2ZBBA 4EESA 4NXEA 1D06A 3NOUC 2BASA 4L9EA 3UE6A 2VV8A 1V9YA 1F98A 2L1MA 3CWFA 5F5YA 2VLGA 3IS2A 2YKFA 1S1ZA 2QKPA 3MQQA 4LRYC 1BYWA 4HOIA 2L0WA 4I5SA 3ULFA 4H6JA 3H9WA 1OT9A 4KUKA 4K08A 3FC7A 3EWKA 1LL8A 2H28A 2PYPA 4R6LA 5DKKA 3GECA 1S4RA 1N9LA 1T1BA 1LSWA 2OWJA 3PYPA 2PD7A 3F1PA 4HNBA 4KUOA 2Z6CA 5DKLA 4EXOA 2M1CA 2OOLA 1GSWA 3EEHA 2PD8A 2P7JA 3K3CA 4DJ3A 4GS9B 4R38A 3BWLA 2KX6A 3HJIA 4M4XA 5HDSA 3NHQA 5J7EA 3F1OB 3E4QA 1JNUA 1X0OA 1S67L 3UB9A 4WF0A 1UWNX 4EQ1A 1P97A 1OTBA 4KQDA 5KIZA 3F1PB 1VB6A 2A24B 4NXBA 1T1AA 2PHYA 4XT2B 4I39A 1DP6A 4PKYG 5AVEA 2CMNA 4LPZA 4B9OA 4GS9A 3SW1A 4GCZA 4E04A 3LUQA 2VV7A 1UGUA 3KX0X 3LIBA 3G6OA 4GW9A 2HV1A 1P0ZA 4HP4A 2JHEA 3A0SA 2V0UA 1XFQA 4JGRA
chains in the Genus database with same CATH superfamily
1Y28A 4KQRA 4Y15A 1LT0A 3IBJA 4BL3A 2PR6A 4LV0A 1IYPA 4WL9A 1YLWA 1G6AA 3WS5A 2C6WB 3G34A 2H5SA 1GHIA 5HWTA 5FQMA 4MEZA 3SH9A 3LIAA 5TBMB 1XJ4A 2ZC4B 1LHYA 2XSSA 3VFFA 5E2FA 3ITAA 1KDSA 1DP8A 4NETA 1FQGA 1NZOA 1W7FA 2R9WA 3P01A 5L10A 4GN2A 3BJNA 3JPUA 4WZ5C 1SKOB 3A3FA 3LFVA 3CITA 1XGJA 1BTLA 2JKRI 3ZVTA 2V1ZA 3C7UA 3TJZC 2D02A 4I3AA 3PBRA 3MFXA 4WUJA 3VMAA 3E0YA 2K31A 2P04A 1W8QA 4EERA 3EEAA 3S22A 3IXGA 1L0EA 2J3WA 3UB5P 5EVIA 1K55A 2JKGA 4I5SA 4EWFA 5DFYA 4S2MA 3D9YA 2Y2OA 4HNBA 3VE4A 2DMWA 1S0WA 3G2YA 3BRMA 4UEYA 1P97A 4KQDA 5HFOA 1OPXA 3QP2A 1Y4OA 1L0DA 3RFBA 4Y17A 4LFUA 4IUHA 3OLOA 1YPRA 1WYCA 2ZQDA 5L07A 3IF5A 1S4SA 4KZ8A 4MBFA 1ZG6A 1N9OA 3E2LA 1N9NA 3A3DA 1H8YA 5A91A 1V9ZA 2XROA 3MZEA 2PR5A 2A24A 3O87A 4JPMA 1IKGA 4EEPA 4ZDXA 4KZBA 3FPWA 4QJGA 3MQOA 1MY8A 3N8RA 1D1JA 1N4OA 1K4EA 2C5WB 1BLPA 3UDFA 2HZ5A 1D7EA 5CGSA 5DJUA 1E3UA 1WA9A 3BW6A 3VSKA 4WBGA 2GJ3A 2OLUA 1DP9A 3ZYTA 5EVID 4MN6A 1YSPA 3NJAA 4CPKA 3LR4A 4R3BA 2E8IA 2GZAA 4PKYA 1PIOA 1LSXA 2B5RA 5F6AA 2X01A 4FTXA 5CX7A 4LGWA 5HPIA 3OCLA 1BT5A 2EWWA 5FASA 3S4XA 1O7EA 2J3TD 4X69A 1OT9A 3GECA 3SS4A 2HJEA 3EEHA 3NECA 3UPPA 3F1OB 1LLBA 1JNUA 4ID4A 4EQ1A 1ZHHB 2O9CA 2H10A 5EV0A 5AVEA 4LPZA 4E04A 3UPNA 2Y2GA 3ZCZA 3PAEA 4HJ3A 2QMIA 4F94A 2INWA 3ZG7B 1YSQA 2IWCA 4O8GA 4O0PA 2M7UA 2PYRA 4NG2A 1G5UA 5CHMA 5GLBA 3D72A 4OLGA 1FIKA 3VFHA 3ZHHA 4PM6A 5HPFA 1YM1A 1K0KA 2QJ5A 3SS5A 5FEFA 4UAAA 4JXSA 5FDHA 3S7QA 3BFCA 1DJBA 3V50A 4P87A 4GB7A 4UQIS 3L7HA 3BFGA 4GLQA 2ZM2A 3N7WA 3KSIA 5TR7A 2VA0A 3R7WA 3OPLA 1CF0A 3CPTA 4GZBA 2OWHA 4BBTA 3KO6A 3TG9A 1VQQA 1EW0A 3PHYA 3UPOA 3PAGA 5CHUA 1M40A 4OPYA 2QJ7A 1YQSA 5HD3A 4R3AA 3ICYA 2HDSA 3C4OA 4XT2A 3AGFA 4KZAA 3LCEA 1W8YA 5FDSA 4N1HA 4AFIA 4JXVA 4IEDA 2W3EA 4MCWA 1U60A 2RL3A 4R4SA 2H28A 2CC1A 3T4JA 3PYPA 1P9RA 1W63M 3QNBA 4OKPA 1L3LA 3C7VA 5HDSA 4WEJA 2ZD8A 4E3NA 3VOYA 3VOZA 5MC7A 1XPBA 2NUPC 1G68A 2J9OA 3CZDA 1A0KA 3HVFA 1KGFA 3NIAA 3PBNA 1P0ZA 1JTGA 3MBZA 3LR0A 1XFQA 5G18A 4S2NC 3S7NA 3UO9A 3GTCA 2X02A 4O7DA 3PBSA 2WKPA 5AQAA 4U0TA 3CJMA 1XX2A 4WMCA 1TS8A 5FQKA 4JBFA 1DJAA 2V0WA 2K2NA 2DCFA 1IYQA 5L09A 4X53A 1CEFA 2EX9A 2J80A 3U4LP 3K2NA 2W27A 4QY6A 3DTEA 4OQIA 3NDEA 4X25A 4C75A 2K7SA 3FYZA 4E3JA 1MC0A 4P0MA 4NXGA 4L9GA 5A93A 3NY4A 4WMCD 1VM1A 2JKFA 3MXRA 3WS2A 5KSHA 2BASA 3BQ8A 3T4OA 2YKFA 1KDWA 2GX5A 3FC7A 2ZQCA 5DKLA 2M7VA 1CK3A 2VJWA 5HL1A 3E4QA 3EGDC 5J8XA 4K91A 3NCKA 5DF8A 2WUQA 4R4RA 4K0WA 4E3IA 3IHAA 1GA9A 3WS4A 4KENB 2HV1A 1TEMA 4MBKA 4KZ3A 5KSCA 3IX8A 1FILA 1PNEA 1UWPX 3M6HA 3O88A 4N9KA 4HP4A 3IS2B 1G6OA 4N1XA 2VZWA 3MZDA 4PHTA 2XLNA 5BOHA 3EQVA 4N9LA 4Y5FA 2A49A 5IT5A 1PW8A 4BD1A 1LSVA 4CLCA 1KE0A 5HWVA 5F82A 2Q9NA 3R4KA 3LEZA 2VGLM 4S2JA 5FI7A 5M1AA 5G4YA 5TJJA 5KZHA 3IX3A 1LI0A 3B42A 2H0YA 4WZ4A 1I2SA 3LI8A 4BJPA 4UHUA 3UNWA 3G31A 3F1NA 5G4ZA 1XA7A 4LV3A 2PBYA 4ZJ3A 4DN0A 2HP5A 5FQIA 1TF1A 3T1RA 2XRNA 2VK3A 4C6YA 4K08A 3N8SA 4BWIA 3PR6A 2PYPA 5DKKA 3QP1A 1YAXA 4XUXA 4OPQA 5FI6A 4UA6A 1X0OA 1VETB 5FEGA 5CRFA 2PHYA 3CUEC 3SH8A 1ES5A 2PAVP 1TVFA 3FKVA 5KMWA 4WYYA 4X56A 1PWGA 4MLLA 4CJNA 4B4XA 1LL9A 4JGPA 1K57C 3BECA 2JKRM 2IWDA 2ZQ7A 3LICA 4LRXC 4YWZA 2ZL1B 2KDKA 3JYIA 5J3WA 1KVLA 1WE4A 4KG5A 4HESA 3MSHA 3IH9A 5D3OA 1GCEA 4OP5A 5A8BA 2EWVA 4HQAA 2ZM8A 3K3DA 4CLCC 4KZ6A 3VP2A 4XXRA 3B33A 2DRWA 5CECA 3EGXC 3IHBA 5U47A 1NRJA 1IYOA 2Y2PA 4MNRA 2X71A 3LY4A 3RXWA 3BFFA 3ZNYA 3B3XA 3WRZA 3Q7ZA 3UMEA 3PBTA 2HP9A 1L0GA 3TOIA 5EM0A 2HDUA 5IU1A 4L9EA 5F5YA 2BTFP 3MQQA 4PAUA 3GSGA 1LSWA 4QB8A 5CGXA 5FA7A 4E6XA 2EXBA 3F1PB 4NXBA 4ZRRA 1GHPA 3PBQA 5CEBA 2OV5A 4IJGA 3T4KA 2WGWB 3NDGA 4BD0A 3T4LA 5CERA 4YFMA 4E3KA 3MXSA 2YKHA 1K6RA 3BFDA 4ZBEA 4G3VA 5AQBA 4FD8A 4UA7A 5CXWA 1Z6FA 4LV2A 1MZUA 4Z1WA 1BLHA 1YMXA 5CTMA 5GLAA 1CQAA 4WN5A 4B93A 1XGIA 4MBHA 1HZOA 4DF6A 1XP4A 4Q8IA 3MJQA 5DTKA 4E6WA 3HLWA 1K25A 3H7WB 3H82B 2L4RA 2Y2HA 5EUAA 4WLAA 1NLYA 1XXMA 3IX4A 3LIFA 3NULA 5GLCA 2PBDP 1PZPA 3Q7VB 1YLTA 4JKTA 3GV9A 3CAXA 3W4OA 3BLSA 1P9WA 3G4PA 2QYBA 1F9IA 4HHDA 1RCJA 3WRTA 3MMHA 1KOUA 