2JNGA

Solution structure of the cul7-cph domain from homo sapiens; northeast structural genomics consortium target ht1.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
MRSEFASGNTYALYVRDTLQPGMRVRMLDDYEEISAGDEGEFRQSNNGVPPVQVFWESTGRTYWVHWHMLEILGFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cullin-7
publication title The Conserved CPH Domains of Cul7 and PARC Are Protein-Protein Interaction Modules That Bind the Tetramerization Domain of p53
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11515 Cul7 Mouse development and cellular proliferation protein Cullin-7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2jngA00
1Q81C 1VQ8A 3ER0A 3DB3A 2OTLA 1KD1U 1SSFA 3CMAT 1QVFA 1EIFA 3G6ET 2QA4T 3PIPA 5LL6S 3DB4A 3OYYA 1S72T 4RG2A 1M90C 1YI2T 3CCRA 3CCLT 1YHQT 1NJIC 2QEXA 4QQDA 3CC4A 1K73C 3G71A 1NZ9A 3I55T 1NPPA 3CD6T 1VQPT 5A2QE 1NJIU 1VQNA 5DM7R 5IT9E 3CCSA 3CCEA 1VQ7A 1VQLA 3CPWS 1VQOT 1VQ9A 1NPRA 4ZN3A 2MI6A 2KVQG 3CC7A 3CC2A 4ZN1A 3I56A 2OTJA 1Q86U 2E6ZA 1M1GA 1VQ5A 1VQMT 3CC2T 1YBYA 5HY6A 5FLXE 1KQSA 1VQ8T 2IG0A 3KBGA 1YITA 1QVFS 2CKKA 2OTLT 5J26A 3CCJA 3J81E 5DLQE 1KQSS 1YJ9A 3DLLA 2MWOA 1YJNA 5J3BA 1YJWA 1BKBA 1KHIA 2EIFA 3CCRT 1QVGA 3CMEA 3CC4T 1K9MC 3P8BB 2QEXT 1Q82C 3G4SA 3G71T 1QVGS 1Q86C 3HKSA 1XTDA 3LGFA 1K9MU 2JNGA 1Q82U 1VQNT 1M90U 1K8AC 3CCST 1M1KU 1VQ7T 1IZ6A 1N8RC 1VQKA 1VQLT 5IAYA 3CCET 2LQ8A 1VQ6A 1YIJA 1VQ4A 1VQ9T 3CCVA 3CC7T 3CCUA 1K8AU 3CCQA 3I56T 1N8RU 2LCLA 2OTJT 2XHCA 1VQ5T 3CCMA 3LGLA 1XNIA 1X6OA 1YITT 3CCJT 1YJ9T 3CMAA 4TVRA 3G6EA 2QA4A 1VQMA 3A5ZB 1RL2A 1YJNT 3CXCA 1YJWT 1S72A 1KC8U 1M1KC 1YI2A 3J7AF 1UEBA 2KDSA 3CMET 2JOYA 3CXCS 1YHQA 3CCLA 3G4ST 1Q7YC 3JAME 3I55A 2JVVA 2E70A 1Q81U 3CD6A 4X34A 2LVMA 1VQPA 2G3RA 4YTLA 1JJ2A 1Q7YU 1VQKT 2DO3A 1VQ6T 2L3RA 1W2BA 1YIJT 2JUFA 1VQ4T 1VQOA 1JJ2S 1KC8C 3CPWA 3OW2A 3TREA 3CCVT 1K73U 1W2BS 3CCUT 1KD1C 3LH0A 3CCQT 2MWPA 4CRIA 3OW2S 3PIOA 3CPFA 3CCMT 3J80E
chains in the Genus database with same CATH superfamily
4BUGA 4O5VA 1M30A 4XTVA 4WTOB 1N6AA 4OGCA 4KBMB 2QA4T 3JCMV 4HCZA 4E7IA 1JB0E 2F5TX 3OB9A 1VQPT 2D0NA 1RAIB 4A53A 4C8QC 1QKWA 3QG1A 3JCMP 2RQWA 7AT1B 4MMLA 4M77B 4J7IA 2ZAEA 1YBYA 2MAMA 4DBHA 1KQSA 2QDYB 4NL3A 2JN0A 3BDUA 5DLQE 4PJOA 5CQYA 1YJ9Q 2I0NA 2QYZA 4C8QF 1LJOA 2JMAA 2GQVA 1BIAA 1UECA 1BYMA 2ZPFB 4O6JA 1E7OA 2FO0A 3HKSA 1TTHB 2KK4A 3SB2A 3WVEB 1RUWA 3OYJA 2RI2A 4JDSA 4LNPA 1GL5A 1FWZA 1UHCA 4E7ZA 2YXYA 4JPBW 1SF9A 5GAOn 1YCYA 1TUCA 1BU1A 2K9GA 1RLQC 1EZZB 3M0QA 4OB3B 2AKKA 5GMKh 1G83A 3G6EA 2KY9A 5IN1A 3OYNA 5GAMe 2FZGB 4R55A 1U06A 3M0SA 3I55A 3JB9I 3CCLQ 4BACA 1UB4A 1M8MA 3EG1A 3O5ZA 2L2PA 2NUPB 4C8QD 5FW9A 1VIEA 2ED1A 4OB0B 3M0RA 2CZ0B 3ER0A 1D3BB 2VC8A 3CC2Q 2LJ3A 3QDRB 5GAOq 3G6ET 3OYFA 4RG2A 1JRIA 1TSFA 2WSEE 1JU5C 3MEWA 4XTXA 2O2OA 4M7AE 3LWIA 1TU0B 1B7TA 4GBQA 1PD1A 5FU6B 3I55T 2AZSA 2D8JA 5GANf 1VQ7A 1AT1B 1WDXA 3CPWS 2DD4A 2YDLA 1NE8A 2KR3A 3CC7A 5GAN7 2E6ZA 1VQ5A 2D9TA 5C0MA 2H3JA 1SRLA 1VYTA 4KT0E 3VS5A 1N5ZA 2JW4A 3CMEA 3P8BB 3JV3A 4RTWA 4EMKC 4KUIA 2E5QA 1M27C 1C6VX 3VS4A 4NL2A 1M90U 1TUGB 1VQ7T 5CKFA 1X6BA 4JRQA 4J8OA 1GBQA 3PVQA 4J9HA 4XU3A 1T0HA 2LQWA 3CC7T 2RO0A 1D0YA 3MP8A 1VQ5T 3CCMA 2DNUA 2VVKA 2DTOA 3L2VA 4J9EA 4J5YA 4DOVA 3ZFJA 3E9GA 2KBTA 2FRYA 4LN2A 3RKXA 4BI3A 5A0LA 1OZ2A 3CMET 1AHJB 4RTXA 3JCMc 2VUBA 1JO8A 2DRKA 1EFNA 2DXTA 2DO3A 5KYUB 1QWEA 3VS1A 1PM3A 5GMKj 1G3SA 4M77C 3PIOA 3QSUA 3CCMT 3RMQA 2F5KA 1SHGA 1G8XA 5J39A 4IIOA 3LLRA 1IB8A 2M0OA 1EIFA 1UJYA 3DB4A 2EBPA 4B6MA 1VOMA 3VS2A 2COYA 1WYXA 3CC4A 4HT9A 2FEIA 3EG2A 4C0DB 5GANg 3M56A 1RAAB 3KXTA 3LW5E 2PQWA 5LJ5d 3A8OB 3VS6A 1UHFA 2QTVA 2GTJA 2RH2A 1BIBA 3CCSQ 3UF4A 3S3OA 4BE1A 2OI3A 5KH6A 2OTJA 1VQ9Q 5CIUA 2L3QA 5LJ3f 3AHUA 2RB6A 1UGSB 1X2KA 1GFDA 2E64A 3VKIA 4BI8B 1ZLMA 2DF6A 5AYFA 1BKBA 3GLXA 2E12A 3OS5A 3CC4T 2KI7A 4JRPA 2MK5A 1X75C 3D7SB 2X3XD 5CVIA 4M7AG 4M75G 2FVUA 1FMWA 2L89A 1ZUYA 2EAYA 2AT1B 5GAN4 4D6WA 2QASA 2LJ1A 1PD0A 2LT1A 1I5OB 4RUGA 3THKA 4Y28E 2OTJT 1D1AA 4M77D 4C92C 2AKLA 2RNAA 4XAXB 4EIKA 3QXEB 3EFRA 2EKOA 3OBYA 1WGSA 4VUBA 1MV0B 2LJ0A 3EH1A 3OY9A 3E1SA 4AFSC 1KJWA 2MOXA 4FL6A 3M58A 2M9UA 2LTOA 5FU6C 3S3NA 4XQ3A 2BKDN 4C92F 1UGRB 1YN8A 1W6XA 1WJRA 2JUFA 2HBPA 2HKNA 3OW2A 2LT4A 1R0CB 1K73U 1I81A 8ATCB 1VQOQ 1XJWB 2KAFA 1H3ZA 4R0KA 2F2VA 3DB3A 4QKUA 5GANe 3OYIA 2HBWA 1VQ8Q 2OTLQ 2KROA 4M7DG 1O75A 4AFQC 3CCRA 4E7JA 3VJPA 3OYCA 2DYBA 3OA6A 3H41A 2JTMA 3G71Q 3NTHA 2P0QA 3GPLA 4AMCA 3NHNA 4V2SA 3PT9A 4D8KA 1WI7A 1WXUA 5LJ3g 3RMSA 3FB9A 4A63B 4E7HA 4C5GA 4NOYA 2IIMA 2DL3A 1X69A 1QCFA 3JCMh 2QQRA 3CCRT 2CSIA 1YJWQ 2AHJB 1QVGS 1FMVA 5CKEA 4PLLA 1K9MU 3SWNA 2EPDA 3JB9F 3NTKA 3X26B 3SHWA 4XTZA 1M5Q1 4AFUC 3CQTA 3BDLA 2CP7A 1I07A 1BB9A 2J6OA 2H3EB 1QLYA 4MDXA 3ASKA 4GLMA 4ZTFA 1S72A 3UDCA 3JCMb 1KQ1A 1WX6A 1WQWA 1LCKA 4XK8E 2FB7A 1TUDA 4C0DC 3L2UA 1RLPC 2JVVA 1OPLA 4FT4A 3V8JA 4A4GA 5KYXB 3Q1JA 2EYZA 2LRQA 2FPFA 3QZ5B 4IUQA 4J9DA 1A0NB 3VYHB 2GFAA 3X25B 2FZKB 5LJ5h 2X51A 3JB9D 3NMZC 3V7SA 2W10A 2P84A 3VUBA 4XU0A 4M7AA 4QVDA 3MEUA 1X27A 3OYYA 1S72T 2HSPA 2C0TA 4ME7A 2QDLA 4BY6C 2JM9A 4PJOG 1OULA 2VGMA 3VRZA 5LJ3e 1IREB 4AG2C 1GBRA 2K2MA 4J9CA 2QAZA 1VQLA 3LWHA 3WXMB 2LQNA 1VA7A 2DFUA 2P4TA 2PVOB 3QDFA 2FYKA 2RJCA 2KVQG 3VRYA 2ZGWA 3FEOA 3QKJA 2DXCA 4HCKA 2LNHB 3PFSA 3A8MB 3UA6A 1AOJA 4F04B 2FPDA 3GIBA 3JB9H 1PNJA 2X3WD 2E4HA 2DL7A 1LNXA 4K11A 1YJNA 3OYEA 3UT1A 4ELZC 1G2BA 4DEYA 2SRCA 2EJ9A 1QVPA 1OX9A 4ORZA 3OYGA 1JJ2P 1MGQA 2GQIA 9ATCB 3PMTA 4KGZB 2EQJA 1Q82U 4LE9A 1VQLT 1MMAA 2LCSA 1VQ6A 1ZA1B 1YIJQ 4M78E 3URGA 2NUTA 3OYLA 4IUUA 1YJNT 1YI2A 1H641 1YHQA 2QA4Q 3JAME 1F1BB 1HYOA 2A7YA 2M16A 2ROTA 2IVWA 4FM4B 1H3HA 3BY7A 2XMFA 3C95A 4QQ6A 2EGEA 1VQPQ 2RMOA 1VQ6T 1BI3A 1Q7YR 3REBB 8AT1B 2X4WA 3TREA 4R56A 1E6HA 2SEMA 3MO8A 2LMJA 4PFZA 4F7UB 5C6SA 4L59A 4RCBA 2HSEB 2RQRA 1NM7A 5LL6S 4FU6A 3L2ZA 3EGDB 1YI2T 1KFZA 2A36A 2WSFE 2DVJA 4HVUA 1YHQT 2CP0A 3MEAA 2DZ9A 1ZHIA 5A2QE 3M0PA 3JCMJ 3S3MA 1NJIR 5FRNA 2K3BA 2A3LA 3BW1A 2DZCA 2MI6A 1XOVA 2NWMA 2RI3A 3VUZA 5GAOr 2RHZA 5LJ5j 2K7AA 3OYMA 4JJBA 1JXMA 2IG0A 1WJSA 5A0DA 2CKKA 5J26A 2RM4A 4PJJA 3DLLA 1JQQA 4IUTA 2O88A 4A54A 2EQMA 2EQIA 2JS0A 2EQUA 2KT8A 2RF0A 3G4SA 4AT1B 5I2MA 3EG3A 4Y91A 1ZSGA 1G3TA 2DL5A 4A4EA 2DBKA 1PRLC 4BDZA 3E19A 2FZCB 4KH1B 2LX7A 2VXFA 1QQJA 4EMGA 1U5SA 1OV3A 3RNJA 1XNIA 3O8VA 1UTIA 4QT7A 2R5MA 4TVRA 3OQ5A 1RL2A 2YUPA 3ME9A 4C8QE 1UDLA 3CXCS 3G6EQ 2YLBA 3G4ST 3RKWA 1Q7YC 4ATOA 4LUEA 3CD6A 4L5GA 3HRUA 3I55Q 5KYNA 1OOTA 4E7LA 4XTYA 1NEGA 1HJDA 3FIFA 5GAOp 4CRIA 4ZGEB 