2JNGA

Solution structure of the cul7-cph domain from homo sapiens; northeast structural genomics consortium target ht1.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
MRSEFASGNTYALYVRDTLQPGMRVRMLDDYEEISAGDEGEFRQSNNGVPPVQVFWESTGRTYWVHWHMLEILGFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Conserved CPH Domains of Cul7 and PARC Are Protein-Protein Interaction Modules That Bind the Tetramerization Domain of p53
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords Cullin-7
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11515 Cul7 Mouse development and cellular proliferation protein Cullin-7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2jngA00
3PIOA 1UEBA 5FLXE 2OTLA 2XHCA 1VQLA 1IZ6A 2LVMA 3I56A 1YJNT 2JNGA 3CPWS 4ZN1A 1NJIU 1M1KC 1S72T 2OTJT 3J81E 1VQ5T 3CC2T 2OTLT 1VQNT 3TREA 1YBYA 3CXCS 3G6ET 3CC4T 5IT9E 1YHQT 3OW2S 1M90U 1M90C 1KHIA 2DO3A 3CCLA 3CCUA 1VQ6A 3DB4A 1KQSS 2MWOA 1VQLT 2KDSA 1YITT 1VQOA 3CCUT 1VQ6T 1K73U 3CPFA 1Q86C 1XNIA 1YJWA 2JUFA 2LQ8A 1N8RU 5A2QE 3LH0A 2OTJA 3CCQA 2JVVA 3G71A 1VQMT 3DB3A 1YJWT 2JOYA 3G6EA 3CC4A 1K9MC 1K9MU 2L3RA 5DLQE 1M1KU 1KD1C 3CCLT 1JJ2A 1BKBA 1Q86U 2QEXT 1NPRA 3OYYA 3G4SA 1Q7YC 1K8AC 3KBGA 3CD6T 5IAYA 2CKKA 1VQ7T 5J3BA 2E70A 3LGLA 3CCRA 3CMEA 1YHQA 2LCLA 2E6ZA 3CCMT 5DM7R 3JAME 1Q82U 1Q82C 3CCRT 1YIJA 5LL6S 1KD1U 1VQNA 3CCEA 1VQKT 3CC7T 3CCMA 1YJ9T 1M1GA 1Q7YU 1W2BS 3OW2A 4X34A 2QA4A 1VQ9T 1VQPA 1YI2T 3I55A 3I56T 3CXCA 3CPWA 1YIJT 2MI6A 1W2BA 4CRIA 4TVRA 5HY6A 1VQ7A 4ZN3A 1VQ5A 3CC2A 1NZ9A 3LGFA 3CCJA 3CCQT 3I55T 3CMAA 1SSFA 3G4ST 1QVFS 5J26A 3G71T 4QQDA 4YTLA 1YJNA 1K73C 3PIPA 3CCET 1VQ4A 3J7AF 3CMAT 3J80E 1QVGS 4RG2A 2QA4T 3DLLA 1VQPT 2KVQG 1VQ4T 1VQ8A 2G3RA 1Q81C 1VQOT 1Q81U 1EIFA 3CC7A 1VQKA 1VQ8T 1JJ2S 1RL2A 2IG0A 3CCVT 3CD6A 1NJIC 1N8RC 1X6OA 1YI2A 1K8AU 1VQ9A 1VQMA 3ER0A 1QVGA 3CCVA 3CCST 1XTDA 2EIFA 3HKSA 3CMET 3A5ZB 1S72A 3CCSA 2MWPA 3P8BB 3CCJT 1KC8C 1KC8U 2QEXA 1KQSA 1QVFA 1YJ9A 1NPPA 1YITA
chains in the Genus database with same CATH superfamily