4I3IA 1YLJA 4NXEA 5FQJA 2J8YA 3IS2A 4R1GA 1ERMA 2WYXA 5FAQA 3Q82A 3EWKA 1QMEA 2Z2MB 3UE1A 4DJ3A 3UY6A 3BWLA 4FCFA 5FQQA 4I39A 2W1TB 2ZQ8A 4DE2A 5I94A 3DAVA 2ZC6B 4JF4A 2W3FA 2A3UA 1VHMA 2A2LA 4Y7PA 3ZNTA 4PM8A 4S2KA 3H7WA 2QPNA 1TS0A 3DWZA 3H82A 3P98A 5F68A 4UA9A 1IFQA 4L9FA 1BZAA 3LEQA 4HJ4A 2Y55A 2W0NA 2Z6DA 3DBAA 1H3QA 3DWKA 2KOIA 4CLCB 5A92A 3MFDA 1TDGA 2O0YA 3VE3A 3HLFA 1KE4A 5TBMA 2WADA 3MZFA 3GDIA 1ZKJA 4CLCE 3QP6A 4LENA 5E43A 2QWSA 4OOMA 2XGNA 4MDZA 1O07A 3N4IA 3IWIA 4GHIA 1PI5A 1RGYA 4BBVA 3IT9A 1ODVA 2B02A 4Y0UA 4DDYA 3UB8A 1C3BA 1XKZA 4KZ4A 1IOUA 1FCMA 5E2GA 4R0QA 3OPHA 2B18A 2EFUA 3C38A 5C5KA 3UE6A 1S1ZA 5L2FA 4FSFA 1SCWA 1LL8A 4R6LA 3ZG5A 1KGGA 4Y0TA 1K54C 3NI9A 5FATA 1MPLA 4WF0A 2A24B 3SZTA 3SW1A 3E2KA 3LUQA 1NRFA 4GW9A 2V0UA 3Q07A 2V2FF 1TDLA 3AGDA 1Q2QA 4HBTA 4ESPA 4ARZA 3ZVWA 4HJ6A 3VSLA 4RQ9A 2ACGA 3BM6A 5EFWA 1SHVA 3L9KA 1KGEA 3ZQ5A 1T19A 2W3DA 5CEDA 5HAIA 1FSWA 2ZOIA 1S1YA 2LB9A 3D3OA 3JVVA 2R78A 3HLEA 1VEUA 2PU2A 4DRTA 2VX8A 3G30A 1NXYA 3GRJA 3LI9A 1F5MA 3OBFA 4HY8A 1ONHA 2VV6A 4OLDA 4OQGA 3KYQA 1MWUA 2XA7M 4QU3A 3DTMA 3BQAA 3ISGA 2BG1A 1L2SA 3CUEA 3BEBA 1GHMA 2ZBBA 1D06A 1V9YA 1F98A 4HBUA 2XA7S 3OZHA 4NEED 2L0WA 4JF5A 1ZG4A 1W79A 2Y2IA 4R23A 1S4RA 3DTIA 2OOLA 2P7JA 4KG2A 3VV4A 3HJIA 4ETXA 3GMWA 1E3UD 2I72A 4YOFA 3W2ZA 4GCZA 2WAFA 3KSGA 2HPBA 4JGRA 3TRCA 1YMSA 2W1TA 2KLIA 3MKFA 4GDNA 3T50A 4HI4A 2ZM0A 3BY9A 5CGWA 2EX6A 5M19A 2ZC7A 2XF3A 5GHXA 2NUTC 4U3TA 4S2IA 3IQAA 2OAQ1 4EBPA 2ZQAA 4JGOA 5HWWA 2VKSA 5CHJA 3RXXA 3MXQA 5HZHA 2WKEA 4OONA 1RP5A 5EVEA 3LR3A 3NOTC 5HSQA 2JBFA 5EVIC 4A5RA 3ZG0A 2WGWA 3V3SA 3ZFZA 4P85A 3HL9A 1S6RA 4MMNA 4R70A 4HP9A 5HW3A 3V5MA 2ZC5B 1FR6A 1W5DA 2VLGA 3OPPA 4Y2FA 4EBNA 3QP4A 1FOFA 3SS3A 4MN7A 3F1PA 1PRQA 2XFSA 4EBLA 4KZ7A 1I5QA 2HDRA 4DMZA 4KQQA 5EVLA 4JF6A 1NZUA 3KX0X 4PMAA 3UE3A 3A0SA 3B47A 1F2KA 4NK3A 3MF0A 4RVAA 3LGOA 1T1CA 2W3HA 3FWLA 3JVUA 5DF9A 3IBRA 2E8JA 1JVJA 1H8ZA 2OSUA 3SOIA 4QHCA 4WZ5A 2BLSA 3HLGA 1OTDA 2VGLS 1BLSA 3W4QA 2ZQ9A 1J9MA 1IKIA 2WK0A 2FFYA 2OAP1 3ZG9B 3T1SA 3VP3A 2XEPA 3A3IA 2Y2QA 2J3TC 3T12B 3VOLA 4QD4A 1EWZA 1FR1A 4LRZE 1TS6A 3BY8A 4X55A 3IXHA 5GL9A 4LCMA 4LLOB 2ZC3B 3S1YA 5HD5A 3C4PA 4GD8A 1TS7A 2R9XA 5DTTA 2VGKA 4UQIM 1AXBA 3E4OA 1I2WA 4ZJ2A 5AQ7A 5HDDA 2Y2JA 4F3LA 3A3EA 4PM5A 3O3VA 4IVKA 1ES2A 4ARZB 4EW7A 1OTIA 1HTZA 1IEMA 1YLYA 2HJ9C 1OMEA 3NOUC 2WGIA 1PI4A 1ACFA 1AWIA 5HX9A 4P6ZM 4RYEA 1PZOA 4JLFA 1E25A 1T1BA 2XK1A 3DW0A 5EM1A 1CI9A 2KX6A 5EPHA 3LR5A 4G3KA 5KIZA 2JCHA 1T1AA 1HLUP 4GOGA 2CMNA 3HBRA 3IF6B 4K0XA 5EE8A 1YLPA 2VV7A 3LIBA 5HL6A 1SZVA 1NYYA 4BL2A 1YT4A 2IA2A 1K56D 1N9BA 4GHIB 5GLDA 1ZTUA 5HDCA 1MKIA 4E3MA 1ERQA 1NLZA 1ZC2A 3O86A 2ZOHA 3FKWA 3PBOA 2V9AA 1H8MA 1XJ3A 5F1FA 4EQIA 3C8CA 2ZMFA 4BENA 3WWXA 4PM7A 3T1XA 4H6JB 3UE0A 4Y13A 4IVIA 2EX8A 4GDBA 4OPRA 5GHYA 2EX2A 3TW8A 5E2EA 3T1QB 3QP5A 4GD6A 4BQMA 2O9BA 2QHKA 1DRMA 3CPTB 1FCOA 1ES3A 5DTSA 1CEGA 2OLVA 2WKQA 5F83A 2WKIA 1WYBA 2O9AA 2J9PA 4QPRA 1OJGA 1K6SA 1NY0A 1JWVA 4P6BA 1NJ4A 2PU4A 2Q0OA 3CMZA 3FPVA 1KE3A 3UDIA 2XFTA 4LV1A 3IXBA 5JYOA 2QKPA 4JXWA 3ULFA 4KUKA 1IYSA 1MWSA 3LO7A 2OWJA 2Z6CA 1SDNA 4M4XA 4RX2A 3MQ0A 4CLCD 3N6IA 5EECA 1EI5A 3IWOA 1UWNX 2PT7A 1OTBA 3ZG8B 4XT2B 2EXAA 1MKMA 2V20A 2JE5A 5AQ9A 1K55C 1TD5A 5L8MA 1BULA 1VEUB 2Y2NA 4GJ4A 1NWZA 3MR0A 4KG6A 1YLZA 4I3JA 1K56A 3F1NB 3UN7A 1MWRA 3AGEA 3KSFA 4Y0OA 4HH2A 3W4PA 4S2NA 3C30A 2LB5A 3MKEA 2DNSA 4S2OA 1OTAA 2Y59A 1K57A 5F69A 2GDNA 3IWQA 5DF7A 5E2HA 1OTEA 5FQ9A 2JN7A 4WELA 4D2OA 3IF6C 1GSXA 2MJ6A 2WKRA 4HH3A 3VP1A 2AVXA 3MS6A 3IXDA 1Q2PA 5IHVA 3OC2A 1XJ6A 3E98A 1J3WA 1BLCA 3OPRA 5EOEA 4DJ2A 4X1LA 2VEAA 1MWTA 3RH8B 1T18A 4EUZA 2JKTI 2G2UA 3WS1A 4ME4A 5FSRA 2Z2LB 2Y4AA 3HCYA 3QNCA 3CHWP 2P9VB 4Y3IA 2WZXA 2Y91A 1DJCA 4EXOA 4IHQA 2M1CA 2PD8A 2WKHA 4R38A 3Q81A 3LY3A 4GNUA 2JKTM 4XUZA 1VB6A 3M6BA 4Q0HA 1DP6A 5FL3A 5AJGA 4DE3A 2O99A 3WS0A 3HLDA 4QY5A 5HARA 4ZAMA 1ONGA 3V3RA 4YINA 1JWZA 4OVDA 3VP0A 1G28A 2I9VA 4OOYA 4E3OA 4OQ0A 4PPRA 2XQZA 3HLBA 3RJUA 3HUMA 5HAPA 5CTNA 2PDRA 3CLOA 5K5BA 4JGQA 4S2PA 4MN5A 1Z09A 1CI8A 3G32A 5HAQA 4X68A 2EA9A 2V1BA 3RTYA 3HUOA 1MXOA 4H8RA 2UV0E 3LIDA 1PWDA 1K54A 3C5AA 2ZL1A 3NOPC 1BUEA 4F3LB 3CG5A 1GSVA 4QWOA 5DJTA 3FV7A 2G2WA 2V8FA 3OCNA 1ESUA 2ZMAA 3ITBA 2RCXA 3A0VA 2ZLYA 2ZJ9A 1S66L 1YKDA 5FI2A 3PXPA 3KSHA 2XH9A 3UMDA 4X6TA 4EESA 3BFEA 2Y8HA 5LBRA 1BYWA 4HOIA 3KYZA 4H6JA 3UDXA 4HEFA 1M6KA 4PM9A 2P74A 1N9LA 3UB6A 4EU0A 4EV4A 2PD7A 3D4FA 5EVIB 4FH4A 4GS9B 3NC8A 4IBXA 3KYEA 5J7EA 3S7OA 1S67L 1VETA 4YNRA 2HF6A 4PKYG 3ZDJA 4B9OA 3EOIA 3GQZA 1BSGA 4R3JA 1FCNA 4ZJ1A 3T4TA 2GNXA 1NYMA 1JWPA 4DKIA 3R7WB 1XA1A 1IELA 4ETZA 3OOVA 1DY6A 4BBUA 3I7JA 4Q0JA 4EETB 1EROA 3BLMA 4NKPA 3HREA 4KZ5A 3QP8A 1OJ5A 1SKOA 3DTKA 4GKUA 3FG8A 4IUKA 3FZCA 5A90A 3P7NA 1OT6A 3BYDA 3CI6A 2HP6A 3TSGA 4DXCA 2B95A 