2XU8A 3X28B 2VWFA 4M78G 3RBBB 1GFCA 1NJIC 2XK0A 4FW1A 4QW2A 4JS4A 3OSSC 1JBMA 4OMNA 2QQAA 3CD6T 1D09B 5FWBA 2DILA 1G3YA 1Y71A 2DE0X 2BUDA 4JS5A 2PUKB 4C92B 4ZN3A 1VQ7Q 1MMDA 5CKBA 4PJOB 2E6NA 1AWOA 2ABLA 4ZN1A 3I56A 3RUXA 3V8LA 1RI9A 2J7IA 4M75C 5L8RE 1VQ5Q 3OYKA 1BI1A 2EGCA 5J3BA 2P4RA 4IKFA 2DMOA 3A1PA 2FG0A 2JXBA 2CUDA 4F17A 4MMKA 1UFFA 1ZX6A 3CMEQ 1WZOA 4M7AF 4M75F 3JCMX 1N8RC 5FWCA 2CZ6B 2EYYA 3RERA 1AZEA 3CCVA 5GJVB 3CXCP 1Q86R 1K8AU 3GF5A 3V8KA 2X4YA 3I56T 2KYBA 3A8HB 3LGLA 1WHHA 3CCJQ 2XI9A 3CCMQ 2NYSA 2CT4A 3VS3A 1MNEA 4AG1C 4Y92A 3J7AF 2RJDA 1KIKA 3OYAA 2K6DA 4II1A 3QO3A 1VQKQ 3MKDA 1KQ2A 2DVEA 3JCMd 4M7DC 2OX7A 4F7UF 3N5BB 1RACB 2KSSA 2D6FA 3CCVT 2FPEA 1G3WA 2EQKA 2HDAA 1KC8R 4JRIA 1PSEA 5CAIA 4M7DF 4DBRA 2Y4YA 4HVWA 2D0QB 1M9SA 3CC4Q 4XU1A 1Z9ZA 4C8QG 5DM7R 1AEYA 5KCHA 5KYYA 5GAN8 3QUIA 1M1FA 1PC0A 3I9QA 3S6WA 1HSQA 1N9RA 4ESRA 1X43A 3FJPA 4NS5A 1K4US 4JJDA 4A4HA 3OS0A 2RQTA 2K5LA 2OTJQ 4Q5WA 2VXEA 5CR2A 2HCKA 1ZBXA 3MHXA 2C0IA 2DPPB 1O9SA 4PFPA 1QVGA 1FX7A 3M4GA 3L2WA 2CGHA 3P8DA 3I5SA 5GAMd 1Q86C 2KXCA 4M77E 3VYGA 2XIDA 1OYXA 3EH2A 1UG1A 4M78A 4LXCA 2YUOA 1ZSZA 1N27A 3VU3C 3EG9A 2XHCA 3EFSA 1YITQ 5I2SA 5FU7B 4E47A 1QP2A 2O4XB 4CC2A 5GAN3 2EYQA 1OI1A 3OMGA 3A5ZB 4BY6B 1U1SA 4FCYA 2VV5A 1M1KR 2KGTA 1X6GA 1PSFA 5DLOA 1T0JA 3H0FA 2EYXA 2A0FB 1QKXA 2X4XA 2CUBA 1U3OA 1KHCA 1M2VA 2K4YA 1KC8C 1KQSP 4PJOC 3NTIA 2R5AA 1AWWA 4JZ3A 4N0AA 2F2XA 3OS2A 2E65A 2G6FX 1GXIE 4FYVB 2COZA 5GMKm 1ZBJA 1GRIA 5L23A 3R6OA 5A0GA 2QEXA 4FT2A 5GMKe 3EGUA 3E9FA 4PJOF 1GCQA 3CCRQ 1G5VA 4DEXA 4OP0A 2LQKA 4N4HA 3LH5A 4C92E 4LDXA 3QYGB 3H9NA 4N4IA 2JT4A 5GAOm 2V1QA 4ZNXA 5KYWA 4MZMA 1YWPA 3OMCA 1J3TA 2RD1A 1MMGA 3JB9J 3M9QA 2K3XA 1KHIA 2XKOC 1RADB 4CI0C 2QEXT 2QGGA 3TVTA 3DKMA 4C0ZA 2RI5A 1N9SA 3JCMW 1IRXA 1ABQA 1Z9QA 3M55A 3UA7A 1VQ4A 4FYXB 1OU9A 4C92D 2X35A 3M0TA 2GBQA 3CCUA 4PJOD 3CCQA 1K0SA 2MYSA 2QI2A 3QHSA 3H6ZA 3MP1A 1X6OA 1I4K1 1NYFA 3EGXA 1FMKA 4C8QA 4PK4A 2L0AA 4C5IA 3QYHB 1M1KC 1RAHB 4F14A 1SRMA 5KYXA 1CSKA 1WJQA 2JS2A 2EWNA 1FXXA 4A4FA 4XTWA 2CYZB 2G3RA 2O01E 4LUDA 2O9VA 2L3RA 1VQ4T 1JJ2S 2HAXA 2YT6A 4M77G 2P0KA 1ZUKA 4RTTA 3CCUT 3CCQT 4OMMA 4MZPA 2CREA 4DBFA 3CPFA 1VQMA 2HQXA 2HNIA 4X9CA 2RJEA 2RN8A 3JCMf 5D6YA 4WCIA 2QGFB 1KD1U 1SSFA 2MCNA 3OS1A 2E5KA 2DJQA 3QJYA 5CKDA 2DYIA 2ATCB 1NBEB 2CDTA 4MDWA 2JTEA 1VQNA 1M3AA 2O31A 4JJCA 2W0ZA 3M4YA 5HKCA 2LP5A 2XDPA 2KEAA 3WVDB 3BFMA 1ZQ1A 5GAMh 4KULA 1KK7A 1VQMT 4JJNK 4N4GA 1CKAA 3U23A 4PJMA 5FU7C 5I21A 3J81E 2JJ9A 2PTKA 1R0BG 3ULRB 2E1HA 2HKQB 2A37A 1PWTA 2YSQA 2OJ2A 1YJNQ 2E41A 4ZGDB 3CCEQ 1VQNT 2QQ9A 2NLUA 1QMCA 3QWYA 5LJ5f 1T3LA 1AVZC 2AZVA 5IXBA 4C5EA 3L2RA 3LYIA 4F16A 3JSCA 1WIEA 3H0IA 3CMAA 3C12A 2YRDA 3EHRA 3CXCA 1RABB 2KDSA 2EJFA 3PE0A 5GANd 1X2QA 1QP3A 2YHTA 1YI2Q 1YHQQ 2X9HA 2ROLA 3CBPA 1MUZA 3NGPA 4M78C 3TQ7P 3UPUA 4X9DA 1ZSZC 2DEUA 5CQXA 2OAWA 4M7AB 3R6NA 3EHQA 4M75B 2DIGA 1QVFP 1Y07A 1Y0MA 4EMKA 2DTHA 1OQKA 4FYWB 3JCMg 2KRNA 1NEBA 6AT1B 2ZCFB 4ELYC 3CMAT 4M78F 3PIPA 4OMLA 2GTOA 3TSWA 2E10A 2COWA 1TH7A 2ECZA 5CKHA 3NFCA 3FRNA 3OSVA 3G7ZA 1AWJA 2V1RA 3BE3A 3TCJA 4XTUA 5AT1B 1NPRA 2R57A 1NG2A 4OGEA 3HL8A 1T3SA 3JB9G 1WFWA 2VB6A 4LDWA 3CEYA 2J6KA 2JTFA 3RR6A 2F1LA 4HCBA 1B34B 2KNBB 2EIFA 2FL7A 2DJZA 1K1ZA 3UATA 1K9MC 4M77A 1BI2A 1SHFA 2RA2A 1MMNA 2GGRA 4M7DB 2DIQA 3LGFA 3EFOB 1WHMA 2YLCA 4KGXB 2NUTB 3OYDA 4PFOA 1V76A 5LJ5g 2MIOA 2Y90A 5GAMj 3E2UA 3QPHA 4HKEA 3G1JA 2OAUA 2YWWA 2X4JA 2RQUA 2V8KA 1D1BA 2MF2A 1WHLA 1YWOA 2CH4W 2J05A 2DLPA 2XDBA 3H0HA 2DA9A 2DXBA 1U1TA 1RI0A 4LDYA 2C06A 1M3CA 1IGUA 2YRVA 1I5LA 3HFOA 3ZL7C 1WPYA 1Y96B 2L3SA 1UGPB 4E7KA 3CD6Q 1M4ZA 2F2WA 2CH4A 3JCMe 3CBMA 5LJ3d 1S1NA 4HXJA 1IHWA 3NPFA 1N8RR 1B07A 3MP6A 2VGNA 1EX4A 1K76A 1BCMA 3HRTA 3X20B 5KE3A 2DD5A 3I35A 3SWNC 2NUPA 2KYMA 4ANJA 3FJ5A 5EG2A 4C5HA 2DRMA 4KRTA 1Q81R 2F69A 1HD3A 1NZ9A 3DLMA 4C92A 2E3IA 2PZ1A 1D3BA 2QTXA 1H92A 4E7SA 1OZ3A 1PKSA 1WXTA 2Y4XA 3M53A 4OMPA 1Q86U 1K9AA 5FLXE 3I56Q 2BIVA 1NLPC 2VASA 2ZPHB 5GJWB 1YJ9A 4IUPA 4KGVB 4CC4B 2DETA 3LX7A 4JRKA 2I2LA 2L8DA 2M02A 2JMCA 1Q82C 3I5RA 3TSZA 4RTYA 1CKBA 5LJ5e 2DTIA 2D1XA 2WSCE 2LDMA 4M7AC 1OU8A 4PL6A 5GANh 1HK9A 3CC7Q 3QJ6A 1WNLA 1U8RA 2M0YA 2LCLA 1WHGA 3CCVQ 2J6FA 2RK1A 2DL8A 1GCPA 2ENMA 2AK5A 5HCKA 4WF2A 2CZ7B 2K5IA 1YJ9T 1QCOA 2YUQA 1VYVA 2ZZDA 1KC8U 3MPUB 4IURA 1K0XA 3CCLA 2H8HA 1SEMA 2FRWA 2DM1A 1RAFB 4LD9K 4AFZC 2HQHA 2LVMA 4C0FA 4M75E 3MCAB 4J9FA 2LC4A 3OYBA 1W2BS 3QZ9B 2YUNA 3CC2A 2Z0WA 2RPNA 1Q81C 1JEGA 4EMHA 4PJNA 5KYUA 4E2FB 4PNOA 3UWNA 3A8LB 2JM8A 1M8VA 1HXDA 2HQEA 2LX9A 2RJFA 1YFNA 4KUDK 3HSBA 3VS0A 4Z89A 2B8AA 1TG0A 3CCLT 5FROA 2RK2A 2MMPA 2EFIA 3GNFB 2RHXA 4FSXA 2GCXA 2O9SA 1SKUB 1MHNA 4F7UE 1BBZA 4M7AD 1QCNA 4M75D 2RQVA 1Y57A 2EJGA 3ZEHA 3CC2T 1MV3A 4BD3A 2ESWA 3KBGA 3OYHA 3SEMA 3CCJA 1KQSS 1W1FA 1R77A 2KQWA 3FDRA 5CO7A 4M7DE 2HL3A 4RTZA 2DL4A 1FYNA 5D7UA 2QG9B 4MZTA 3TEEA 3GBQA 2XD0A 4DBQA 2EYWA 2JNGA 3SDZA 1M1KU 1VQKA 5I11A 2KMTA 1KG1A 4C0GA 2P0PA 2V26A 2YRCA 4HCCA 1WHKA 2O4XA 3EAEA 3M59A 3AT1B 4B9WA 5IHNA 5EC7A 2DX1A 2L3PA 1K8AR 1WHJA 3HTRA 4M4ZA 3CCJT 2PVGB 1P92A 1LOJA 5LJ3h 3A98A 1WQ7A 2ED0A 3PNWC 1UEBA 4BE0A 1W2BP 4HVVA 3CPWP 5KCOA 3PTAA 4M7DD 2NUZA 1QW1A 1M90R 2DKGA 1RAEB 4OMFB 4YTLA 1JJ2A 1IGQA 1VQKT 5GANj 3HP9A 3C94A 2PU9B 4M77F 3JRZA 3A8GB 1BK2A 1NYGA 4RMOA 1SPKA 2XG8D 3PGGA 1R8OB 2BZXA 2KRMA 5HK0A 3HFNA 2E3HA 2KRSA 3QIIA 4X1VA 1C0MA 3H8ZA 3INZA 4OB2B 4JLIA 3C4SA 2CP2A 1QVFA 2M51A 3HHTB 5KYYB 2V8IA 4PLIA 3FC3A 1WXBA 3KUFA 4P5NA 1ACMB 2KXDA 4CC3A 3M5AA 2QEXQ 2HEQA 5CK9A 1YNZA 5IT9E 3CCSA 4BDYA 2MPXC 4OMOA 1VQ9A 3T9NA 2A08A 2K57A 1YP5A 1UGVA 2M1HA 2CZ1B 2K5FA 3MEVA 1YITA 1VYUA 3REAB 2BZ8A 2MWOA 4J9IA 3L42A 4M78B 2GNCA 1NLOC 2XDDA 1ZSZB 1OEBA 4PJOE 3EG9B 1TOVA 1UGQB 1XTDA 4J6WA 4IUVA 5CCAA 4PKCC 1K8AC 3CCST 1BCOA 2LQ8A 4OMQA 2BE7D 1VQ9T 3VS7A 5IH2A 1TXQA 4L6V5 4F7UG 1VQ4Q 2VKNA 4IIMA 4DQ2A 3CCUQ 3CCQQ 1YITT 1VUBA 5IHKA 5D6WA 3JCMQ 1M90C 2CT3A 2HL5C 4JUVA 3META 3C0CA 3IQLA 2JOYA 1M2VB 4PJLA 5IHIA 2GFUA 2E70A 3MJXA 2WACA 1PCXA 4JLGA 3RKYA 4GLKA 1VQOA 1C1AA 1H8KA 3CBOA 3LH0A 2R58A 2MWPA 3P8HA 1W4SA 1AWXA 1VQ8A 2GF7A 4B9XA 2ZPBB 1V29B 5LJ3j 2OTLA 5ECAA 2XICA 4QVZA 3GP8A 1VQMQ 5M9OA 1S72Q 3FLGA 1LVKA 2CSQA 4HA8A 4RTUA 1TS9A 2BTTA 2K3YA 1DJ7B 4LDUA 4A4KA 3G71A 3V7CA 5KYWB 1NPPA 3M0UA 4RKUE 3ZBDA 2BZYA 3HPWA 4BI4A 1VQOT 1K73R 5IXFA 1VQNQ 1M3BA 2QQBA 2V8JA 4J6XA 3RDVA 3X24B 1VQ8T 4Z8AA 2OTLT 1QVFS 2DAQA 1ZUUA 2HD0A 4OVAA 1YJWA 1UE9A 1AZGB 4XU2A 3G71T 2C0OA 4KH0B 3SD4A 2AIRB 4FIBA 1VQLQ 2HZYA 2ZPGB 2DXUA 1MNDA 