3A3JA 3G35A 4KZ9A 5EOOA 5J4EA 4N92A 4BLMA 2EFXA 4D60A 2UWXA 5DVAA 3HJKA 2QZ6A 5AVFA 3HUNA 2G7UA 2V8CA 4B88A 1H5XA 4P6ZS 4DE0A 4M3KA 3Q1FA 3LIEA 3PTEA 1LL5A 3HLCA 3T4SA 4U0XA 1MBLA 2IWBA 3V67A 5GHZA 4RX3A 2H0TA 3O5YA 3CWFA 1SKFA 2W1RA 2HDQA 4C3QA 2Y79A 4DXBA 3P09A 1ES4A 4ZTKA 3SH7A 1Y54A 4Q0IA 3K3CA 3IF6A 1PWCA 3NHQA 2P08A 1SDEA 3NBLA 5M18A 4LCLA 2FFFB 2P9VA 1PFLA 1UGUA 3M2JA 4WEKA 3G6OA 4OP8A 2JHEA 4JXGA 3IH8A 4IBRA 1XFNA 4FOFA 3A0RA 3LYXA 4G3WA 1HVBA 2D01A 4NXFA 5I5LA 1QMFA 1JTDA 3VP4A 4B4ZA 4E3LA 1PYYA 2WZZA 5DFXA 4HIAA 2XD5A 3ZGAB 4II7A 4I38A 4Z9QA 3E4PA 5JYPA 4CQHA 3QHYA 4WM9A 2Q9MA 3C2WA 4DE1A 4DDSA 3G2ZA 4BMWA 2FZ0A 2JC7A 4S2LA 3GVBA 1FSYA 2V1AA 1W63Q 4KQOA 5FAPA 4EEUA 4EUVA 1ESIA 2Y2KA 3U2AA 1KVMA 1H0MA 4FH2A 5TFQA 2Y2LA 4OH0A 1ALQA 2FH5A 3UB7A 2XDMA 3M2KA 4X1MA 4L0LA 3V39A 3S7PA 1CJFA 5FAOA 2WGVA 4OPZA 1E4DA 5IS1A 3TE8A 1XJ2A 3F1OA 1LI9A 2J7VA 5TGFA 4FUWA 2VV8A 3W8KA 2L1MA 3EQUA 4LRYC 3H9WA 3N8LA 4RA7A 1RGZA 3T4QA 3Q7VA 2WAEA 1K4FA 3GR2A 4KUOA 2PRFA 4O01A 2ZMVA 1GSWA 1STZA 1L0FA 4OOLA 2HGVA 3UB9A 2XD1A 1GA0A 2VGJA 2Y2MA 2W3GA 2XR0A 1K38A 4GS9A 4OQHA 1PW1A 5F1GA 1HD8A
chains in the Genus database with same CATH topology
1Y28A 4GJ4A 1LT0A 1NWZA 3MR0A 3IBJA 2PR6A 4ARZA 4HJ6A 4I3JA 4WL9A 3F1NB 1UWPX 4RQ9A 5EFWA 3KSFA 4HH2A 5HWTA 3C30A 2LB5A 4HP4A 3IS2B 1G6OA 3ZQ5A 2VZWA 3LIAA 5TBMB 1OTAA 1XJ4A 1T19A 4PHTA 5F69A 2W3DA 2XSSA 2ZOIA 3EQVA 1S1YA 2LB9A 3D3OA 3JVVA 1DP8A 4Y5FA 1OTEA 2R78A 5IT5A 2JN7A 4WELA 3P01A 1LSVA 4CLCA 3BJNA 1GSXA 2MJ6A 2VX8A 2WKRA 5HWVA 3LFVA 4HH3A 3R4KA 3CITA 3LI9A 1F5MA 2JKRI 2VGLM 3OC2A 3OBFA 1XJ6A 2VV6A 4HY8A 5G4YA 5TJJA 3E98A 3B42A 3TJZC 2D02A 4I3AA 3KYQA 3PBRA 3MFXA 4WUJA 3E0YA 4DJ2A 3LI8A 4BJPA 2VEAA 2XA7M 2K31A 2P04A 3RH8B 3BQAA 1T18A 3F1NA 4EERA 3EEAA 5G4ZA 2JKTI 3CUEA 2ZBBA 4ME4A 4DN0A 1D06A 2J3WA 1V9YA 1F98A 3HCYA 2XA7S 1TF1A 4NEED 2L0WA 4I5SA 2XRNA 5DFYA 4Y3IA 4K08A 4BWIA 3PR6A 2PYPA 5DKKA 1S4RA 4HNBA 3VE4A 2DMWA 4EXOA 1YAXA 4IHQA 2M1CA 2OOLA 2PD8A 2P7JA 3VV4A 4R38A 3HJIA 4ETXA 4YOFA 1X0OA 4UEYA 3W2ZA 1P97A 2JKTM 4KQDA 1VB6A 2PHYA 4Q0HA 1DP6A 3CUEC 1OPXA 4GCZA 5FL3A 5AJGA 2O99A 3RFBA 3KSGA 4JGRA 4IUHA 3TRCA 3OLOA 2W1TA 2KLIA 4JGPA 1S4SA 3T50A 4HI4A 1N9OA 2JKRM 3BY9A 1N9NA 1G28A 2I9VA 3LICA 4LRXC 4YWZA 1V9ZA 2XROA 2KDKA 2PR5A 2A24A 5J3WA 2PDRA 3CLOA 5K5BA 4JGQA 2NUTC 4MN5A 4EEPA 3FPWA 3MQOA 2EA9A 2V1BA 3RTYA 2OAQ1 5A8BA 4JGOA 3LIDA 2EWVA 5HWWA 4HQAA 3K3DA 4CLCC 3NOPC 1D7EA 5DJUA 2VKSA 3MXQA 4F3LB 1GSVA 1WA9A 3BW6A 5DJTA 3B33A 2GJ3A 5HZHA 3OCNA 3EGXC 1DP9A 1NRJA 3ZYTA 4MN6A 1YSPA 3NJAA 3A0VA 3LR3A 3NOTC 3LR4A 1S66L 2GZAA 5HSQA 4PKYA 1LSXA 1YKDA 5F6AA 3UMEA 3PBTA 4MMNA 4R70A 5CX7A 3PXPA 3KSHA 4HP9A 5IU1A 3UMDA 5HPIA 4EESA 4L9EA 5F5YA 3OCLA 2VLGA 2EWWA 2Y8HA 5LBRA 3MQQA 1BYWA 4HOIA 4Y2FA 2J3TD 3KYZA 4H6JA 4PAUA 1OT9A 3GECA 1N9LA 3UB6A 1LSWA 4EU0A 4MN7A 2HJEA 2PD7A 3F1PA 3EEHA 4GS9B 5J7EA 3F1OB 1JNUA 3S7OA 1S67L 4YNRA 4EQ1A 3F1PB 4NXBA 4DMZA 1ZHHB 2O9CA 2HF6A 4ZRRA 3PBQA 4PKYG 5AVEA 4B9OA 3EOIA 4LPZA 4IJGA 4E04A 3T4TA 3T4KA 3KX0X 2GNXA 3UE3A 3A0SA 3B47A 3T4LA 4HJ3A 2INWA 3MF0A 3R7WB 4ETZA 2YKHA 1YSQA 4O8GA 4O0PA 2M7UA 2PYRA 3OOVA 1T1CA 2W3HA 3JVUA 5DF9A 3IBRA 4BBUA 4Q0JA 4G3VA 4EETB 4NKPA 1OTDA 2VGLS 1MZUA 3D72A 5HPFA 4Z1WA 1OJ5A 2OAP1 2QJ5A 3FG8A 4WN5A 4IUKA 4B93A 2J3TC 3S7QA 3VOLA 4LRZE 3P7NA 1OT6A 1TS6A 3BY8A 3CI6A 4UQIS 4GLQA 3MJQA 3H7WB 3H82B 2L4RA 3KSIA 2VA0A 4LLOB 5HD5A 5J4EA 3R7WA 1TS7A 4WLAA 4UQIM 1NLYA 3HJKA 5AVFA 2OWHA 3LIFA 3E4OA 4BBTA 2G7UA 3KO6A 5HDDA 4P6ZS 4F3LA 1EW0A 3CAXA 3PHYA 1P9WA 2QJ7A 3LIEA 2QYBA 4ARZB 5HD3A 4R3AA 4EW7A 1F9IA 3ICYA 1OTIA 4HHDA 4XT2A 3T4SA 3MMHA 1KOUA 4I3IA 2HJ9C 3V67A 4NXEA 3NOUC 3O5YA 3CWFA 4AFIA 3IS2A 2W3EA 4MCWA 4P6ZM 3EWKA 2W1RA 2H28A 3T4JA 2Y79A 1T1BA 3PYPA 1P9RA 1W63M 4Q0IA 3K3CA 4DJ3A 3BWLA 2KX6A 5HDSA 3NHQA 3LR5A 4WEJA 4G3KA 5MC7A 5KIZA 2P08A 2NUPC 1T1AA 4I39A 2W1TB 2CMNA 2VV7A 1UGUA 3LIBA 4WEKA 3G6OA 5HL6A 3PBNA 1P0ZA 2JHEA 3LR0A 1XFQA 3S7NA 1XFNA 2W3FA 4FOFA 3A0RA 2IA2A 3LYXA 4G3WA 1VHMA 2A2LA 4GHIB 1ZTUA 3PBSA 3H7WA 2WKPA 1TS0A 3H82A 5HDCA 1NLZA 4NXFA 2D01A 5F68A 5I5LA 2ZOHA 1IFQA 3PBOA 2V9AA 1TS8A 1H8MA 4L9FA 1XJ3A 4HJ4A 5DFXA 4HIAA 2V0WA 2W0NA 3C8CA 2ZMFA 2Z6DA 3DBAA 2K2NA 4I38A 4II7A 1H3QA 4H6JB 3E4PA 2KOIA 4CLCB 4CQHA 2O0YA 3VE3A 5TBMA 3C2WA 3GDIA 2J80A 3TW8A 3K2NA 4BMWA 4CLCE 2W27A 2QWSA 2FZ0A 2O9BA 4OOMA 2QHKA 2V1AA 4MDZA 1DRMA 1W63Q 4KQOA 4EEUA 4EUVA 2K7SA 3U2AA 4GHIA 4BBVA 2WKQA 1ODVA 1MC0A 4NXGA 2FH5A 3UB7A 2O9AA 2B02A 4L9GA 1OJGA 4QPRA 3UB8A 4L0LA 3S7PA 1IOUA 5IS1A 3TE8A 1XJ2A 3FPVA 3F1OA 2B18A 5KSHA 2BASA 3C38A 5C5KA 2VV8A 3UE6A 2L1MA 3BQ8A 3EQUA 3T4OA 2YKFA 1S1ZA 2QKPA 4LRYC 4FSFA 3ULFA 2GX5A 3H9WA 4KUKA 3FC7A 3T4QA 1LL8A 4R6LA 2OWJA 4O01A 4KUOA 5DKLA 2Z6CA 2M7VA 2ZMVA 1GSWA 1STZA 2VJWA 4OOLA 2HGVA 4M4XA 3MQ0A 3E4QA 4CLCD 3EGDC 3UB9A 4WF0A 1UWNX 2PT7A 1OTBA 2A24B 4XT2B 2W3GA 1MKMA 3SW1A 4GS9A 3LUQA 1TD5A 5L8MA 4GW9A 2HV1A 2V0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y28 A;  3OLO A;  1XFN A;  4HJ3 A;  2INW A;  3A0R A;  1LT0 A;  1NWZ A;  2YKH A;  3LYX A;  3MR0 A;  4JGP A;  1S4S A;  2PR6 A;  4GHI B;  4HI4 A;  3T50 A;  4HJ6 A;  2PYR A;  1T1C A;  3H7W A;  2WKP A;  1TS0 A;  3H82 A;  1N9O A;  3IBR A;  3F1N B;  4I3J A;  4WL9 A;  5HDC A;  1UWP X;  4RQ9 A;  3BY9 A;  4BBU A;  1N9N A;  4NXF A;  2D01 A;  5F68 A;  1G28 A;  2I9V A;  4EET B;  3LIC A;  4LRX C;  5I5L A;  4YWZ A;  2ZOH A;  1V9Z A;  5EFW A;  5HWV A;  3ZQ5 A;  2V9A A;  1TS8 A;  2KDK A;  4HH2 A;  1OTD A;  4L9F A;  5HWT A;  2PR5 A;  1MZU A;  1XJ3 A;  2A24 A;  3D72 A;  2PDR A;  3CLO A;  3IS2 B;  4HJ4 A;  2V0W A;  2W0N A;  1OJ5 A;  3C8C A;  3LIA A;  4HIA A;  2Z6D A;  4JGQ A;  5TBM B;  1OTA A;  1XJ4 A;  4I38 A;  1T19 A;  2QJ5 A;  4H6J B;  4MN5 A;  5F69 A;  4EEP A;  3E4P A;  3FG8 A;  4WN5 A;  2ZOI A;  3MQO A;  1S1Y A;  2EA9 A;  2V1B A;  1DP8 A;  3RTY A;  3VOL A;  1OTE A;  2R78 A;  4LRZ E;  3UB6 A;  3P7N A;  3VE3 A;  1OT6 A;  1TS6 A;  3BY8 A;  5A8B A;  2JN7 A;  5TBM A;  4JGO A;  3LID A;  3C2W A;  3GDI A;  5HWW A;  3MJQ A;  4HQA A;  3K3D A;  2J80 A;  3H7W B;  3H82 B;  1D7E A;  2L4R A;  1LSV A;  3NOP C;  2W27 A;  5DJU A;  4LLO B;  2QWS A;  3MXQ A;  5HD5 A;  4F3L B;  1GSX A;  5J4E A;  1GSV A;  1WA9 A;  3VE4 A;  2QHK A;  1TS7 A;  2V1A A;  1DRM A;  2GJ3 A;  2WKR A;  3B33 A;  4HH3 A;  4WLA A;  5DJT A;  4EEU A;  5HZH A;  1DP9 A;  3HJK A;  2K7S A;  2OWH A;  5AVF A;  3LI9 A;  3LIF A;  3E4O A;  4GHI A;  4BBT A;  4MN6 A;  4HY8 A;  1XJ6 A;  2VV6 A;  3NJA A;  4BBV A;  3A0V A;  5G4Y A;  5HDD A;  3NOT C;  2WKQ A;  1ODV A;  4NXG A;  1S66 L;  1EW0 A;  3CAX A;  3PHY A;  4F3L A;  5HSQ A;  3UB7 A;  5J3W A;  2D02 A;  4PKY A;  2B02 A;  4I3A A;  4L9G A;  1OJG A;  3MFX A;  4WUJ A;  1LSX A;  3UB8 A;  4DJ2 A;  3LI8 A;  2QJ7 A;  2VEA A;  3LIE A;  4EW7 A;  5HD3 A;  4R3A A;  5F6A A;  1F9I A;  3ICY A;  3RH8 B;  1OTI A;  4HHD A;  3UME A;  1T18 A;  4R70 A;  3F1N A;  4EER A;  5IS1 A;  5G4Z A;  1XJ2 A;  4HP9 A;  4XT2 A;  1KOU A;  3F1O A;  5IU1 A;  4I3I A;  3UMD A;  2ZBB A;  4EES A;  4NXE A;  1D06 A;  3NOU C;  2BAS A;  4L9E A;  3UE6 A;  2VV8 A;  1V9Y A;  1F98 A;  2L1M A;  3CWF A;  5F5Y A;  2VLG A;  3IS2 A;  2YKF A;  1S1Z A;  2QKP A;  3MQQ A;  4LRY C;  1BYW A;  4HOI A;  2L0W A;  4I5S A;  3ULF A;  4H6J A;  3H9W A;  1OT9 A;  4KUK A;  4K08 A;  3FC7 A;  3EWK A;  1LL8 A;  2H28 A;  2PYP A;  4R6L A;  5DKK A;  3GEC A;  1S4R A;  1N9L A;  1T1B A;  1LSW A;  2OWJ A;  3PYP A;  2PD7 A;  3F1P A;  4HNB A;  4KUO A;  2Z6C A;  5DKL A;  4EXO A;  2M1C A;  2OOL A;  1GSW A;  3EEH A;  2PD8 A;  2P7J A;  3K3C A;  4DJ3 A;  4GS9 B;  4R38 A;  3BWL A;  2KX6 A;  3HJI A;  4M4X A;  5HDS A;  3NHQ A;  5J7E A;  3F1O B;  3E4Q A;  1JNU A;  1X0O A;  1S67 L;  3UB9 A;  4WF0 A;  1UWN X;  4EQ1 A;  1P97 A;  1OTB A;  4KQD A;  5KIZ A;  3F1P B;  1VB6 A;  2A24 B;  4NXB A;  1T1A A;  2PHY A;  4XT2 B;  4I39 A;  1DP6 A;  4PKY G;  5AVE A;  2CMN A;  4LPZ A;  4B9O A;  4GS9 A;  3SW1 A;  4GCZ A;  4E04 A;  3LUQ A;  2VV7 A;  1UGU A;  3KX0 X;  3LIB A;  3G6O A;  4GW9 A;  2HV1 A;  1P0Z A;  4HP4 A;  2JHE A;  3A0S A;  2V0U A;  1XFQ A;  4JGR A; 
#chains in the Genus database with same CATH topology
 1Y28 A;  4KQR A;  4Y15 A;  1LT0 A;  3IBJ A;  4BL3 A;  2PR6 A;  4LV0 A;  1IYP A;  4WL9 A;  1YLW A;  1G6A A;  3WS5 A;  2C6W B;  3G34 A;  2H5S A;  1GHI A;  5HWT A;  5FQM A;  4MEZ A;  3SH9 A;  3LIA A;  5TBM B;  1XJ4 A;  2ZC4 B;  1LHY A;  2XSS A;  3VFF A;  5E2F A;  3ITA A;  1KDS A;  1DP8 A;  4NET A;  1FQG A;  1NZO A;  1W7F A;  2R9W A;  3P01 A;  5L10 A;  4GN2 A;  3BJN A;  3JPU A;  4WZ5 C;  1SKO B;  3A3F A;  3LFV A;  3CIT A;  1XGJ A;  1BTL A;  2JKR I;  3ZVT A;  2V1Z A;  3C7U A;  3TJZ C;  2D02 A;  4I3A A;  3PBR A;  3MFX A;  4WUJ A;  3VMA A;  3E0Y A;  2K31 A;  2P04 A;  1W8Q A;  4EER A;  3EEA A;  3S22 A;  3IXG A;  1L0E A;  2J3W A;  3UB5 P;  5EVI A;  1K55 A;  2JKG A;  4I5S A;  4EWF A;  5DFY A;  4S2M A;  3D9Y A;  2Y2O A;  4HNB A;  3VE4 A;  2DMW A;  1S0W A;  3G2Y A;  3BRM A;  4UEY A;  1P97 A;  4KQD A;  5HFO A;  1OPX A;  3QP2 A;  1Y4O A;  1L0D A;  3RFB A;  4Y17 A;  4LFU A;  4IUH A;  3OLO A;  1YPR A;  1WYC A;  2ZQD A;  5L07 A;  3IF5 A;  1S4S A;  4KZ8 A;  4MBF A;  1ZG6 A;  1N9O A;  3E2L A;  1N9N A;  3A3D A;  1H8Y A;  5A91 A;  1V9Z A;  2XRO A;  3MZE A;  2PR5 A;  2A24 A;  3O87 A;  4JPM A;  1IKG A;  4EEP A;  4ZDX A;  4KZB A;  3FPW A;  4QJG A;  3MQO A;  1MY8 A;  3N8R A;  1D1J A;  1N4O A;  1K4E A;  2C5W B;  1BLP A;  3UDF A;  2HZ5 A;  1D7E A;  5CGS A;  5DJU A;  1E3U A;  1WA9 A;  3BW6 A;  3VSK A;  4WBG A;  2GJ3 A;  2OLU A;  1DP9 A;  3ZYT A;  5EVI D;  4MN6 A;  1YSP A;  3NJA A;  