3EGXB 4OF1A 4HT8A 5IAYA 4C8QB 4FW2A 1D0ZA 1W70A 2DEQA 5GAN6 1KSWA 1QWFA 4RG8A 2D8HA 2PNIA 3RESA 1LPLA 3SWNB 4ZTJA 5I22A 1ARKA 1TWBA 5KE2A 1IO6A 1YJWT 1X01A 3CMAQ 4Z02A 2PVDB 3PVLA 4J9BA 4M75A 4QVCA 3GOXA 4X34A 1K9MR 2EGAA 4J83A 1UUEA 1Y7XA 2HMAA 2LCCA 4C92G 4UC4A 1Q7YU 1VQ6Q 1IHVA 5GAMf 4OB1B 1I1JA 1M2OA 3GNGA 3OW2S 2CP6A 3J80E 2A28A 4DOWA 5GMKi 1OX8A 1VIFA 3OBWA 1QVGP 3M57A 2ZPEB 3TU4K 1UJ0A 1KD1R 4LD6A 4QQGA 1PG5B 4QQDA 2JZ2A 1IXDA 1Q95G 1K73C 4F7UA 3HRSA 5FRMA 2BE9B 2KE9A 1ABOA 1NJIU 2DK3A 3CCEA 3EGDA 4EDUA 1SSHA 1V1CA 2EKHA 1B34A 2KT1A 3M54A 1M1GA 1XQHA 5HY6A 4EPCA 4DA4A 2CP5A 4M7DA 3PMIA 1WA7A 4J7FA 2K2VA 2VYTA 1B3QA 4J6YA 1PRMC 3EFOA 2ZPIB 4RCCA 2PUOB 4BE2A 3SFMA 2DBMA 2FHDA 4ZGJB 1YCSB 1SG5A 4N0AC 2LZ6B 3V7RA 2DERA 4Z88A 5GAN2 3VV0A 3L1AA 3CCET 1IZ6A 3L2QA 3F70A 4J9GA 5GAN5 3KFVA 1YIJA 1I8FA 2RHIA 2RHYA 4FSSA 1N8RU 4E6RA 2RHUA 3EG0A 3QBYA 2B86A 4JZ4A 1GCQC 1JXOA 4GY5A 1ZA2B 1D1CA 2IPOB 1PHTA 2QA4A 3QWXX 1Y96A 1WLPB 4BB7A 3G4SQ 2EVRA 1E6GA 5GMKl 4M78D 2L5QA 2CP3A 4EMKB 4LDVA 3OW2P 1Q81U 1OPKA 1PKTA 2LNVA 1Q82R 4FYYB 4CC7A 1VQPA 1BI0A 2EW3A 2QXFA 5D6XA 5DY9A 5GAMg 1AD5A 1I0CA 5HK3A 3RIRA 1W2BA 1YIJT 4RTVA 3CPWA 1RAGB 2K79A 2QK0A 1KD1C 1D0XA 4D8DA 2CS7A 5GAOl 2QQSA 2J06A
chains in the Genus database with same CATH topology
4N0AA 4BUGA 2GFAA 3X25B 3OS2A 1Q81C 4O5VA 2E65A 5LJ5h 3JB9D 4XTVA 3V7SA 4EMHA 3VUBA 1N6AA 4OGCA 4XU0A 4M7AA 4QVDA 4PNOA 1GXIE 3MEUA 3UWNA 3A8LB 4KBMB 2QA4T 3JCMV 1KQ2A 3OYYA 1HXDA 1S72T 2HQEA 2LX9A 2RJFA 5GMKm 4KUDK 3HSBA 4HCZA 2B8AA 4E7IA 3CCLT 4ME7A 3R6OA 1JB0E 5A0GA 2QEXA 4FT2A 5FROA 2RK2A 4BY6C 5GMKe 3E9FA 4PJOF 2MMPA 2EFIA 3GNFB 4PJOG 1G5VA 4OP0A 2LQKA 2RHXA 2F5TX 2VGMA 3OB9A 4FSXA 4N4HA 1VQPT 2GCXA 5LJ3e 1IREB 4C92E 1MHNA 1VQLA 4LDXA 4F7UE 3LWHA 3WXMB 3QYGB 4A53A 4C8QC 2P4TA 4N4IA 2PVOB 3QG1A 4M7AD 2FYKA 2RJCA 4M75D 5GAOm 3JCMP 2KVQG 2ZGWA 3FEOA 3QKJA 2DXCA 4MMLA 3PFSA 2EJGA 3A8MB 4J7IA 4M77B 4MZMA 3OMCA 3ZEHA 1YBYA 3CC2T 2MAMA 3GIBA 1KQSA 3JB9H 4BD3A 2RD1A 2QDYB 3KBGA 3OYHA 1LNXA 4NL3A 2JN0A 3JB9J 3CCJA 1KQSS 3BDUA 5DLQE 2KQWA 3FDRA 1YJNA 3M9QA 3OYEA 2K3XA 3UT1A 5CO7A 1KHIA 2XKOC 4M7DE 4PJOA 4ELZC 5CQYA 2EJ9A 1QVPA 4C8QF 1LJOA 4CI0C 2GQVA 3OYGA 2QEXT 1BIAA 3DKMA 1BYMA 2ZPFB 4O6JA 1MGQA 4C0ZA 2RI5A 3HKSA 4MZTA 3TEEA 2XD0A 2KK4A 3SB2A 3PMTA 3WVEB 1N9SA 2EQJA 2JNGA 3OYJA 3JCMW 1Q82U 2RI2A 4JDSA 3SDZA 1M1KU 2KMTA 1VQKA 3M55A 4C0GA 1FWZA 2P0PA 1VQLT 1VQ6A 1KG1A 4HCCA 1VQ4A 2O4XA 3EAEA 3M59A 4C92D 2X35A 5GAOn 4B9WA 3CCUA 4PJOD 1YCYA 3CCQA 1VQ5A 2QI2A 3QHSA 3H6ZA 4M78E 3MP1A 4OB3B 3URGA 5GMKh 1X6OA 1I4K1 3OYLA 3CCJT 2PVGB 1P92A 4C8QA 1LOJA 4IUUA 4C5IA 3QYHB 5LJ3h 3G6EA 1YJNT 1M1KC 2KY9A 1WQ7A 5IN1A 3PNWC 1UEBA 1H641 3OYNA 1WJQA 5GAMe 4BE0A 1YI2A 1M8VA 1YHQA 2EWNA 1FXXA 4R55A 4A4FA 3JAME 4XTWA 5KCOA 3I55A 3PTAA 4M7DD 3JB9I 2CYZB 4BACA 1QW1A 2A7YA 2M16A 2DKGA 1UB4A 2G3RA 2IVWA 2O01E 4OMFB 4YTLA 4FM4B 1JJ2A 1VQKT 3BY7A 3HP9A 5GANj 3C95A 4QQ6A 1VQ6T 3C94A 2L3RA 2PU9B 1BI3A 4C8QD 1VQ4T 4M77F 1JJ2S 3JRZA 4M77G 2P0KA 3A8GB 2HAXA 2X4WA 3TREA 4RMOA 4R56A 1VIEA 3CCUT 2XG8D 3CCQT 3PGGA 1R8OB 4MZPA 5HK0A 3CPFA 1VQMA 3HFNA 3QIIA 3MO8A 4OB0B 2HQXA 2HNIA 3H8ZA 3INZA 2RJEA 4X9CA 2CZ0B 3ER0A 4OB2B 5D6YA 3JCMf 4F7UB 5C6SA 4JLIA 1D3BB 2VC8A 1KD1U 1SSFA 3QDRB 4L59A 4RCBA 3C4SA 5GAOq 3OS1A 1QVFA 3HHTB 3OYFA 3G6ET 5LL6S 4FU6A 3L2ZA 3QJYA 4RG2A 1JRIA 5CKDA 2WSEE 1YI2T 2V8IA 4PLIA 3FC3A 3MEWA 2WSFE 4XTXA 4M7AE 3LWIA 1YHQT 3KUFA 5FU6B 3I55T 3MEAA 2DZ9A 4P5NA 3M5AA 4MDWA 1ZHIA 5GANf 5A2QE 3JCMJ 5CK9A 1VQNA 5IT9E 3CCSA 1VQ7A 3S3MA 3M4YA 5FRNA 4BDYA 3CPWS 2DD4A 5HKCA 2XDPA 2A3LA 3BW1A 1VQ9A 3T9NA 2DZCA 2MI6A 1XOVA 1NE8A 3BFMA 2RI3A 3WVDB 3CC7A 5GAN7 2K57A 1ZQ1A 5GAMh 3VUZA 4KULA 2E6ZA 5GAOr 2RHZA 2D9TA 5LJ5j 1VQMT 4JJNK 4N4GA 2H3JA 5C0MA 3OYMA 2M1HA 2CZ1B 2IG0A 2K5FA 1WJSA 3MEVA 4KT0E 5FU7C 2CKKA 5A0DA 5J26A 1YITA 2RM4A 5I21A 3J81E 3DLLA 2MWOA 2E1HA 4IUTA 4A54A 2EQMA 3CMEA 3L42A 4M78B 3P8BB 2EQUA 4EMKC 3G4SA 2XDDA 4KUIA 5I2MA 4PJOE 2E5QA 1UGQB 1XTDA 4Y91A 2E41A 4J6WA 4ZGDB 1G3TA 4A4EA 4IUVA 4NL2A 4PKCC 5CCAA 1VQNT 2QQ9A 1K8AC 2NLUA 3CCST 1M90U 5CKFA 1VQ7T 4BDZA 3E19A 2LQ8A 4JRQA 4J8OA 4XU3A 1VQ9T 3CC7T 5LJ5f 2RO0A 2VXFA 4L6V5 4F7UG 4EMGA 3MP8A 1VQ5T 3CCMA 2DTOA 3L2VA 1XNIA 4C5EA 4DQ2A 3O8VA 3LYIA 3L2RA 4J5YA 1YITT 4DOVA 1VUBA 3JSCA 5D6WA 3JCMQ 2R5MA 3ZFJA 3E9GA 3CMAA 4TVRA 3C12A 3OQ5A 1M90C 1RL2A 4JUVA 3CXCA 3META 3RKXA 2KDSA 2EJFA 4BI3A 1OZ2A 3ME9A 5A0LA 4C8QE 1AHJB 5GANd 2JOYA 3CXCS 3CMET 3JCMc 2YLBA 3G4ST 3RKWA 1QP3A 2GFUA 1Q7YC 4ATOA 2YHTA 2VUBA 2E70A 3CD6A 3CBPA 2WACA 4M78C 4L5GA 3UPUA 4JLGA 4X9DA 3HRUA 5CQXA 2DXTA 2DO3A 4M7AB 3RKYA 4GLKA 4M75B 1VQOA 4E7LA 2DIGA 4XTYA 1Y07A 4EMKA 3FIFA 3CBOA 3LH0A 2R58A 2MWPA 1G3SA 4CRIA 2DTHA 3P8HA 4M77C 5GMKj 5GAOp 3PIOA 3QSUA 4ZGEB 3CCMT 1W4SA 3JCMg 3RMQA 2F5KA 1VQ8A 5J39A 2GF7A 4B9XA 2XU8A 1V29B 2ZCFB 2ZPBB 4ELYC 5LJ3j 2OTLA 3X28B 2XICA 3LLRA 4QVZA 3GP8A 2M0OA 3CMAT 5M9OA 4M78F 1EIFA 4M78G 3PIPA 3FLGA 3DB4A 4HA8A 2K3YA 1DJ7B 1NJIC 3CC4A 4HT9A 2XK0A 4LDUA 4QW2A 4A4KA 4JS4A 2E10A 3OSSC 3V7CA 3G71A 4C0DB 1JBMA 1TH7A 2QQAA 5GANg 1NPPA 3CD6T 5CKHA 3M56A 1G3YA 1Y71A 3KXTA 3LW5E 2PQWA 3NFCA 5LJ5d 3A8OB 3FRNA 2BUDA 3OSVA 4RKUE 2PUKB 3G7ZA 4JS5A 2RH2A 3TCJA 4XTUA 3ZBDA 1BIBA 3HPWA 4BI4A 1VQOT 4C92B 1NPRA 4ZN3A 2R57A 3S3OA 5CKBA 4OGEA 4BE1A 4PJOB 3HL8A 2E6NA 3JB9G 4ZN1A 2QQBA 5KH6A 3RUXA 3V8LA 3I56A 2OTJA 5CIUA 4M75C 5LJ3f 4LDWA 2V8JA 4J6XA 3CEYA 3X24B 3AHUA 2RB6A 1VQ8T 5L8RE 1QVFS 2OTLT 1UGSB 2JTFA 2E64A 3VKIA 4BI8B 1BI1A 2DAQA 3OYKA 4HCBA 2HD0A 4OVAA 1B34B 5J3BA 1YJWA 5AYFA 1BKBA 3GLXA 2EIFA 4IKFA 2FL7A 2DJZA 2E12A 3OS5A 4XU2A 3CC4T 1K9MC 4M77A 1BI2A 2RA2A 4JRPA 3G71T 1X75C 4MMKA 4M7DB 2DIQA 5CVIA 3SD4A 3LGFA 4M7AF 4M7AG 4FIBA 4M75F 2YLCA 4M75G 2ZPGB 3JCMX 2FVUA 2DXUA 2L89A 4OF1A 2EAYA 1N8RC 4HT8A 5IAYA 3OYDA 4C8QB 2CZ6B 2DEQA 3RERA 5GAN4 4D6WA 5LJ5g 5GAN6 2Y90A 5GAMj 3CCVA 4RG8A 3QPHA 1K8AU 3GF5A 3V8KA 2X4YA 3RESA 4HKEA 2LT1A 3I56T 2OTJT 4Y28E 3SWNB 3A8HB 4ZTJA 4M77D 4C92C 2OAUA 3LGLA 2X4JA 4XAXB 2XI9A 3QXEB 3EFRA 2EKOA 3OBYA 2V8KA 5KE2A 1WGSA 1YJWT 4VUBA 2MF2A 1X01A 3OY9A 3E1SA 3J7AF 2RJDA 4FL6A 4Z02A 2XDBA 2DXBA 2PVDB 1U1TA 3M58A 4M75A 1RI0A 2M9UA 4LDYA 4QVCA 2LTOA 5FU6C 3OYAA 3GOXA 2YRVA 2C06A 1I5LA 3HFOA 4X34A 4II1A 1WPYA 3S3NA 4J83A 4XQ3A 3QO3A 1Y7XA 1Y96B 2BKDN 1UGPB 2DVEA 2LCCA 4C92F 4UC4A 4C92G 1UGRB 3JCMd 4E7KA 1Q7YU 1M4ZA 4F7UF 3JCMe 3N5BB 4M7DC 5GAMf 1WJRA 3CBMA 4OB1B 5LJ3d 2JUFA 2HBPA 2KSSA 2D6FA 3OW2A 3CCVT 2LT4A 3MP6A 1K73U 2VGNA 1G3WA 1I81A 3GNGA 3OW2S 2KAFA 