4CPK A;  3LR4 A;  4R3B A;  2E8I A;  2GZA A;  4PKY A;  1PIO A;  1LSX A;  2B5R A;  5F6A A;  2X01 A;  4FTX A;  5CX7 A;  4LGW A;  5HPI A;  3OCL A;  1BT5 A;  2EWW A;  5FAS A;  3S4X A;  1O7E A;  2J3T D;  4X69 A;  1OT9 A;  3GEC A;  3SS4 A;  2HJE A;  3EEH A;  3NEC A;  3UPP A;  3F1O B;  1LLB A;  1JNU A;  4ID4 A;  4EQ1 A;  1ZHH B;  2O9C A;  2H10 A;  5EV0 A;  5AVE A;  4LPZ A;  4E04 A;  3UPN A;  2Y2G A;  3ZCZ A;  3PAE A;  4HJ3 A;  2QMI A;  4F94 A;  2INW A;  3ZG7 B;  1YSQ A;  2IWC A;  4O8G A;  4O0P A;  2M7U A;  2PYR A;  4NG2 A;  1G5U A;  5CHM A;  5GLB A;  3D72 A;  4OLG A;  1FIK A;  3VFH A;  3ZHH A;  4PM6 A;  5HPF A;  1YM1 A;  1K0K A;  2QJ5 A;  3SS5 A;  5FEF A;  4UAA A;  4JXS A;  5FDH A;  3S7Q A;  3BFC A;  1DJB A;  3V50 A;  4P87 A;  4GB7 A;  4UQI S;  3L7H A;  3BFG A;  4GLQ A;  2ZM2 A;  3N7W A;  3KSI A;  5TR7 A;  2VA0 A;  3R7W A;  3OPL A;  1CF0 A;  3CPT A;  4GZB A;  2OWH A;  4BBT A;  3KO6 A;  3TG9 A;  1VQQ A;  1EW0 A;  3PHY A;  3UPO A;  3PAG A;  5CHU A;  1M40 A;  4OPY A;  2QJ7 A;  1YQS A;  5HD3 A;  4R3A A;  3ICY A;  2HDS A;  3C4O A;  4XT2 A;  3AGF A;  4KZA A;  3LCE A;  1W8Y A;  5FDS A;  4N1H A;  4AFI A;  4JXV A;  4IED A;  2W3E A;  4MCW A;  1U60 A;  2RL3 A;  4R4S A;  2H28 A;  2CC1 A;  3T4J A;  3PYP A;  1P9R A;  1W63 M;  3QNB A;  4OKP A;  1L3L A;  3C7V A;  5HDS A;  4WEJ A;  2ZD8 A;  4E3N A;  3VOY A;  3VOZ A;  5MC7 A;  1XPB A;  2NUP C;  1G68 A;  2J9O A;  3CZD A;  1A0K A;  3HVF A;  1KGF A;  3NIA A;  3PBN A;  1P0Z A;  1JTG A;  3MBZ A;  3LR0 A;  1XFQ A;  5G18 A;  4S2N C;  3S7N A;  3UO9 A;  3GTC A;  2X02 A;  4O7D A;  3PBS A;  2WKP A;  5AQA A;  4U0T A;  3CJM A;  1XX2 A;  4WMC A;  1TS8 A;  5FQK A;  4JBF A;  1DJA A;  2V0W A;  2K2N A;  2DCF A;  1IYQ A;  5L09 A;  4X53 A;  1CEF A;  2EX9 A;  2J80 A;  3U4L P;  3K2N A;  2W27 A;  4QY6 A;  3DTE A;  4OQI A;  3NDE A;  4X25 A;  4C75 A;  2K7S A;  3FYZ A;  4E3J A;  1MC0 A;  4P0M A;  4NXG A;  4L9G A;  5A93 A;  3NY4 A;  4WMC D;  1VM1 A;  2JKF A;  3MXR A;  3WS2 A;  5KSH A;  2BAS A;  3BQ8 A;  3T4O A;  2YKF A;  1KDW A;  2GX5 A;  3FC7 A;  2ZQC A;  5DKL A;  2M7V A;  1CK3 A;  2VJW A;  5HL1 A;  3E4Q A;  3EGD C;  5J8X A;  4K91 A;  3NCK A;  5DF8 A;  2WUQ A;  4R4R A;  4K0W A;  4E3I A;  3IHA A;  1GA9 A;  3WS4 A;  4KEN B;  2HV1 A;  1TEM A;  4MBK A;  4KZ3 A;  5KSC A;  3IX8 A;  1FIL A;  1PNE A;  1UWP X;  3M6H A;  3O88 A;  4N9K A;  4HP4 A;  3IS2 B;  1G6O A;  4N1X A;  2VZW A;  3MZD A;  4PHT A;  2XLN A;  5BOH A;  3EQV A;  4N9L A;  4Y5F A;  2A49 A;  5IT5 A;  1PW8 A;  4BD1 A;  1LSV A;  4CLC A;  1KE0 A;  5HWV A;  5F82 A;  2Q9N A;  3R4K A;  3LEZ A;  2VGL M;  4S2J A;  5FI7 A;  5M1A A;  5G4Y A;  5TJJ A;  5KZH A;  3IX3 A;  1LI0 A;  3B42 A;  2H0Y A;  4WZ4 A;  1I2S A;  3LI8 A;  4BJP A;  4UHU A;  3UNW A;  3G31 A;  3F1N A;  5G4Z A;  1XA7 A;  4LV3 A;  2PBY A;  4ZJ3 A;  4DN0 A;  2HP5 A;  5FQI A;  1TF1 A;  3T1R A;  2XRN A;  2VK3 A;  4C6Y A;  4K08 A;  3N8S A;  4BWI A;  3PR6 A;  2PYP A;  5DKK A;  3QP1 A;  1YAX A;  4XUX A;  4OPQ A;  5FI6 A;  4UA6 A;  1X0O A;  1VET B;  5FEG A;  5CRF A;  2PHY A;  3CUE C;  3SH8 A;  1ES5 A;  2PAV P;  1TVF A;  3FKV A;  5KMW A;  4WYY A;  4X56 A;  1PWG A;  4MLL A;  4CJN A;  4B4X A;  1LL9 A;  4JGP A;  1K57 C;  3BEC A;  2JKR M;  2IWD A;  2ZQ7 A;  3LIC A;  4LRX C;  4YWZ A;  2ZL1 B;  2KDK A;  3JYI A;  5J3W A;  1KVL A;  1WE4 A;  4KG5 A;  4HES A;  3MSH A;  3IH9 A;  5D3O A;  1GCE A;  4OP5 A;  5A8B A;  2EWV A;  4HQA A;  2ZM8 A;  3K3D A;  4CLC C;  4KZ6 A;  3VP2 A;  4XXR A;  3B33 A;  2DRW A;  5CEC A;  3EGX C;  3IHB A;  5U47 A;  1NRJ A;  1IYO A;  2Y2P A;  4MNR A;  2X71 A;  3LY4 A;  3RXW A;  3BFF A;  3ZNY A;  3B3X A;  3WRZ A;  3Q7Z A;  3UME A;  3PBT A;  2HP9 A;  1L0G A;  3TOI A;  5EM0 A;  2HDU A;  5IU1 A;  4L9E A;  5F5Y A;  2BTF P;  3MQQ A;  4PAU A;  3GSG A;  1LSW A;  4QB8 A;  5CGX A;  5FA7 A;  4E6X A;  2EXB A;  3F1P B;  4NXB A;  4ZRR A;  1GHP A;  3PBQ A;  5CEB A;  2OV5 A;  4IJG A;  3T4K A;  2WGW B;  3NDG A;  4BD0 A;  3T4L A;  5CER A;  4YFM A;  4E3K A;  3MXS A;  2YKH A;  1K6R A;  3BFD A;  4ZBE A;  4G3V A;  5AQB A;  4FD8 A;  4UA7 A;  5CXW A;  1Z6F A;  4LV2 A;  1MZU A;  4Z1W A;  1BLH A;  1YMX A;  5CTM A;  5GLA A;  1CQA A;  4WN5 A;  4B93 A;  1XGI A;  4MBH A;  1HZO A;  4DF6 A;  1XP4 A;  4Q8I A;  3MJQ A;  5DTK A;  4E6W A;  3HLW A;  1K25 A;  3H7W B;  3H82 B;  2L4R A;  2Y2H A;  5EUA A;  4WLA A;  1NLY A;  1XXM A;  3IX4 A;  3LIF A;  3NUL A;  5GLC A;  2PBD P;  1PZP A;  3Q7V B;  1YLT A;  4JKT A;  3GV9 A;  3CAX A;  3W4O A;  3BLS A;  1P9W A;  3G4P A;  2QYB A;  1F9I A;  4HHD A;  1RCJ A;  3WRT A;  3MMH A;  1KOU A;  4I3I A;  1YLJ A;  4NXE A;  5FQJ A;  2J8Y A;  3IS2 A;  4R1G A;  1ERM A;  2WYX A;  5FAQ A;  3Q82 A;  3EWK A;  1QME A;  2Z2M B;  3UE1 A;  4DJ3 A;  3UY6 A;  3BWL A;  4FCF A;  5FQQ A;  4I39 A;  2W1T B;  2ZQ8 A;  4DE2 A;  5I94 A;  3DAV A;  2ZC6 B;  4JF4 A;  2W3F A;  2A3U A;  1VHM A;  2A2L A;  4Y7P A;  3ZNT A;  4PM8 A;  4S2K A;  3H7W A;  2QPN A;  1TS0 A;  3DWZ A;  3H82 A;  3P98 A;  5F68 A;  4UA9 A;  1IFQ A;  4L9F A;  1BZA A;  3LEQ A;  4HJ4 A;  2Y55 A;  2W0N A;  2Z6D A;  3DBA A;  1H3Q A;  3DWK A;  2KOI A;  4CLC B;  5A92 A;  3MFD A;  1TDG A;  2O0Y A;  3VE3 A;  3HLF A;  1KE4 A;  5TBM A;  2WAD A;  3MZF A;  3GDI A;  1ZKJ A;  4CLC E;  3QP6 A;  4LEN A;  5E43 A;  2QWS A;  4OOM A;  2XGN A;  4MDZ A;  1O07 A;  3N4I A;  3IWI A;  4GHI A;  1PI5 A;  1RGY A;  4BBV A;  3IT9 A;  1ODV A;  2B02 A;  4Y0U A;  4DDY A;  3UB8 A;  1C3B A;  1XKZ A;  4KZ4 A;  1IOU A;  1FCM A;  5E2G A;  4R0Q A;  3OPH A;  2B18 A;  2EFU A;  3C38 A;  5C5K A;  3UE6 A;  1S1Z A;  5L2F A;  4FSF A;  1SCW A;  1LL8 A;  4R6L A;  3ZG5 A;  1KGG A;  4Y0T A;  1K54 C;  3NI9 A;  5FAT A;  1MPL A;  4WF0 A;  2A24 B;  3SZT A;  3SW1 A;  3E2K A;  3LUQ A;  1NRF A;  4GW9 A;  2V0U A;  3Q07 A;  2V2F F;  1TDL A;  3AGD A;  1Q2Q A;  4HBT A;  4ESP A;  4ARZ A;  3ZVW A;  4HJ6 A;  3VSL A;  4RQ9 A;  2ACG A;  3BM6 A;  5EFW A;  1SHV A;  3L9K A;  1KGE A;  3ZQ5 A;  1T19 A;  2W3D A;  5CED A;  5HAI A;  1FSW A;  2ZOI A;  1S1Y A;  2LB9 A;  3D3O A;  3JVV A;  2R78 A;  3HLE A;  1VEU A;  2PU2 A;  4DRT A;  2VX8 A;  3G30 A;  1NXY A;  3GRJ A;  3LI9 A;  1F5M A;  3OBF A;  4HY8 A;  1ONH A;  2VV6 A;  4OLD A;  4OQG A;  3KYQ A;  1MWU A;  2XA7 M;  4QU3 A;  3DTM A;  3BQA A;  3ISG A;  2BG1 A;  1L2S A;  3CUE A;  3BEB A;  1GHM A;  2ZBB A;  1D06 A;  1V9Y A;  1F98 A;  4HBU A;  2XA7 S;  3OZH A;  4NEE D;  2L0W A;  4JF5 A;  1ZG4 A;  1W79 A;  2Y2I A;  4R23 A;  1S4R A;  3DTI A;  2OOL A;  2P7J A;  4KG2 A;  3VV4 A;  3HJI A;  4ETX A;  3GMW A;  1E3U D;  2I72 A;  4YOF A;  3W2Z A;  4GCZ A;  2WAF A;  3KSG A;  2HPB A;  4JGR A;  3TRC A;  1YMS A;  2W1T A;  2KLI A;  3MKF A;  4GDN A;  3T50 A;  4HI4 A;  2ZM0 A;  3BY9 A;  5CGW A;  2EX6 A;  5M19 A;  2ZC7 A;  2XF3 A;  5GHX A;  2NUT C;  4U3T A;  4S2I A;  3IQA A;  2OAQ 1;  4EBP A;  2ZQA A;  4JGO A;  5HWW A;  2VKS A;  5CHJ A;  3RXX A;  3MXQ A;  5HZH A;  2WKE A;  4OON A;  1RP5 A;  5EVE A;  3LR3 A;  3NOT C;  5HSQ A;  2JBF A;  5EVI C;  4A5R A;  3ZG0 A;  2WGW A;  3V3S A;  3ZFZ A;  4P85 A;  3HL9 A;  1S6R A;  4MMN A;  4R70 A;  4HP9 A;  5HW3 A;  3V5M A;  2ZC5 B;  1FR6 A;  1W5D A;  2VLG A;  3OPP A;  4Y2F A;  4EBN A;  3QP4 A;  1FOF A;  3SS3 A;  4MN7 A;  3F1P A;  1PRQ A;  2XFS A;  4EBL A;  4KZ7 A;  1I5Q A;  2HDR A;  4DMZ A;  4KQQ A;  5EVL A;  4JF6 A;  1NZU A;  3KX0 X;  4PMA A;  3UE3 A;  3A0S A;  3B47 A;  1F2K A;  4NK3 A;  3MF0 A;  4RVA A;  3LGO A;  1T1C A;  2W3H A;  3FWL A;  3JVU A;  5DF9 A;  3IBR A;  2E8J A;  1JVJ A;  1H8Z A;  2OSU A;  3SOI A;  4QHC A;  4WZ5 A;  2BLS A;  3HLG A;  1OTD A;  2VGL S;  1BLS A;  3W4Q A;  2ZQ9 A;  1J9M A;  1IKI A;  2WK0 A;  2FFY A;  2OAP 1;  3ZG9 B;  3T1S A;  3VP3 A;  2XEP A;  3A3I A;  2Y2Q A;  2J3T C;  3T12 B;  3VOL A;  4QD4 A;  1EWZ A;  1FR1 A;  4LRZ E;  1TS6 A;  3BY8 A;  4X55 A;  3IXH A;  5GL9 A;  4LCM A;  4LLO B;  2ZC3 B;  3S1Y A;  5HD5 A;  3C4P A;  4GD8 A;  1TS7 A;  2R9X A;  5DTT A;  2VGK A;  4UQI M;  1AXB A;  3E4O A;  1I2W A;  4ZJ2 A;  5AQ7 A;  5HDD A;  2Y2J A;  4F3L A;  3A3E A;  4PM5 A;  3O3V A;  4IVK A;  1ES2 A;  4ARZ B;  4EW7 A;  1OTI A;  1HTZ A;  1IEM A;  1YLY A;  2HJ9 C;  1OME A;  3NOU C;  2WGI A;  1PI4 A;  1ACF A;  1AWI A;  5HX9 A;  4P6Z M;  4RYE A;  1PZO A;  4JLF A;  1E25 A;  1T1B A;  2XK1 A;  3DW0 A;  5EM1 A;  1CI9 A;  2KX6 A;  5EPH A;  3LR5 A;  4G3K A;  5KIZ A;  2JCH A;  1T1A A;  1HLU P;  4GOG A;  2CMN A;  3HBR A;  3IF6 B;  4K0X A;  5EE8 A;  1YLP A;  2VV7 A;  3LIB A;  5HL6 A;  1SZV A;  1NYY A;  4BL2 A;  1YT4 A;  2IA2 A;  1K56 D;  1N9B A;  4GHI B;  5GLD A;  1ZTU A;  5HDC A;  1MKI A;  4E3M A;  1ERQ A;  1NLZ A;  1ZC2 A;  3O86 A;  2ZOH A;  3FKW A;  3PBO A;  2V9A A;  1H8M A;  1XJ3 A;  5F1F A;  4EQI A;  3C8C A;  2ZMF A;  4BEN A;  3WWX A;  4PM7 A;  3T1X A;  4H6J B;  3UE0 A;  4Y13 A;  4IVI A;  2EX8 A;  4GDB A;  4OPR A;  5GHY A;  2EX2 A;  3TW8 A;  5E2E A;  3T1Q B;  3QP5 A;  4GD6 A;  4BQM A;  2O9B A;  2QHK A;  1DRM A;  3CPT B;  1FCO A;  1ES3 A;  5DTS A;  1CEG A;  2OLV A;  2WKQ A;  5F83 A;  2WKI A;  1WYB A;  2O9A A;  2J9P A;  4QPR A;  1OJG A;  1K6S A;  1NY0 A;  1JWV A;  4P6B A;  1NJ4 A;  2PU4 A;  2Q0O A;  3CMZ A;  3FPV A;  1KE3 A;  3UDI A;  2XFT A;  4LV1 A;  3IXB A;  5JYO A;  2QKP A;  4JXW A;  3ULF A;  4KUK A;  1IYS A;  1MWS A;  3LO7 A;  2OWJ A;  2Z6C A;  1SDN A;  4M4X A;  4RX2 A;  3MQ0 A;  4CLC D;  3N6I A;  5EEC A;  1EI5 A;  3IWO A;  1UWN X;  2PT7 A;  1OTB A;  3ZG8 B;  4XT2 B;  2EXA A;  1MKM A;  2V20 A;  2JE5 A;  5AQ9 A;  1K55 C;  1TD5 A;  5L8M A;  1BUL A;  1VEU B;  2Y2N A;  4GJ4 A;  1NWZ A;  3MR0 A;  4KG6 A;  1YLZ A;  4I3J A;  1K56 A;  3F1N B;  3UN7 A;  1MWR A;  3AGE