1H3ZA 3J80E 2EQKA 3HRTA 3X20B 4DOWA 5KE3A 5GMKi 3DB3A 2DD5A 3OBWA 1VIFA 3SWNC 5GANe 3OYIA 3M57A 2ZPEB 3TU4K 4JRIA 1PSEA 5CAIA 4M7DF 4LD6A 4QQGA 4M7DG 2Y4YA 1O75A 3CCRA 5EG2A 4E7JA 4C5HA 4QQDA 2JZ2A 2F69A 2D0QB 1K73C 1NZ9A 3DLMA 4C92A 3VJPA 1M9SA 3OYCA 4F7UA 3OA6A 3HRSA 4XU1A 5FRMA 1D3BA 2JTMA 2QTXA 4C8QG 1NJIU 5DM7R 2DK3A 5KCHA 3NTHA 3CCEA 2P0QA 3GPLA 1OZ3A 5GAN8 3QUIA 1M1FA 4EDUA 4V2SA 3PT9A 3S6WA 1B34A 2Y4XA 3M53A 5LJ3g 3RMSA 3M54A 1N9RA 1Q86U 1M1GA 3FB9A 4E7HA 1XQHA 3FJPA 4NS5A 5HY6A 5FLXE 4EPCA 4DA4A 4A4HA 4C5GA 3OS0A 4NOYA 2K5LA 4Q5WA 4M7DA 2VXEA 2BIVA 3PMIA 5CR2A 2ZPHB 4J7FA 2K2VA 1YJ9A 1ZBXA 3MHXA 2VYTA 4IUPA 4J6YA 2DPPB 3LX7A 4JRKA 2ZPIB 2I2LA 1O9SA 2L8DA 4RCCA 3JCMh 2QQRA 2PUOB 3CCRT 4BE2A 1QVGA 3SFMA 1FX7A 3M4GA 2FHDA 2CGHA 4ZGJB 3L2WA 1Q82C 2AHJB 3P8DA 1QVGS 5LJ5e 5GAMd 1Q86C 2DTIA 5CKEA 4PLLA 4M77E 4N0AC 3VYGA 2XIDA 3V7RA 1K9MU 3SWNA 5GAN2 3VV0A 2WSCE 3L1AA 3CCET 2LDMA 1IZ6A 3L2QA 3JB9F 1OYXA 3F70A 3NTKA 3X26B 4M7AC 5GAN5 4PL6A 1YIJA 5GANh 1I8FA 2RHIA 4M78A 1HK9A 4XTZA 3QJ6A 1WNLA 1M5Q1 1U8RA 1N27A 2RHYA 3VU3C 1N8RU 2LCLA 2XHCA 2RHUA 3EFSA 3BDLA 2RK1A 3QBYA 4GY5A 5I2SA 4WF2A 2CZ7B 5FU7B 4E47A 1QP2A 2K5IA 2O4XB 5GAN3 2EYQA 1YJ9T 1OI1A 3OMGA 2QA4A 3A5ZB 4BY6B 4MDXA 2ZZDA 3ASKA 1U1SA 1Y96A 4ZTFA 1S72A 1KC8U 4BB7A 4IURA 3UDCA 3JCMb 1KQ1A 3CCLA 5GMKl 2L5QA 4M78D 4EMKB 1WQWA 4LDVA 4XK8E 2FB7A 4C0DC 3L2UA 2JVVA 1Q81U 4LD9K 2VV5A 2LNVA 2LVMA 1VQPA 4FT4A 3V8JA 4C0FA 1BI0A 4M75E 2QXFA 1PSFA 5D6XA 4A4GA 5DLOA 5DY9A 5GAMg 5HK3A 3MCAB 3Q1JA 3RIRA 2LRQA 1W2BA 1YIJT 2X4XA 1KC8C 1KHCA 2K4YA 2LC4A 3CPWA 3OYBA 4PJOC 3NTIA 3QZ5B 1W2BS 2R5AA 4IUQA 3QZ9B 1KD1C 2CS7A 5GAOl 2QQSA 3VYHB 3CC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q81 C;  1VQ8 A;  3ER0 A;  3DB3 A;  2OTL A;  1KD1 U;  1SSF A;  3CMA T;  1QVF A;  1EIF A;  3G6E T;  2QA4 T;  3PIP A;  5LL6 S;  3DB4 A;  3OYY A;  1S72 T;  4RG2 A;  1M90 C;  1YI2 T;  3CCR A;  3CCL T;  1YHQ T;  1NJI C;  2QEX A;  4QQD A;  3CC4 A;  1K73 C;  3G71 A;  1NZ9 A;  3I55 T;  1NPP A;  3CD6 T;  1VQP T;  5A2Q E;  1NJI U;  1VQN A;  5DM7 R;  5IT9 E;  3CCS A;  3CCE A;  1VQ7 A;  1VQL A;  3CPW S;  1VQO T;  1VQ9 A;  1NPR A;  4ZN3 A;  2MI6 A;  2KVQ G;  3CC7 A;  3CC2 A;  4ZN1 A;  3I56 A;  2OTJ A;  1Q86 U;  2E6Z A;  1M1G A;  1VQ5 A;  1VQM T;  3CC2 T;  1YBY A;  5HY6 A;  5FLX E;  1KQS A;  1VQ8 T;  2IG0 A;  3KBG A;  1YIT A;  1QVF S;  2CKK A;  2OTL T;  5J26 A;  3CCJ A;  3J81 E;  5DLQ E;  1KQS S;  1YJ9 A;  3DLL A;  2MWO A;  1YJN A;  5J3B A;  1YJW A;  1BKB A;  1KHI A;  2EIF A;  3CCR T;  1QVG A;  3CME A;  3CC4 T;  1K9M C;  3P8B B;  2QEX T;  1Q82 C;  3G4S A;  3G71 T;  1QVG S;  1Q86 C;  3HKS A;  1XTD A;  3LGF A;  1K9M U;  2JNG A;  1Q82 U;  1VQN T;  1M90 U;  1K8A C;  3CCS T;  1M1K U;  1VQ7 T;  1IZ6 A;  1N8R C;  1VQK A;  1VQL T;  5IAY A;  3CCE T;  2LQ8 A;  1VQ6 A;  1YIJ A;  1VQ4 A;  1VQ9 T;  3CCV A;  3CC7 T;  3CCU A;  1K8A U;  3CCQ A;  3I56 T;  1N8R U;  2LCL A;  2OTJ T;  2XHC A;  1VQ5 T;  3CCM A;  3LGL A;  1XNI A;  1X6O A;  1YIT T;  3CCJ T;  1YJ9 T;  3CMA A;  4TVR A;  3G6E A;  2QA4 A;  1VQM A;  3A5Z B;  1RL2 A;  1YJN T;  3CXC A;  1YJW T;  1S72 A;  1KC8 U;  1M1K C;  1YI2 A;  3J7A F;  1UEB A;  2KDS A;  3CME T;  2JOY A;  3CXC S;  1YHQ A;  3CCL A;  3G4S T;  1Q7Y C;  3JAM E;  3I55 A;  2JVV A;  2E70 A;  1Q81 U;  3CD6 A;  4X34 A;  2LVM A;  1VQP A;  2G3R A;  4YTL A;  1JJ2 A;  1Q7Y U;  1VQK T;  2DO3 A;  1VQ6 T;  2L3R A;  1W2B A;  1YIJ T;  2JUF A;  1VQ4 T;  1VQO A;  1JJ2 S;  1KC8 C;  3CPW A;  3OW2 A;  3TRE A;  3CCV T;  1K73 U;  1W2B S;  3CCU T;  1KD1 C;  3LH0 A;  3CCQ T;  2MWP A;  4CRI A;  3OW2 S;  3PIO A;  3CPF A;  3CCM T;  3J80 E; 
#chains in the Genus database with same CATH topology
 4BUG A;  4O5V A;  1M30 A;  4XTV A;  4WTO B;  1N6A A;  4OGC A;  4KBM B;  2QA4 T;  3JCM V;  4HCZ A;  4E7I A;  1JB0 E;  2F5T X;  3OB9 A;  1VQP T;  2D0N A;  1RAI B;  4A53 A;  4C8Q C;  1QKW A;  3QG1 A;  3JCM P;  2RQW A;  7AT1 B;  4MML A;  4M77 B;  4J7I A;  2ZAE A;  1YBY A;  2MAM A;  4DBH A;  1KQS A;  2QDY B;  4NL3 A;  2JN0 A;  3BDU A;  5DLQ E;  4PJO A;  5CQY A;  1YJ9 Q;  2I0N A;  2QYZ A;  4C8Q F;  1LJO A;  2JMA A;  2GQV A;  1BIA A;  1UEC A;  1BYM A;  2ZPF B;  4O6J A;  1E7O A;  2FO0 A;  3HKS A;  1TTH B;  2KK4 A;  3SB2 A;  3WVE B;  1RUW A;  3OYJ A;  2RI2 A;  4JDS A;  4LNP A;  1GL5 A;  1FWZ A;  1UHC A;  4E7Z A;  2YXY A;  4JPB W;  1SF9 A;  5GAO n;  1YCY A;  1TUC A;  1BU1 A;  2K9G A;  1RLQ C;  1EZZ B;  3M0Q A;  4OB3 B;  2AKK A;  5GMK h;  1G83 A;  3G6E A;  2KY9 A;  5IN1 A;  3OYN A;  5GAM e;  2FZG B;  4R55 A;  1U06 A;  3M0S A;  3I55 A;  3JB9 I;  3CCL Q;  4BAC A;  1UB4 A;  1M8M A;  3EG1 A;  3O5Z A;  2L2P A;  2NUP B;  4C8Q D;  5FW9 A;  1VIE A;  2ED1 A;  4OB0 B;  3M0R A;  2CZ0 B;  3ER0 A;  1D3B B;  2VC8 A;  3CC2 Q;  2LJ3 A;  3QDR B;  5GAO q;  3G6E T;  3OYF A;  4RG2 A;  1JRI A;  1TSF A;  2WSE E;  1JU5 C;  3MEW A;  4XTX A;  2O2O A;  4M7A E;  3LWI A;  1TU0 B;  1B7T A;  4GBQ A;  1PD1 A;  5FU6 B;  3I55 T;  2AZS A;  2D8J A;  5GAN f;  1VQ7 A;  1AT1 B;  1WDX A;  3CPW S;  2DD4 A;  2YDL A;  1NE8 A;  2KR3 A;  3CC7 A;  5GAN 7;  2E6Z A;  1VQ5 A;  2D9T A;  5C0M A;  2H3J A;  1SRL A;  1VYT A;  4KT0 E;  3VS5 A;  1N5Z A;  2JW4 A;  3CME A;  3P8B B;  3JV3 A;  4RTW A;  4EMK C;  4KUI A;  2E5Q A;  1M27 C;  1C6V X;  3VS4 A;  4NL2 A;  1M90 U;  1TUG B;  1VQ7 T;  5CKF A;  1X6B A;  4JRQ A;  4J8O A;  1GBQ A;  3PVQ A;  4J9H A;  4XU3 A;  1T0H A;  2LQW A;  3CC7 T;  2RO0 A;  1D0Y A;  3MP8 A;  1VQ5 T;  3CCM A;  2DNU A;  2VVK A;  2DTO A;  3L2V A;  4J9E A;  4J5Y A;  4DOV A;  3ZFJ A;  3E9G A;  2KBT A;  2FRY A;  4LN2 A;  3RKX A;  4BI3 A;  5A0L A;  1OZ2 A;  3CME T;  1AHJ B;  4RTX A;  3JCM c;  2VUB A;  1JO8 A;  2DRK A;  1EFN A;  2DXT A;  2DO3 A;  5KYU B;  1QWE A;  3VS1 A;  1PM3 A;  5GMK j;  1G3S A;  4M77 C;  3PIO A;  3QSU A;  3CCM T;  3RMQ A;  2F5K A;  1SHG A;  1G8X A;  5J39 A;  4IIO A;  3LLR A;  1IB8 A;  2M0O A;  1EIF A;  1UJY A;  3DB4 A;  2EBP A;  4B6M A;  1VOM A;  3VS2 A;  2COY A;  1WYX A;  3CC4 A;  4HT9 A;  2FEI A;  3EG2 A;  4C0D B;  5GAN g;  3M56 A;  1RAA B;  3KXT A;  3LW5 E;  2PQW A;  5LJ5 d;  3A8O B;  3VS6 A;  1UHF A;  2QTV A;  2GTJ A;  2RH2 A;  1BIB A;  3CCS Q;  3UF4 A;  3S3O A;  4BE1 A;  2OI3 A;  5KH6 A;  2OTJ A;  1VQ9 Q;  5CIU A;  2L3Q A;  5LJ3 f;  3AHU A;  2RB6 A;  1UGS B;  1X2K A;  1GFD A;  2E64 A;  3VKI A;  4BI8 B;  1ZLM A;  2DF6 A;  5AYF A;  1BKB A;  3GLX A;  2E12 A;  3OS5 A;  3CC4 T;  2KI7 A;  4JRP A;  2MK5 A;  1X75 C;  3D7S B;  2X3X D;  5CVI A;  4M7A G;  4M75 G;  2FVU A;  1FMW A;  2L89 A;  1ZUY A;  2EAY A;  2AT1 B;  5GAN 4;  4D6W A;  2QAS A;  2LJ1 A;  1PD0 A;  2LT1 A;  1I5O B;  4RUG A;  3THK A;  4Y28 E;  2OTJ T;  1D1A A;  4M77 D;  4C92 C;  2AKL A;  2RNA A;  4XAX B;  4EIK A;  3QXE B;  3EFR A;  2EKO A;  3OBY A;  1WGS A;  4VUB A;  1MV0 B;  2LJ0 A;  3EH1 A;  3OY9 A;  3E1S A;  4AFS C;  1KJW A;  2MOX A;  4FL6 A;  3M58 A;  2M9U A;  2LTO A;  5FU6 C;  3S3N A;  4XQ3 A;  2BKD N;  4C92 F;  1UGR B;  1YN8 A;  1W6X A;  1WJR A;  2JUF A;  2HBP A;  2HKN A;  3OW2 A;  2LT4 A;  1R0C B;  1K73 U;  1I81 A;  8ATC B;  1VQO Q;  1XJW B;  2KAF A;  1H3Z A;  4R0K A;  2F2V A;  3DB3 A;  4QKU A;  5GAN e;  3OYI A;  2HBW A;  1VQ8 Q;  2OTL Q;  2KRO A;  4M7D G;  1O75 A;  4AFQ C;  3CCR A;  4E7J A;  3VJP A;  3OYC A;  2DYB A;  3OA6 A;  3H41 A;  2JTM A;  3G71 Q;  3NTH A;  2P0Q A;  3GPL A;  4AMC A;  3NHN A;  4V2S A;  3PT9 A;  4D8K A;  1WI7 A;  1WXU A;  5LJ3 g;  3RMS A;  3FB9 A;  4A63 B;  4E7H A;  4C5G A;  4NOY A;  2IIM A;  2DL3 A;  1X69 A;  1QCF A;  3JCM h;  2QQR A;  3CCR T;  2CSI A;  1YJW Q;  2AHJ B;  1QVG S;  1FMV A;  5CKE A;  4PLL A;  1K9M U;  3SWN A;  2EPD A;  3JB9 F;  3NTK A;  3X26 B;  3SHW A;  4XTZ A;  1M5Q 1;  4AFU C;  3CQT A;  3BDL A;  2CP7 A;  1I07 A;  1BB9 A;  2J6O A;  2H3E B;  1QLY A;  4MDX A;  3ASK A;  4GLM A;  4ZTF A;  1S72 A;  3UDC A;  3JCM b;  1KQ1 A;  1WX6 A;  1WQW A;  1LCK A;  4XK8 E;  2FB7 A;  1TUD A;  4C0D C;  3L2U A;  1RLP C;  2JVV A;  1OPL A;  4FT4 A;  3V8J A;  4A4G A;  5KYX B;  3Q1J A;  2EYZ A;  2LRQ A;  2FPF A;  3QZ5 B;  4IUQ A;  4J9D A;  1A0N B;  3VYH B;  2GFA A;  3X25 B;  2FZK B;  5LJ5 h;  2X51 A;  3JB9 D;  3NMZ C;  3V7S A;  2W10 A;  2P84 A;  3VUB A;  4XU0 A;  4M7A A;  4QVD A;  3MEU A;  1X27 A;  3OYY A;  1S72 T;  2HSP A;  2C0T A;  4ME7 A;  2QDL A;  4BY6 C;  2JM9 A;  4PJO G;  1OUL A;  2VGM A;  3VRZ A;  5LJ3 e;  1IRE B;  4AG2 C;  1GBR A;  2K2M A;  4J9C A;  2QAZ A;  1VQL A;  3LWH A;  3WXM B;  2LQN A;  1VA7 A;  2DFU A;  2P4T A;  2PVO B;  3QDF A;  2FYK A;  2RJC A;  2KVQ G;  3VRY A;  2ZGW A;  3FEO A;  3QKJ A;  2DXC A;  4HCK A;  2LNH B;  3PFS A;  3A8M B;  3UA6 A;  1AOJ A;  4F04 B;  2FPD A;  3GIB A;  3JB9 H;  1PNJ A;  2X3W D;  2E4H A;  2DL7 A;  1LNX A;  4K11 A;  1YJN A;  3OYE A;  3UT1 A;  4ELZ C;  1G2B A;  4DEY A;  2SRC A;  2EJ9 A;  1QVP A;  1OX9 A;  4ORZ A;  3OYG A;  1JJ2 P;  1MGQ A;  2GQI A;  9ATC B;  3PMT A;  4KGZ B;  2EQJ A;  1Q82 U;  4LE9 A;  1VQL T;  1MMA A;  2LCS A;  1VQ6 A;  1ZA1 B;  1YIJ Q;  4M78 E;  3URG A;  2NUT A;  3OYL A;  4IUU A;  1YJN T;  1YI2 A;  1H64 1;  1YHQ A;  2QA4 Q;  3JAM E;  1F1B B;  1HYO A;  2A7Y A;  2M16 A;  2ROT A;  2IVW A;  4FM4 B;  1H3H A;  3BY7 A;  2XMF A;  3C95 A;  4QQ6 A;  2EGE A;  1VQP Q;  2RMO A;  1VQ6 T;  1BI3 A;  1Q7Y R;  3REB B;  8AT1 B;  2X4W A;  3TRE A;  4R56 A;  1E6H A;  2SEM A;  3MO8 A;  2LMJ A;  4PFZ A;  4F7U B;  5C6S A;  4L59 A;  4RCB A;  2HSE B;  2RQR A;  1NM7 A;  5LL6 S;  4FU6 A;  3L2Z A;  3EGD B;  1YI2 T;  1KFZ A;  2A36 A;  2WSF E;  2DVJ A;  4HVU A;  1YHQ T;  2CP0 A;  3MEA A;  2DZ9 A;  1ZHI A;  5A2Q E;  3M0P A;  3JCM J;  3S3M A;  1NJI R;  5FRN A;  2K3B A;  2A3L A;  3BW1 A;  2DZC A;  2MI6 A;  1XOV A;  2NWM A;  2RI3 A;  3VUZ A;  5GAO r;  2RHZ A;  5LJ5 j;  2K7A A;  3OYM A;  4JJB A;  1JXM A;  2IG0 A;  1WJS A;  5A0D A;  2CKK A;  5J26 A;  2RM4 A;  4PJJ A;  3DLL A;  1JQQ A;  4IUT A;  2O88 A;  4A54 A;  2EQM A;  2EQI A;  2JS0 A;  2EQU A;  2KT8 A;  2RF0 A;  3G4S A;  4AT1 B;  5I2M A;  3EG3 A;  4Y91 A;  1ZSG A;  1G3T A;  2DL5 A;  4A4E A;  2DBK A;  1PRL C;  4BDZ A;  3E19 A;  2FZC B;  4KH1 B;  2LX7 A;  2VXF A;  1QQJ A;  4EMG A;  1U5S A;  1OV3 A;  3RNJ A;  1XNI A;  3O8V A;  1UTI A;  4QT7 A;  2R5M A;  4TVR A;  3OQ5 A;  1RL2 A;  2YUP A;  3ME9 A;  4C8Q E;  1UDL A;  3CXC S;  3G6E Q;  2YLB A;  3G4S T;  3RKW A;  1Q7Y C;  4ATO A;  4LUE A;  3CD6 A;  4L5G A;  3HRU A;  3I55 Q;  5KYN A;  1OOT A;  4E7L A;  4XTY A;  1NEG A;  1HJD A;  3FIF A;  5GAO p;  4CRI A;  4ZGE B;  2XU8 A;  3X28 B;  2VWF A;  4M78 G;  3RBB B;  1GFC A;  1NJI C;  2XK0 A;  4FW1 A;  4QW2 A;  4JS4 A;  3OSS C;  1JBM A;  4OMN A;  2QQA A;  3CD6 T;  1D09 B;  5FWB A;  2DIL A;  1G3Y A;  1Y71 A;  2DE0 X;  2BUD A;  4JS5 A;  2PUK B;  4C92 B;  4ZN3 A;  1VQ7 Q;  1MMD A;  5CKB A;  4PJO B;  2E6N A;  1AWO A;  2ABL A;  4ZN1 A;  3I56 A;  3RUX A;  3V8L A;  1RI9 A;  2J7I A;  4M75 C;  5L8R E;  1VQ5 Q;  3OYK A;  1BI1 A;  2EGC A;  5J3B A;  2P4R A;  4IKF A;  2DMO A;  3A1P A;  2FG0 A;  2JXB A;  2CUD A;  4F17 A;  4MMK A;  1UFF A;  1ZX6 A;  3CME Q;  1WZO A;  4M7A F;  4M75 F;  3JCM X;  1N8R C;  5FWC A;  2CZ6 B;  2EYY A;  3RER A;  1AZE A;  3CCV A;  5GJV B;  3CXC P;  1Q86 R;  1K8A U;  3GF5 A;  3V8K A;  2X4Y A;  3I56 T;  2KYB A;  3A8H B;  3LGL A;  1WHH A;  3CCJ Q;  2XI9 A;  3CCM Q;  2NYS A;  2CT4 A;  3VS3 A;  1MNE A;  4AG1 C;  4Y92 A;  3J7A F;  2RJD A;  1KIK A;  3OYA A;  2K6D A;  4II1 A;  3QO3 A;  1VQK Q;  3MKD A;  1KQ2 A;  2DVE A;  3JCM d;  4M7D C;  2OX7 A;  4F7U F;  3N5B B;  1RAC B;  2KSS A;  2D6F A;  3CCV T;  2FPE A;  1G3W A;  2EQK A;  2HDA A;  1KC8 R;  4JRI A;  1PSE A;  5CAI A;  4M7D F;  4DBR A;  2Y4Y A;  4HVW A;  2D0Q B;  1M9S A;  3CC4 Q;  4XU1 A;  1Z9Z A;  4C8Q G;  5DM7 R;  1AEY A;  5KCH A;  5KYY A;  5GAN 8;  3QUI A;  1M1F A;  1PC0 A;  3I9Q A;  3S6W A;  1HSQ A;  1N9R A;  4ESR A;  1X43 A;  3FJP A;  4NS5 A;  1K4U S;  4JJD A;  4A4H A;  3OS0 A;  2RQT A;  2K5L A;  2OTJ Q;  4Q5W A;  2VXE A;  5CR2 A;  2HCK A;  1ZBX A;  3MHX A;  2C0I A;  2DPP B;  1O9S A;  4PFP A;  1QVG A;  1FX7 A;  3M4G A;  3L2W A;  2CGH A;  3P8D A;  3I5S A;  5GAM d;  1Q86 C;  2KXC A;  4M77 E;  3VYG A;  2XID A;  1OYX A;  3EH2 A;  1UG1 A;  4M78 A;  4LXC A;  2YUO A;  1ZSZ A;  1N27 A;  3VU3 C;  3EG9 A;  2XHC A;  3EFS A;  1YIT Q;  5I2S A;  5FU7 B;  4E47 A;  1QP2 A;  2O4X B;  4CC2 A;  5GAN 3;  2EYQ A;  1OI1 A;  3OMG A;  3A5Z B;  4BY6 B;  1U1S A;  4FCY A;  2VV5 A;  1M1K R;  2KGT A;  1X6G A;  1PSF A;  5DLO A;  1T0J A;  3H0F A;  2EYX A;  2A0F B;  1QKX A;  2X4X A;  2CUB A;  1U3O A;  1KHC A;  1M2V A;  2K4Y A;  1KC8 C;  1KQS P;  4PJO C;  3NTI A;  2R5A A;  1AWW A;  4JZ3 A;  4N0A A;  2F2X A;  3OS2 A;  2E65 A;  2G6F X;  1GXI E;  4FYV B;  2COZ A;  5GMK m;  1ZBJ A;  1GRI A;  5L23 A;  3R6O A;  5A0G A;  2QEX A;  4FT2 A;  5GMK e;  3EGU A;  3E9F A;  4PJO F;  1GCQ A;  3CCR Q;  1G5V A;  4DEX A;  4OP0 A;  2LQK A;  4N4H A;  3LH5 A;  4C92 E;  4LDX A;  3QYG B;  3H9N A;  4N4I A;  2JT4 A;  5GAO m;  2V1Q A;  4ZNX A;  5KYW A;  4MZM A;  1YWP A;  3OMC A;  1J3T A;  2RD1 A;  1MMG A;  3JB9 J;  3M9Q