A;  3KSF A;  4Y0O A;  4HH2 A;  3W4P A;  4S2N A;  3C30 A;  2LB5 A;  3MKE A;  2DNS A;  4S2O A;  1OTA A;  2Y59 A;  1K57 A;  5F69 A;  2GDN A;  3IWQ A;  5DF7 A;  5E2H A;  1OTE A;  5FQ9 A;  2JN7 A;  4WEL A;  4D2O A;  3IF6 C;  1GSX A;  2MJ6 A;  2WKR A;  4HH3 A;  3VP1 A;  2AVX A;  3MS6 A;  3IXD A;  1Q2P A;  5IHV A;  3OC2 A;  1XJ6 A;  3E98 A;  1J3W A;  1BLC A;  3OPR A;  5EOE A;  4DJ2 A;  4X1L A;  2VEA A;  1MWT A;  3RH8 B;  1T18 A;  4EUZ A;  2JKT I;  2G2U A;  3WS1 A;  4ME4 A;  5FSR A;  2Z2L B;  2Y4A A;  3HCY A;  3QNC A;  3CHW P;  2P9V B;  4Y3I A;  2WZX A;  2Y91 A;  1DJC A;  4EXO A;  4IHQ A;  2M1C A;  2PD8 A;  2WKH A;  4R38 A;  3Q81 A;  3LY3 A;  4GNU A;  2JKT M;  4XUZ A;  1VB6 A;  3M6B A;  4Q0H A;  1DP6 A;  5FL3 A;  5AJG A;  4DE3 A;  2O99 A;  3WS0 A;  3HLD A;  4QY5 A;  5HAR A;  4ZAM A;  1ONG A;  3V3R A;  4YIN A;  1JWZ A;  4OVD A;  3VP0 A;  1G28 A;  2I9V A;  4OOY A;  4E3O A;  4OQ0 A;  4PPR A;  2XQZ A;  3HLB A;  3RJU A;  3HUM A;  5HAP A;  5CTN A;  2PDR A;  3CLO A;  5K5B A;  4JGQ A;  4S2P A;  4MN5 A;  1Z09 A;  1CI8 A;  3G32 A;  5HAQ A;  4X68 A;  2EA9 A;  2V1B A;  3RTY A;  3HUO A;  1MXO A;  4H8R A;  2UV0 E;  3LID A;  1PWD A;  1K54 A;  3C5A A;  2ZL1 A;  3NOP C;  1BUE A;  4F3L B;  3CG5 A;  1GSV A;  4QWO A;  5DJT A;  3FV7 A;  2G2W A;  2V8F A;  3OCN A;  1ESU A;  2ZMA A;  3ITB A;  2RCX A;  3A0V A;  2ZLY A;  2ZJ9 A;  1S66 L;  1YKD A;  5FI2 A;  3PXP A;  3KSH A;  2XH9 A;  3UMD A;  4X6T A;  4EES A;  3BFE A;  2Y8H A;  5LBR A;  1BYW A;  4HOI A;  3KYZ A;  4H6J A;  3UDX A;  4HEF A;  1M6K A;  4PM9 A;  2P74 A;  1N9L A;  3UB6 A;  4EU0 A;  4EV4 A;  2PD7 A;  3D4F A;  5EVI B;  4FH4 A;  4GS9 B;  3NC8 A;  4IBX A;  3KYE A;  5J7E A;  3S7O A;  1S67 L;  1VET A;  4YNR A;  2HF6 A;  4PKY G;  3ZDJ A;  4B9O A;  3EOI A;  3GQZ A;  1BSG A;  4R3J A;  1FCN A;  4ZJ1 A;  3T4T A;  2GNX A;  1NYM A;  1JWP A;  4DKI A;  3R7W B;  1XA1 A;  1IEL A;  4ETZ A;  3OOV A;  1DY6 A;  4BBU A;  3I7J A;  4Q0J A;  4EET B;  1ERO A;  3BLM A;  4NKP A;  3HRE A;  4KZ5 A;  3QP8 A;  1OJ5 A;  1SKO A;  3DTK A;  4GKU A;  3FG8 A;  4IUK A;  3FZC A;  5A90 A;  3P7N A;  1OT6 A;  3BYD A;  3CI6 A;  2HP6 A;  3TSG A;  4DXC A;  2B95 A;  3A3J A;  3G35 A;  4KZ9 A;  5EOO A;  5J4E A;  4N92 A;  4BLM A;  2EFX A;  4D60 A;  2UWX A;  5DVA A;  3HJK A;  2QZ6 A;  5AVF A;  3HUN A;  2G7U A;  2V8C A;  4B88 A;  1H5X A;  4P6Z S;  4DE0 A;  4M3K A;  3Q1F A;  3LIE A;  3PTE A;  1LL5 A;  3HLC A;  3T4S A;  4U0X A;  1MBL A;  2IWB A;  3V67 A;  5GHZ A;  4RX3 A;  2H0T A;  3O5Y A;  3CWF A;  1SKF A;  2W1R A;  2HDQ A;  4C3Q A;  2Y79 A;  4DXB A;  3P09 A;  1ES4 A;  4ZTK A;  3SH7 A;  1Y54 A;  4Q0I A;  3K3C A;  3IF6 A;  1PWC A;  3NHQ A;  2P08 A;  1SDE A;  3NBL A;  5M18 A;  4LCL A;  2FFF B;  2P9V A;  1PFL A;  1UGU A;  3M2J A;  4WEK A;  3G6O A;  4OP8 A;  2JHE A;  4JXG A;  3IH8 A;  4IBR A;  1XFN A;  4FOF A;  3A0R A;  3LYX A;  4G3W A;  1HVB A;  2D01 A;  4NXF A;  5I5L A;  1QMF A;  1JTD A;  3VP4 A;  4B4Z A;  4E3L A;  1PYY A;  2WZZ A;  5DFX A;  4HIA A;  2XD5 A;  3ZGA B;  4II7 A;  4I38 A;  4Z9Q A;  3E4P A;  5JYP A;  4CQH A;  3QHY A;  4WM9 A;  2Q9M A;  3C2W A;  4DE1 A;  4DDS A;  3G2Z A;  4BMW A;  2FZ0 A;  2JC7 A;  4S2L A;  3GVB A;  1FSY A;  2V1A A;  1W63 Q;  4KQO A;  5FAP A;  4EEU A;  4EUV A;  1ESI A;  2Y2K A;  3U2A A;  1KVM A;  1H0M A;  4FH2 A;  5TFQ A;  2Y2L A;  4OH0 A;  1ALQ A;  2FH5 A;  3UB7 A;  2XDM A;  3M2K A;  4X1M A;  4L0L A;  3V39 A;  3S7P A;  1CJF A;  5FAO A;  2WGV A;  4OPZ A;  1E4D A;  5IS1 A;  3TE8 A;  1XJ2 A;  3F1O A;  1LI9 A;  2J7V A;  5TGF A;  4FUW A;  2VV8 A;  3W8K A;  2L1M A;  3EQU A;  4LRY C;  3H9W A;  3N8L A;  4RA7 A;  1RGZ A;  3T4Q A;  3Q7V A;  2WAE A;  1K4F A;  3GR2 A;  4KUO A;  2PRF A;  4O01 A;  2ZMV A;  1GSW A;  1STZ A;  1L0F A;  4OOL A;  2HGV A;  3UB9 A;  2XD1 A;  1GA0 A;  2VGJ A;  2Y2M A;  2W3G A;  2XR0 A;  1K38 A;  4GS9 A;  4OQH A;  1PW1 A;  5F1G A;  1HD8 A; 
#chains in the Genus database with same CATH homology
 1Y28 A;  4GJ4 A;  1LT0 A;  1NWZ A;  3MR0 A;  3IBJ A;  2PR6 A;  4ARZ A;  4HJ6 A;  4I3J A;  4WL9 A;  3F1N B;  1UWP X;  4RQ9 A;  5EFW A;  3KSF A;  4HH2 A;  5HWT A;  3C30 A;  2LB5 A;  4HP4 A;  3IS2 B;  1G6O A;  3ZQ5 A;  2VZW A;  3LIA A;  5TBM B;  1OTA A;  1XJ4 A;  1T19 A;  4PHT A;  5F69 A;  2W3D A;  2XSS A;  2ZOI A;  3EQV A;  1S1Y A;  2LB9 A;  3D3O A;  3JVV A;  1DP8 A;  4Y5F A;  1OTE A;  2R78 A;  5IT5 A;  2JN7 A;  4WEL A;  3P01 A;  1LSV A;  4CLC A;  3BJN A;  1GSX A;  2MJ6 A;  2VX8 A;  2WKR A;  5HWV A;  3LFV A;  4HH3 A;  3R4K A;  3CIT A;  3LI9 A;  1F5M A;  2JKR I;  2VGL M;  3OC2 A;  3OBF A;  1XJ6 A;  2VV6 A;  4HY8 A;  5G4Y A;  5TJJ A;  3E98 A;  3B42 A;  3TJZ C;  2D02 A;  4I3A A;  3KYQ A;  3PBR A;  3MFX A;  4WUJ A;  3E0Y A;  4DJ2 A;  3LI8 A;  4BJP A;  2VEA A;  2XA7 M;  2K31 A;  2P04 A;  3RH8 B;  3BQA