A;  2K3X A;  1KHI A;  2XKO C;  1RAD B;  4CI0 C;  2QEX T;  2QGG A;  3TVT A;  3DKM A;  4C0Z A;  2RI5 A;  1N9S A;  3JCM W;  1IRX A;  1ABQ A;  1Z9Q A;  3M55 A;  3UA7 A;  1VQ4 A;  4FYX B;  1OU9 A;  4C92 D;  2X35 A;  3M0T A;  2GBQ A;  3CCU A;  4PJO D;  3CCQ A;  1K0S A;  2MYS A;  2QI2 A;  3QHS A;  3H6Z A;  3MP1 A;  1X6O A;  1I4K 1;  1NYF A;  3EGX A;  1FMK A;  4C8Q A;  4PK4 A;  2L0A A;  4C5I A;  3QYH B;  1M1K C;  1RAH B;  4F14 A;  1SRM A;  5KYX A;  1CSK A;  1WJQ A;  2JS2 A;  2EWN A;  1FXX A;  4A4F A;  4XTW A;  2CYZ B;  2G3R A;  2O01 E;  4LUD A;  2O9V A;  2L3R A;  1VQ4 T;  1JJ2 S;  2HAX A;  2YT6 A;  4M77 G;  2P0K A;  1ZUK A;  4RTT A;  3CCU T;  3CCQ T;  4OMM A;  4MZP A;  2CRE A;  4DBF A;  3CPF A;  1VQM A;  2HQX A;  2HNI A;  4X9C A;  2RJE A;  2RN8 A;  3JCM f;  5D6Y A;  4WCI A;  2QGF B;  1KD1 U;  1SSF A;  2MCN A;  3OS1 A;  2E5K A;  2DJQ A;  3QJY A;  5CKD A;  2DYI A;  2ATC B;  1NBE B;  2CDT A;  4MDW A;  2JTE A;  1VQN A;  1M3A A;  2O31 A;  4JJC A;  2W0Z A;  3M4Y A;  5HKC A;  2LP5 A;  2XDP A;  2KEA A;  3WVD B;  3BFM A;  1ZQ1 A;  5GAM h;  4KUL A;  1KK7 A;  1VQM T;  4JJN K;  4N4G A;  1CKA A;  3U23 A;  4PJM A;  5FU7 C;  5I21 A;  3J81 E;  2JJ9 A;  2PTK A;  1R0B G;  3ULR B;  2E1H A;  2HKQ B;  2A37 A;  1PWT A;  2YSQ A;  2OJ2 A;  1YJN Q;  2E41 A;  4ZGD B;  3CCE Q;  1VQN T;  2QQ9 A;  2NLU A;  1QMC A;  3QWY A;  5LJ5 f;  1T3L A;  1AVZ C;  2AZV A;  5IXB A;  4C5E A;  3L2R A;  3LYI A;  4F16 A;  3JSC A;  1WIE A;  3H0I A;  3CMA A;  3C12 A;  2YRD A;  3EHR A;  3CXC A;  1RAB B;  2KDS A;  2EJF A;  3PE0 A;  5GAN d;  1X2Q A;  1QP3 A;  2YHT A;  1YI2 Q;  1YHQ Q;  2X9H A;  2ROL A;  3CBP A;  1MUZ A;  3NGP A;  4M78 C;  3TQ7 P;  3UPU A;  4X9D A;  1ZSZ C;  2DEU A;  5CQX A;  2OAW A;  4M7A B;  3R6N A;  3EHQ A;  4M75 B;  2DIG A;  1QVF P;  1Y07 A;  1Y0M A;  4EMK A;  2DTH A;  1OQK A;  4FYW B;  3JCM g;  2KRN A;  1NEB A;  6AT1 B;  2ZCF B;  4ELY C;  3CMA T;  4M78 F;  3PIP A;  4OML A;  2GTO A;  3TSW A;  2E10 A;  2COW A;  1TH7 A;  2ECZ A;  5CKH A;  3NFC A;  3FRN A;  3OSV A;  3G7Z A;  1AWJ A;  2V1R A;  3BE3 A;  3TCJ A;  4XTU A;  5AT1 B;  1NPR A;  2R57 A;  1NG2 A;  4OGE A;  3HL8 A;  1T3S A;  3JB9 G;  1WFW A;  2VB6 A;  4LDW A;  3CEY A;  2J6K A;  2JTF A;  3RR6 A;  2F1L A;  4HCB A;  1B34 B;  2KNB B;  2EIF A;  2FL7 A;  2DJZ A;  1K1Z A;  3UAT A;  1K9M C;  4M77 A;  1BI2 A;  1SHF A;  2RA2 A;  1MMN A;  2GGR A;  4M7D B;  2DIQ A;  3LGF A;  3EFO B;  1WHM A;  2YLC A;  4KGX B;  2NUT B;  3OYD A;  4PFO A;  1V76 A;  5LJ5 g;  2MIO A;  2Y90 A;  5GAM j;  3E2U A;  3QPH A;  4HKE A;  3G1J A;  2OAU A;  2YWW A;  2X4J A;  2RQU A;  2V8K A;  1D1B A;  2MF2 A;  1WHL A;  1YWO A;  2CH4 W;  2J05 A;  2DLP A;  2XDB A;  3H0H A;  2DA9 A;  2DXB A;  1U1T A;  1RI0 A;  4LDY A;  2C06 A;  1M3C A;  1IGU A;  2YRV A;  1I5L A;  3HFO A;  3ZL7 C;  1WPY A;  1Y96 B;  2L3S A;  1UGP B;  4E7K A;  3CD6 Q;  1M4Z A;  2F2W A;  2CH4 A;  3JCM e;  3CBM A;  5LJ3 d;  1S1N A;  4HXJ A;  1IHW A;  3NPF A;  1N8R R;  1B07 A;  3MP6 A;  2VGN A;  1EX4 A;  1K76 A;  1BCM A;  3HRT A;  3X20 B;  5KE3 A;  2DD5 A;  3I35 A;  3SWN C;  2NUP A;  2KYM A;  4ANJ A;  3FJ5 A;  5EG2 A;  4C5H A;  2DRM A;  4KRT A;  1Q81 R;  2F69 A;  1HD3 A;  1NZ9 A;  3DLM A;  4C92 A;  2E3I A;  2PZ1 A;  1D3B A;  2QTX A;  1H92 A;  4E7S A;  1OZ3 A;  1PKS A;  1WXT A;  2Y4X A;  3M53 A;  4OMP A;  1Q86 U;  1K9A A;  5FLX E;  3I56 Q;  2BIV A;  1NLP C;  2VAS A;  2ZPH B;  5GJW B;  1YJ9 A;  4IUP A;  4KGV B;  4CC4 B;  2DET A;  3LX7 A;  4JRK A;  2I2L A;  2L8D A;  2M02 A;  2JMC A;  1Q82 C;  3I5R A;  3TSZ A;  4RTY A;  1CKB A;  5LJ5 e;  2DTI A;  2D1X A;  2WSC E;  2LDM A;  4M7A C;  1OU8 A;  4PL6 A;  5GAN h;  1HK9 A;  3CC7 Q;  3QJ6 A;  1WNL A;  1U8R A;  2M0Y A;  2LCL A;  1WHG A;  3CCV Q;  2J6F A;  2RK1 A;  2DL8 A;  1GCP A;  2ENM A;  2AK5 A;  5HCK A;  4WF2 A;  2CZ7 B;  2K5I A;  1YJ9 T;  1QCO A;  2YUQ A;  1VYV A;  2ZZD A;  1KC8 U;  3MPU B;  4IUR A;  1K0X A;  3CCL A;  2H8H A;  1SEM A;  2FRW A;  2DM1 A;  1RAF B;  4LD9 K;  4AFZ C;  2HQH A;  2LVM A;  4C0F A;  4M75 E;  3MCA B;  4J9F A;  2LC4 A;  3OYB A;  1W2B S;  3QZ9 B;  2YUN A;  3CC2 A;  2Z0W A;  2RPN A;  1Q81 C;  1JEG A;  4EMH A;  4PJN A;  5KYU A;  4E2F B;  4PNO A;  3UWN A;  3A8L B;  2JM8 A;  1M8V A;  1HXD A;  2HQE A;  2LX9 A;  2RJF A;  1YFN A;  4KUD K;  3HSB A;  3VS0 A;  4Z89 A;  2B8A A;  1TG0 A;  3CCL T;  5FRO A;  2RK2 A;  2MMP A;  2EFI A;  3GNF B;  2RHX A;  4FSX A;  2GCX A;  2O9S A;  1SKU B;  1MHN A;  4F7U E;  1BBZ A;  4M7A D;  1QCN A;  4M75 D;  2RQV A;  1Y57 A;  2EJG A;  3ZEH A;  3CC2 T;  1MV3 A;  4BD3 A;  2ESW A;  3KBG A;  3OYH A;  3SEM A;  3CCJ A;  1KQS S;  1W1F A;  1R77 A;  2KQW A;  3FDR A;  5CO7 A;  4M7D E;  2HL3 A;  4RTZ A;  2DL4 A;  1FYN A;  5D7U A;  2QG9 B;  4MZT A;  3TEE A;  3GBQ A;  2XD0 A;  4DBQ A;  2EYW A;  2JNG A;  3SDZ A;  1M1K U;  1VQK A;  5I11 A;  2KMT A;  1KG1 A;  4C0G A;  2P0P A;  2V26 A;  2YRC A;  4HCC A;  1WHK A;  2O4X A;  3EAE A;  3M59 A;  3AT1 B;  4B9W A;  5IHN A;  5EC7 A;  2DX1 A;  2L3P A;  1K8A R;  1WHJ A;  3HTR A;  4M4Z A;  3CCJ T;  2PVG B;  1P92 A;  1LOJ A;  5LJ3 h;  3A98 A;  1WQ7 A;  2ED0 A;  3PNW C;  1UEB A;  4BE0 A;  1W2B P;  4HVV A;  3CPW P;  5KCO A;  3PTA A;  4M7D D;  2NUZ A;  1QW1 A;  1M90 R;  2DKG A;  1RAE B;  4OMF B;  4YTL A;  1JJ2 A;  1IGQ A;  1VQK T;  5GAN j;  3HP9 A;  3C94 A;  2PU9 B;  4M77 F;  3JRZ A;  3A8G B;  1BK2 A;  1NYG A;  4RMO A;  1SPK A;  2XG8 D;  3PGG A;  1R8O B;  2BZX A;  2KRM A;  5HK0 A;  3HFN A;  2E3H A;  2KRS A;  3QII A;  4X1V A;  1C0M A;  3H8Z A;  3INZ A;  4OB2 B;  4JLI A;  3C4S A;  2CP2 A;  1QVF A;  2M51 A;  3HHT B;  5KYY B;  2V8I A;  4PLI A;  3FC3 A;  1WXB A;  3KUF A;  4P5N A;  1ACM B;  2KXD A;  4CC3 A;  3M5A A;  2QEX Q;  2HEQ A;  5CK9 A;  1YNZ A;  5IT9 E;  3CCS A;  4BDY A;  2MPX C;  4OMO A;  1VQ9 A;  3T9N A;  2A08 A;  2K57 A;  1YP5 A;  1UGV A;  2M1H A;  2CZ1 B;  2K5F A;  3MEV A;  1YIT A;  1VYU A;  3REA B;  2BZ8 A;  2MWO A;  4J9I A;  3L42 A;  4M78 B;  2GNC A;  1NLO C;  2XDD A;  1ZSZ B;  1OEB A;  4PJO E;  3EG9 B;  1TOV A;  1UGQ B;  1XTD A;  4J6W A;  4IUV A;  5CCA A;  4PKC C;  1K8A C;  3CCS T;  1BCO A;  2LQ8 A;  4OMQ A;  2BE7 D;  1VQ9 T;  3VS7 A;  5IH2 A;  1TXQ A;  4L6V 5;  4F7U G;  1VQ4 Q;  2VKN A;  4IIM A;  4DQ2 A;  3CCU Q;  3CCQ Q;  1YIT T;  1VUB A;  5IHK A;  5D6W A;  3JCM Q;  1M90 C;  2CT3 A;  2HL5 C;  4JUV A;  3MET A;  3C0C A;  3IQL A;  2JOY A;  1M2V B;  4PJL A;  5IHI A;  2GFU A;  2E70 A;  3MJX A;  2WAC A;  1PCX A;  4JLG A;  3RKY A;  4GLK A;  1VQO A;  1C1A A;  1H8K A;  3CBO A;  3LH0 A;  2R58 A;  2MWP A;  3P8H A;  1W4S A;  1AWX A;  1VQ8 A;  2GF7 A;  4B9X A;  2ZPB B;  1V29 B;  5LJ3 j;  2OTL A;  5ECA A;  2XIC A;  4QVZ A;  3GP8 A;  1VQM Q;  5M9O A;  1S72 Q;  3FLG A;  1LVK A;  2CSQ A;  4HA8 A;  4RTU A;  1TS9 A;  2BTT A;  2K3Y A;  1DJ7 B;  4LDU A;  4A4K A;  3G71 A;  3V7C A;  5KYW B;  1NPP A;  3M0U A;  4RKU E;  3ZBD A;  2BZY A;  3HPW A;  4BI4 A;  1VQO T;  1K73 R;  5IXF A;  1VQN Q;  1M3B A;  2QQB A;  2V8J A;  4J6X A;  3RDV A;  3X24 B;  1VQ8 T;  4Z8A A;  2OTL T;  1QVF S;  2DAQ A;  1ZUU A;  2HD0 A;  4OVA A;  1YJW A;  1UE9 A;  1AZG B;  4XU2 A;  3G71 T;  2C0O A;  4KH0 B;  3SD4 A;  2AIR B;  4FIB A;  1VQL Q;  2HZY A;  2ZPG B;  2DXU A;  1MND A;  3EGX B;  4OF1 A;  4HT8 A;  5IAY A;  4C8Q B;  4FW2 A;  1D0Z A;  1W70 A;  2DEQ A;  5GAN 6;  1KSW A;  1QWF A;  4RG8 A;  2D8H A;  2PNI A;  3RES A;  1LPL A;  3SWN B;  4ZTJ A;  5I22 A;  1ARK A;  1TWB A;  5KE2 A;  1IO6 A;  1YJW T;  1X01 A;  3CMA Q;  4Z02 A;  2PVD B;  3PVL A;  4J9B A;  4M75 A;  4QVC A;  3GOX A;  4X34 A;  1K9M R;  2EGA A;  4J83 A;  1UUE A;  1Y7X A;  2HMA A;  2LCC A;  4C92 G;  4UC4 A;  1Q7Y U;  1VQ6 Q;  1IHV A;  5GAM f;  4OB1 B;  1I1J A;  1M2O A;  3GNG A;  3OW2 S;  2CP6 A;  3J80 E;  2A28 A;  4DOW A;  5GMK i;  1OX8 A;  1VIF A;  3OBW A;  1QVG P;  3M57 A;  2ZPE B;  3TU4 K;  1UJ0 A;  1KD1 R;  4LD6 A;  4QQG A;  1PG5 B;  4QQD A;  2JZ2 A;  1IXD A;  1Q95 G;  1K73 C;  4F7U A;  3HRS A;  5FRM A;  2BE9 B;  2KE9 A;  1ABO A;  1NJI U;  2DK3 A;  3CCE A;  3EGD A;  4EDU A;  1SSH A;  1V1C A;  2EKH A;  1B34 A;  2KT1 A;  3M54 A;  1M1G A;  1XQH A;  5HY6 A;  4EPC A;  4DA4 A;  2CP5 A;  4M7D A;  3PMI A;  1WA7 A;  4J7F A;  2K2V A;  2VYT A;  1B3Q A;  4J6Y A;  1PRM C;  3EFO A;  2ZPI B;  4RCC A;  2PUO B;  4BE2 A;  3SFM A;  2DBM A;  2FHD A;  4ZGJ B;  1YCS B;  1SG5 A;  4N0A C;  2LZ6 B;  3V7R A;  2DER A;  4Z88 A;  5GAN 2;  3VV0 A;  3L1A A;  3CCE T;  1IZ6 A;  3L2Q A;  3F70 A;  4J9G A;  5GAN 5;  3KFV A;  1YIJ A;  1I8F A;  2RHI A;  2RHY A;  4FSS A;  1N8R U;  4E6R A;  2RHU A;  3EG0 A;  3QBY A;  2B86 A;  4JZ4 A;  1GCQ C;  1JXO A;  4GY5 A;  1ZA2 B;  1D1C A;  2IPO B;  1PHT A;  2QA4 A;  3QWX X;  1Y96 A;  1WLP B;  4BB7 A;  3G4S Q;  2EVR A;  1E6G A;  5GMK l;  4M78 D;  2L5Q A;  2CP3 A;  4EMK B;  4LDV A;  3OW2 P;  1Q81 U;  1OPK A;  1PKT A;  2LNV A;  1Q82 R;  4FYY B;  4CC7 A;  1VQP A;  1BI0 A;  2EW3 A;  2QXF A;  5D6X A;  5DY9 A;  5GAM g;  1AD5 A;  1I0C A;  5HK3 A;  3RIR A;  1W2B A;  1YIJ T;  4RTV A;  3CPW A;  1RAG B;  2K79 A;  2QK0 A;  1KD1 C;  1D0X A;  4D8D A;  2CS7 A;  5GAO l;  2QQS A;  2J06 A; 
#chains in the Genus database with same CATH homology
 4N0A A;  4BUG A;  2GFA A;  3X25 B;  3OS2 A;  1Q81 C;  4O5V A;  2E65 A;  5LJ5 h;  3JB9 D;  4XTV A;  3V7S A;  4EMH A;  3VUB A;  1N6A A;  4OGC A;  4XU0 A;  4M7A A;  4QVD A;  4PNO A;  1GXI E;  3MEU A;  3UWN A;  3A8L B;  4KBM B;  2QA4 T;  3JCM V;  1KQ2 A;  3OYY A;  1HXD A;  1S72 T;  2HQE A;  2LX9 A;  2RJF A;  5GMK m;  4KUD K;  3HSB A;  4HCZ A;  2B8A A;  4E7I A;  3CCL T;  4ME7 A;  3R6O A;  1JB0 E;  5A0G A;  2QEX A;  4FT2 A;  5FRO A;  2RK2 A;  4BY6 C;  5GMK e;  3E9F A;  4PJO F;  2MMP A;  2EFI A;  3GNF B;  4PJO G;  1G5V A;  4OP0 A;  2LQK A;  2RHX A;  2F5T X;  2VGM A;  3OB9 A;  4FSX A;  4N4H A;  1VQP T;  2GCX A;  5LJ3 e;  1IRE B;  4C92 E;  1MHN A;  1VQL A;  4LDX A;  4F7U E;  3LWH A;  3WXM B;  3QYG B;  4A53 A;  4C8Q C;  2P4T A;  4N4I A;  2PVO B;  3QG1 A;  4M7A D;  2FYK A;  2RJC A;  4M75 D;  5GAO m;  3JCM P;  2KVQ G;  2ZGW A;  3FEO A;  3QKJ A;  2DXC A;  4MML A;  3PFS A;  2EJG A;  3A8M B;  4J7I A;  4M77 B;  4MZM A;  3OMC A;  3ZEH A;  1YBY A;  3CC2 T;  2MAM A;  3GIB A;  1KQS A;  3JB9 H;  4BD3 A;  2RD1 A;  2QDY B;  3KBG A;  3OYH A;  1LNX A;  4NL3 A;  2JN0 A;  3JB9 J;  3CCJ A;  1KQS S;  3BDU A;  5DLQ E;  2KQW A;  3FDR A;  1YJN A;  3M9Q A;  3OYE A;  2K3X A;  3UT1 A;  5CO7 A;  1KHI A;  2XKO C;  4M7D E;  4PJO A;  4ELZ C;  5CQY A;  2EJ9 A;  1QVP A;  4C8Q F;  1LJO A;  4CI0 C;  2GQV A;  3OYG A;  2QEX T;  1BIA A;  3DKM A;  1BYM A;  2ZPF B;  4O6J A;  1MGQ A;  4C0Z A;  2RI5 A;  3HKS A;  4MZT A;  3TEE A;  2XD0 A;  2KK4 A;  3SB2 A;  3PMT A;  3WVE B;  1N9S A;  2EQJ A;  2JNG A;  3OYJ A;  3JCM W;  1Q82 U;  2RI2 A;  4JDS A;  3SDZ A;  1M1K U;  2KMT A;  1VQK A;  3M55 A;  4C0G A;  1FWZ A;  2P0P A;  1VQL T;  1VQ6 A;  1KG1 A;  4HCC A;  1VQ4 A;  2O4X A;  3EAE A;  3M59 A;  4C92 D;  2X35 A;  5GAO n;  4B9W A;  3CCU A;  4PJO D;  1YCY A;  3CCQ A;  1VQ5 A;  2QI2 A;  3QHS A;  3H6Z A;  4M78 E;  3MP1 A;  4OB3 B;  3URG A;  5GMK h;  1X6O A;  1I4K 1;  3OYL A;  3CCJ T;  2PVG B;  1P92 A;  4C8Q A;  1LOJ A;  4IUU A;  4C5I A;  3QYH B;  5LJ3 h;  3G6E A;  1YJN T;  1M1K C;  2KY9 A;  1WQ7 A;  5IN1 A;  3PNW C;  1UEB A;  1H64 1;  3OYN A;  1WJQ A;  5GAM e;  4BE0 A;  1YI2 A;  1M8V A;  1YHQ A;  2EWN A;  1FXX A;  4R55 A;  4A4F A;  3JAM E;  4XTW A;  5KCO A;  3I55 A;  3PTA A;  4M7D D;  3JB9 I;  2CYZ B;  4BAC A;  1QW1 A;  2A7Y A;  2M16 A;  2DKG A;  1UB4 A;  2G3R A;  2IVW A;  2O01 E;  4OMF B;  4YTL A;  4FM4 B;  1JJ2 A;  1VQK T;  3BY7 A;  3HP9 A;  5GAN j;  3C95 A;  4QQ6 A;  1VQ6 T;  3C94 A;  2L3R A;  2PU9 B;  1BI3 A;  4C8Q D;  1VQ4 T;  4M77 F;  1JJ2 S;  3JRZ A;  4M77 G;  2P0K A;  3A8G B;  2HAX A;  2X4W A;  3TRE A;  4RMO A;  4R56 A;  1VIE A;  3CCU T;  2XG8 D;  3CCQ T;  3PGG A;  1R8O B;  4MZP A;  5HK0 A;  3CPF A;  1VQM A;  3HFN A;  3QII A;  3MO8 A;  4OB0 B;  2HQX A;  2HNI A;  3H8Z A;  3INZ A;  2RJE A;  4X9C A;  2CZ0 B;  3ER0 A;  4OB2 B;  5D6Y A;  3JCM f;  4F7U B;  5C6S A;  4JLI A;  1D3B B;  2VC8 A;  1KD1 U;  1SSF A;  3QDR B;  4L59 A;  4RCB A;  3C4S A;  5GAO q;  3OS1 A;  1QVF A;  3HHT B;  3OYF A;  3G6E T;  5LL6 S;  4FU6 A;  3L2Z A;  3QJY A;  4RG2 A;  1JRI A;  5CKD A;  2WSE E;  1YI2 T;  2V8I A;  4PLI A;  3FC3 A;  3MEW A;  2WSF E;  4XTX A;  4M7A E;  3LWI A;  1YHQ T;  3KUF A;  5FU6 B;  3I55 T;  3MEA A;  2DZ9 A;  4P5N A;  3M5A A;  4MDW A;  1ZHI A;  5GAN f;  5A2Q E;  3JCM J;  5CK9 A;  1VQN A;  5IT9 E;  3CCS A;  1VQ7 A;  3S3M A;  3M4Y A;  5FRN A;  4BDY A;  3CPW S;  2DD4 A;  5HKC A;  2XDP A;  2A3L A;  3BW1 A;  1VQ9 A;  3T9N A;  2DZC A;  2MI6 A;  1XOV A;  1NE8 A;  3BFM A;  2RI3 A;  3WVD B;  3CC7 A;  5GAN 7;  2K57 A;  1ZQ1 A;  5GAM h;  3VUZ A;  4KUL A;  2E6Z A;  5GAO r;  2RHZ A;  2D9T A;  5LJ5 j;  1VQM T;  4JJN K;  4N4G A;  2H3J A;  5C0M A;  3OYM A;  2M1H A;  2CZ1 B;  2IG0 A;  2K5F A;  1WJS A;  3MEV A;  4KT0 E;  5FU7 C;  2CKK A;  5A0D A;  5J26 A;  1YIT A;  2RM4 A;  5I21 A;  3J81 E;  3DLL A;  2MWO A;  2E1H A;  4IUT