A;  1T18 A;  3F1N A;  4EER A;  3EEA A;  5G4Z A;  2JKT I;  3CUE A;  2ZBB A;  4ME4 A;  4DN0 A;  1D06 A;  2J3W A;  1V9Y A;  1F98 A;  3HCY A;  2XA7 S;  1TF1 A;  4NEE D;  2L0W A;  4I5S A;  2XRN A;  5DFY A;  4Y3I A;  4K08 A;  4BWI A;  3PR6 A;  2PYP A;  5DKK A;  1S4R A;  4HNB A;  3VE4 A;  2DMW A;  4EXO A;  1YAX A;  4IHQ A;  2M1C A;  2OOL A;  2PD8 A;  2P7J A;  3VV4 A;  4R38 A;  3HJI A;  4ETX A;  4YOF A;  1X0O A;  4UEY A;  3W2Z A;  1P97 A;  2JKT M;  4KQD A;  1VB6 A;  2PHY A;  4Q0H A;  1DP6 A;  3CUE C;  1OPX A;  4GCZ A;  5FL3 A;  5AJG A;  2O99 A;  3RFB A;  3KSG A;  4JGR A;  4IUH A;  3TRC A;  3OLO A;  2W1T A;  2KLI A;  4JGP A;  1S4S A;  3T50 A;  4HI4 A;  1N9O A;  2JKR M;  3BY9 A;  1N9N A;  1G28 A;  2I9V A;  3LIC A;  4LRX C;  4YWZ A;  1V9Z A;  2XRO A;  2KDK A;  2PR5 A;  2A24 A;  5J3W A;  2PDR A;  3CLO A;  5K5B A;  4JGQ A;  2NUT C;  4MN5 A;  4EEP A;  3FPW A;  3MQO A;  2EA9 A;  2V1B A;  3RTY A;  2OAQ 1;  5A8B A;  4JGO A;  3LID A;  2EWV A;  5HWW A;  4HQA A;  3K3D A;  4CLC C;  3NOP C;  1D7E A;  5DJU A;  2VKS A;  3MXQ A;  4F3L B;  1GSV A;  1WA9 A;  3BW6 A;  5DJT A;  3B33 A;  2GJ3 A;  5HZH A;  3OCN A;  3EGX C;  1DP9 A;  1NRJ A;  3ZYT A;  4MN6 A;  1YSP A;  3NJA A;  3A0V A;  3LR3 A;  3NOT C;  3LR4 A;  1S66 L;  2GZA A;  5HSQ A;  4PKY A;  1LSX A;  1YKD A;  5F6A A;  3UME A;  3PBT A;  4MMN A;  4R70 A;  5CX7 A;  3PXP A;  3KSH A;  4HP9 A;  5IU1 A;  3UMD A;  5HPI A;  4EES A;  4L9E A;  5F5Y A;  3OCL A;  2VLG A;  2EWW A;  2Y8H A;  5LBR A;  3MQQ A;  1BYW A;  4HOI A;  4Y2F A;  2J3T D;  3KYZ A;  4H6J A;  4PAU A;  1OT9 A;  3GEC A;  1N9L A;  3UB6 A;  1LSW A;  4EU0 A;  4MN7 A;  2HJE A;  2PD7 A;  3F1P A;  3EEH A;  4GS9 B;  5J7E A;  3F1O B;  1JNU A;  3S7O A;  1S67 L;  4YNR A;  4EQ1 A;  3F1P B;  4NXB A;  4DMZ A;  1ZHH B;  2O9C A;  2HF6 A;  4ZRR A;  3PBQ A;  4PKY G;  5AVE A;  4B9O A;  3EOI A;  4LPZ A;  4IJG A;  4E04 A;  3T4T A;  3T4K A;  3KX0 X;  2GNX A;  3UE3 A;  3A0S A;  3B47 A;  3T4L A;  4HJ3 A;  2INW A;  3MF0 A;  3R7W B;  4ETZ A;  2YKH A;  1YSQ A;  4O8G A;  4O0P A;  2M7U A;  2PYR A;  3OOV A;  1T1C A;  2W3H A;  3JVU A;  5DF9 A;  3IBR A;  4BBU A;  4Q0J A;  4G3V A;  4EET B;  4NKP A;  1OTD A;  2VGL S;  1MZU A;  3D72 A;  5HPF A;  4Z1W A;  1OJ5 A;  2OAP 1;  2QJ5 A;  3FG8 A;  4WN5 A;  4IUK A;  4B93 A;  2J3T C;  3S7Q A;  3VOL A;  4LRZ E;  3P7N A;  1OT6 A;  1TS6 A;  3BY8 A;  3CI6 A;  4UQI S;  4GLQ A;  3MJQ A;  3H7W B;  3H82 B;  2L4R A;  3KSI A;  2VA0 A;  4LLO B;  5HD5 A;  5J4E A;  3R7W A;  1TS7 A;  4WLA A;  4UQI M;  1NLY A;  3HJK A;  5AVF A;  2OWH A;  3LIF A;  3E4O A;  4BBT A;  2G7U A;  3KO6 A;  5HDD A;  4P6Z S;  4F3L A;  1EW0 A;  3CAX A;  3PHY A;  1P9W A;  2QJ7 A;  3LIE A;  2QYB A;  4ARZ B;  5HD3 A;  4R3A A;  4EW7 A;  1F9I A;  3ICY A;  1OTI A;  4HHD A;  4XT2 A;  3T4S A;  3MMH A;  1KOU A;  4I3I A;  2HJ9 C;  3V67 A;  4NXE A;  3NOU C;  3O5Y A;  3CWF A;  4AFI A;  3IS2 A;  2W3E A;  4MCW A;  4P6Z M;  3EWK A;  2W1R A;  2H28 A;  3T4J A;  2Y79 A;  1T1B A;  3PYP A;  1P9R A;  1W63 M;  4Q0I A;  3K3C A;  4DJ3 A;  3BWL A;  2KX6 A;  5HDS A;  3NHQ A;  3LR5 A;  4WEJ A;  4G3K A;  5MC7 A;  5KIZ A;  2P08 A;  2NUP C;  1T1A A;  4I39 A;  2W1T B;  2CMN A;  2VV7 A;  1UGU A;  3LIB A;  4WEK A;  3G6O A;  5HL6 A;  3PBN A;  1P0Z A;  2JHE A;  3LR0 A;  1XFQ A;  3S7N A;  1XFN A;  2W3F A;  4FOF A;  3A0R A;  2IA2 A;  3LYX A;  4G3W A;  1VHM A;  2A2L A;  4GHI B;  1ZTU A;  3PBS A;  3H7W A;  2WKP A;  1TS0 A;  3H82 A;  5HDC A;  1NLZ A;  4NXF A;  2D01 A;  5F68 A;  5I5L A;  2ZOH A;  1IFQ A;  3PBO A;  2V9A A;  1TS8 A;  1H8M A;  4L9F A;  1XJ3 A;  4HJ4 A;  5DFX A;  4HIA A;  2V0W A;  2W0N A;  3C8C A;  2ZMF A;  2Z6D A;  3DBA A;  2K2N A;  4I38 A;  4II7 A;  1H3Q A;  4H6J B;  3E4P A;  2KOI A;  4CLC B;  4CQH A;  2O0Y A;  3VE3 A;  5TBM A;  3C2W A;  3GDI A;  2J80 A;  3TW8 A;  3K2N A;  4BMW A;  4CLC E;  2W27 A;  2QWS A;  2FZ0 A;  2O9B A;  4OOM A;  2QHK A;  2V1A A;  4MDZ A;  1DRM A;  1W63 Q;  4KQO A;  4EEU A;  4EUV A;  2K7S A;  3U2A A;  4GHI A;  4BBV A;  2WKQ A;  1ODV A;  1MC0 A;  4NXG A;  2FH5 A;  3UB7 A;  2O9A A;  2B02 A;  4L9G A;  1OJG A;  4QPR A;  3UB8 A;  4L0L A;  3S7P A;  1IOU A;  5IS1 A;  3TE8 A;  1XJ2 A;  3FPV A;  3F1O A;  2B18 A;  5KSH A;  2BAS A;  3C38 A;  5C5K A;  2VV8 A;  3UE6 A;  2L1M A;  3BQ8 A;  3EQU A;  3T4O A;  2YKF A;  1S1Z A;  2QKP A;  4LRY C;  4FSF A;  3ULF A;  2GX5 A;  3H9W A;  4KUK A;  3FC7 A;  3T4Q A;  1LL8 A;  4R6L A;  2OWJ A;  4O01 A;  4KUO A;  5DKL A;  2Z6C A;  2M7V A;  2ZMV A;  1GSW A;  1STZ A;  2VJW A;  4OOL A;  2HGV A;  4M4X A;  3MQ0 A;  3E4Q A;  4CLC D;  3EGD C;  3UB9 A;  4WF0 A;  1UWN X;  2PT7 A;  1OTB A;  2A24 B;  4XT2 B;  2W3G A;  1MKM A;  3SW1 A;  4GS9 A;  3LUQ A;  1TD5 A;  5L8M A;  4GW9 A;  2HV1 A;  2V0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...