A;  4A54 A;  2EQM A;  3CME A;  3L42 A;  4M78 B;  3P8B B;  2EQU A;  4EMK C;  3G4S A;  2XDD A;  4KUI A;  5I2M A;  4PJO E;  2E5Q A;  1UGQ B;  1XTD A;  4Y91 A;  2E41 A;  4J6W A;  4ZGD B;  1G3T A;  4A4E A;  4IUV A;  4NL2 A;  4PKC C;  5CCA A;  1VQN T;  2QQ9 A;  1K8A C;  2NLU A;  3CCS T;  1M90 U;  5CKF A;  1VQ7 T;  4BDZ A;  3E19 A;  2LQ8 A;  4JRQ A;  4J8O A;  4XU3 A;  1VQ9 T;  3CC7 T;  5LJ5 f;  2RO0 A;  2VXF A;  4L6V 5;  4F7U G;  4EMG A;  3MP8 A;  1VQ5 T;  3CCM A;  2DTO A;  3L2V A;  1XNI A;  4C5E A;  4DQ2 A;  3O8V A;  3LYI A;  3L2R A;  4J5Y A;  1YIT T;  4DOV A;  1VUB A;  3JSC A;  5D6W A;  3JCM Q;  2R5M A;  3ZFJ A;  3E9G A;  3CMA A;  4TVR A;  3C12 A;  3OQ5 A;  1M90 C;  1RL2 A;  4JUV A;  3CXC A;  3MET A;  3RKX A;  2KDS A;  2EJF A;  4BI3 A;  1OZ2 A;  3ME9 A;  5A0L A;  4C8Q E;  1AHJ B;  5GAN d;  2JOY A;  3CXC S;  3CME T;  3JCM c;  2YLB A;  3G4S T;  3RKW A;  1QP3 A;  2GFU A;  1Q7Y C;  4ATO A;  2YHT A;  2VUB A;  2E70 A;  3CD6 A;  3CBP A;  2WAC A;  4M78 C;  4L5G A;  3UPU A;  4JLG A;  4X9D A;  3HRU A;  5CQX A;  2DXT A;  2DO3 A;  4M7A B;  3RKY A;  4GLK A;  4M75 B;  1VQO A;  4E7L A;  2DIG A;  4XTY A;  1Y07 A;  4EMK A;  3FIF A;  3CBO A;  3LH0 A;  2R58 A;  2MWP A;  1G3S A;  4CRI A;  2DTH A;  3P8H A;  4M77 C;  5GMK j;  5GAO p;  3PIO A;  3QSU A;  4ZGE B;  3CCM T;  1W4S A;  3JCM g;  3RMQ A;  2F5K A;  1VQ8 A;  5J39 A;  2GF7 A;  4B9X A;  2XU8 A;  1V29 B;  2ZCF B;  2ZPB B;  4ELY C;  5LJ3 j;  2OTL A;  3X28 B;  2XIC A;  3LLR A;  4QVZ A;  3GP8 A;  2M0O A;  3CMA T;  5M9O A;  4M78 F;  1EIF A;  4M78 G;  3PIP A;  3FLG A;  3DB4 A;  4HA8 A;  2K3Y A;  1DJ7 B;  1NJI C;  3CC4 A;  4HT9 A;  2XK0 A;  4LDU A;  4QW2 A;  4A4K A;  4JS4 A;  2E10 A;  3OSS C;  3V7C A;  3G71 A;  4C0D B;  1JBM A;  1TH7 A;  2QQA A;  5GAN g;  1NPP A;  3CD6 T;  5CKH A;  3M56 A;  1G3Y A;  1Y71 A;  3KXT A;  3LW5 E;  2PQW A;  3NFC A;  5LJ5 d;  3A8O B;  3FRN A;  2BUD A;  3OSV A;  4RKU E;  2PUK B;  3G7Z A;  4JS5 A;  2RH2 A;  3TCJ A;  4XTU A;  3ZBD A;  1BIB A;  3HPW A;  4BI4 A;  1VQO T;  4C92 B;  1NPR A;  4ZN3 A;  2R57 A;  3S3O A;  5CKB A;  4OGE A;  4BE1 A;  4PJO B;  3HL8 A;  2E6N A;  3JB9 G;  4ZN1 A;  2QQB A;  5KH6 A;  3RUX A;  3V8L A;  3I56 A;  2OTJ A;  5CIU A;  4M75 C;  5LJ3 f;  4LDW A;  2V8J A;  4J6X A;  3CEY A;  3X24 B;  3AHU A;  2RB6 A;  1VQ8 T;  5L8R E;  1QVF S;  2OTL T;  1UGS B;  2JTF A;  2E64 A;  3VKI A;  4BI8 B;  1BI1 A;  2DAQ A;  3OYK A;  4HCB A;  2HD0 A;  4OVA A;  1B34 B;  5J3B A;  1YJW A;  5AYF A;  1BKB A;  3GLX A;  2EIF A;  4IKF A;  2FL7 A;  2DJZ A;  2E12 A;  3OS5 A;  4XU2 A;  3CC4 T;  1K9M C;  4M77 A;  1BI2 A;  2RA2 A;  4JRP A;  3G71 T;  1X75 C;  4MMK A;  4M7D B;  2DIQ A;  5CVI A;  3SD4 A;  3LGF A;  4M7A F;  4M7A G;  4FIB A;  4M75 F;  2YLC A;  4M75 G;  2ZPG B;  3JCM X;  2FVU A;  2DXU A;  2L89 A;  4OF1 A;  2EAY A;  1N8R C;  4HT8 A;  5IAY A;  3OYD A;  4C8Q B;  2CZ6 B;  2DEQ A;  3RER A;  5GAN 4;  4D6W A;  5LJ5 g;  5GAN 6;  2Y90 A;  5GAM j;  3CCV A;  4RG8 A;  3QPH A;  1K8A U;  3GF5 A;  3V8K A;  2X4Y A;  3RES A;  4HKE A;  2LT1 A;  3I56 T;  2OTJ T;  4Y28 E;  3SWN B;  3A8H B;  4ZTJ A;  4M77 D;  4C92 C;  2OAU A;  3LGL A;  2X4J A;  4XAX B;  2XI9 A;  3QXE B;  3EFR A;  2EKO A;  3OBY A;  2V8K A;  5KE2 A;  1WGS A;  1YJW T;  4VUB A;  2MF2 A;  1X01 A;  3OY9 A;  3E1S A;  3J7A F;  2RJD A;  4FL6 A;  4Z02 A;  2XDB A;  2DXB A;  2PVD B;  1U1T A;  3M58 A;  4M75 A;  1RI0 A;  2M9U A;  4LDY A;  4QVC A;  2LTO A;  5FU6 C;  3OYA A;  3GOX A;  2YRV A;  2C06 A;  1I5L A;  3HFO A;  4X34 A;  4II1 A;  1WPY A;  3S3N A;  4J83 A;  4XQ3 A;  3QO3 A;  1Y7X A;  1Y96 B;  2BKD N;  1UGP B;  2DVE A;  2LCC A;  4C92 F;  4UC4 A;  4C92 G;  1UGR B;  3JCM d;  4E7K A;  1Q7Y U;  1M4Z A;  4F7U F;  3JCM e;  3N5B B;  4M7D C;  5GAM f;  1WJR A;  3CBM A;  4OB1 B;  5LJ3 d;  2JUF A;  2HBP A;  2KSS A;  2D6F A;  3OW2 A;  3CCV T;  2LT4 A;  3MP6 A;  1K73 U;  2VGN A;  1G3W A;  1I81 A;  3GNG A;  3OW2 S;  2KAF A;  1H3Z A;  3J80 E;  2EQK A;  3HRT A;  3X20 B;  4DOW A;  5KE3 A;  5GMK i;  3DB3 A;  2DD5 A;  3OBW A;  1VIF A;  3SWN C;  5GAN e;  3OYI A;  3M57 A;  2ZPE B;  3TU4 K;  4JRI A;  1PSE A;  5CAI A;  4M7D F;  4LD6 A;  4QQG A;  4M7D G;  2Y4Y A;  1O75 A;  3CCR A;  5EG2 A;  4E7J A;  4C5H A;  4QQD A;  2JZ2 A;  2F69 A;  2D0Q B;  1K73 C;  1NZ9 A;  3DLM A;  4C92 A;  3VJP A;  1M9S A;  3OYC A;  4F7U A;  3OA6 A;  3HRS A;  4XU1 A;  5FRM A;  1D3B A;  2JTM A;  2QTX A;  4C8Q G;  1NJI U;  5DM7 R;  2DK3 A;  5KCH A;  3NTH A;  3CCE A;  2P0Q A;  3GPL A;  1OZ3 A;  5GAN 8;  3QUI A;  1M1F A;  4EDU A;  4V2S A;  3PT9 A;  3S6W A;  1B34 A;  2Y4X A;  3M53 A;  5LJ3 g;  3RMS A;  3M54 A;  1N9R A;  1Q86 U;  1M1G A;  3FB9 A;  4E7H A;  1XQH A;  3FJP A;  4NS5 A;  5HY6 A;  5FLX E;  4EPC A;  4DA4 A;  4A4H A;  4C5G A;  3OS0 A;  4NOY A;  2K5L A;  4Q5W A;  4M7D A;  2VXE A;  2BIV A;  3PMI A;  5CR2 A;  2ZPH B;  4J7F A;  2K2V A;  1YJ9 A;  1ZBX A;  3MHX A;  2VYT A;  4IUP A;  4J6Y A;  2DPP B;  3LX7 A;  4JRK A;  2ZPI B;  2I2L A;  1O9S A;  2L8D A;  4RCC A;  3JCM h;  2QQR A;  2PUO B;  3CCR T;  4BE2 A;  1QVG A;  3SFM A;  1FX7 A;  3M4G A;  2FHD A;  2CGH A;  4ZGJ B;  3L2W A;  1Q82 C;  2AHJ B;  3P8D A;  1QVG S;  5LJ5 e;  5GAM d;  1Q86 C;  2DTI A;  5CKE A;  4PLL A;  4M77 E;  4N0A C;  3VYG A;  2XID A;  3V7R A;  1K9M U;  3SWN A;  5GAN 2;  3VV0 A;  2WSC E;  3L1A A;  3CCE T;  2LDM A;  1IZ6 A;  3L2Q A;  3JB9 F;  1OYX A;  3F70 A;  3NTK A;  3X26 B;  4M7A C;  5GAN 5;  4PL6 A;  1YIJ A;  5GAN h;  1I8F A;  2RHI A;  4M78 A;  1HK9 A;  4XTZ A;  3QJ6 A;  1WNL A;  1M5Q 1;  1U8R A;  1N27 A;  2RHY A;  3VU3 C;  1N8R U;  2LCL A;  2XHC A;  2RHU A;  3EFS A;  3BDL A;  2RK1 A;  3QBY A;  4GY5 A;  5I2S A;  4WF2 A;  2CZ7 B;  5FU7 B;  4E47 A;  1QP2 A;  2K5I A;  2O4X B;  5GAN 3;  2EYQ A;  1YJ9 T;  1OI1 A;  3OMG A;  2QA4 A;  3A5Z B;  4BY6 B;  4MDX A;  2ZZD A;  3ASK A;  1U1S A;  1Y96 A;  4ZTF A;  1S72 A;  1KC8 U;  4BB7 A;  4IUR A;  3UDC A;  3JCM b;  1KQ1 A;  3CCL A;  5GMK l;  2L5Q A;  4M78 D;  4EMK B;  1WQW A;  4LDV A;  4XK8 E;  2FB7 A;  4C0D C;  3L2U A;  2JVV A;  1Q81 U;  4LD9 K;  2VV5 A;  2LNV A;  2LVM A;  1VQP A;  4FT4 A;  3V8J A;  4C0F A;  1BI0 A;  4M75 E;  2QXF A;  1PSF A;  5D6X A;  4A4G A;  5DLO A;  5DY9 A;  5GAM g;  5HK3 A;  3MCA B;  3Q1J A;  3RIR A;  2LRQ A;  1W2B A;  1YIJ T;  2X4X A;  1KC8 C;  1KHC A;  2K4Y A;  2LC4 A;  3CPW A;  3OYB A;  4PJO C;  3NTI A;  3QZ5 B;  1W2B S;  2R5A A;  4IUQ A;  3QZ9 B;  1KD1 C;  2CS7 A;  5GAO l;  2QQS A;  3VYH B;  3CC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...