2EWNA 2BZYA 4LXCA 2JNGA 5D6XA 1H8KA 1WXBA 3TREA 2KYMA 4J9HA 4ANJA 2NUPB 2HD0A 3EHQA 3MP6A 1D0ZA 1WHJA 4N0AA 4HCBA 1GXIE 4MZPA 2JUFA 5D6WA 5GAOl 3CCQA 5FRMA 1UE9A 2QQSA 1MGQA 2JOYA 3TVTA 1UJ0A 2XKOC 3U23A 3S3OA 1FMKA 2ESWA 1WJSA 2EW3A 1RI9A 4HXJA 3C95A 1K8AC 4KT0E 1HYOA 4EMHA 3VUZA 2QG9B 2L89A 1VOMA 3LGLA 3RIRA 5GAN2 3EFOB 1I1JA 3L2UA 5GAN6 5AYFA 1AZEA 4HCKA 4LD6A 3WVEB 3GF5A 1VQ7Q 4RKUE 4MMKA 5GMKj 4C8QA 4ZGDB 3CCQT 1X69A 3CMAA 5J26A 1E6GA 1D1CA 1B7TA 1IB8A 1VQ4A 1Q7YR 1AWOA 1YCSB 4RG2A 4XU1A 2K3YA 2RI3A 1Q81C 2LJ1A 3IQLA 2DXBA 1T3SA 3CBMA 2XU8A 4LDWA 1IO6A 3CCVA 4DBFA 4BDYA 2L2PA 2EPDA 4JZ4A 3OYAA 2LJ3A 2MWPA 1YITQ 3OYDA 2QEXA 1EX4A 2K3BA 1YJ9A 4FIBA 5AT1B 2F5KA 3JCMe 2LRQA 1N8RR 3EH2A 4NL2A 3ZBDA 2YDLA 2OTLT 3LYIA 1CKAA 2PQWA 4XTVA 1WNLA 4C0FA 2HSPA 2LJ0A 1TWBA 1D1BA 1ZBJA 1KQSS 4F7UE 2CP3A 2O9VA 2DE0X 1MMNA 1VQ6T 1S72Q 2RI2A 5DLQE 3M0TA 2VYTA 3VS3A 4PJOC 3LLRA 2P0KA 5C0MA 4DBHA 1PG5B 4M75D 4OMOA 2LCSA 2EQJA 4RTWA 2EGAA 1Q7YC 3MP8A 2DJZA 2VKNA 4M7AB 1YJ9Q 2MK5A 4M78C 1W1FA 3RR6A 2HQHA 1WHGA 3N5BB 1QVFP 1F1BB 2HEQA 1ZQ1A 3CBOA 1N6AA 1Y57A 4C92E 4EMKB 3GBQA 1IGUA 1W2BS 1XJWB 4DEYA 1VQ9T 3I56T 1KQSP 1VA7A 3RUXA 5FU7B 2QA4Q 3QO3A 1NM7A 1VYUA 4M7AE 5CQXA 1T3LA 1UUEA 3G71T 4ZTFA 3NGPA 1RADB 4CC2A 4II1A 3EFRA 1PD0A 2LDMA 2RA2A 1M8VA 3RKYA 2C0IA 2KVQG 2H3JA 1IXDA 4JJDA 4PFZA 1HXDA 1VQKQ 2Z0WA 3OYGA 1YN8A 5A0DA 1U8RA 2J6OA 2HZYA 2K5FA 2V8IA 2WACA 3CCJT 1KC8U 1C1AA 4M77D 2GTOA 2M9UA 3M0SA 4HCZA 1JQQA 4ESRA 4C5EA 3QWYA 3REAB 2K4YA 4C0DC 3UF4A 1NEBA 8ATCB 4AFUC 4BI8B 4R0KA 4J9IA 5LJ3e 3E2UA 4E7IA 1AEYA 3VS2A 2FHDA 5A0LA 2KY9A 2WSEE 3OYFA 2EQKA 3TU4K 3I55Q 2VC8A 2ATCB 1H92A 5FWCA 4ZNXA 1QCOA 1ZA2B 2HCKA 3X20B 2EQUA 2DL8A 2ZPGB 2QQ9A 3ZEHA 1Z9QA 5KYXB 4UC4A 1UGVA 4FM4B 5GANj 4AMCA 2E41A 2F2WA 1Y71A 2KEAA 3HFNA 3JCMV 1Q82C 5CIUA 2V26A 4HVUA 3CCMA 3SDZA 2QQAA 3EG2A 4FYVB 5FU6B 2I0NA 2L3PA 2A37A 4CRIA 1QWFA 4F7UB 1TXQA 3CC2A 2PZ1A 4BY6B 2EYQA 2A0FB 1UGRB 2D8HA 4QVCA 1PKSA 1WJRA 1YJNA 1HJDA 1HD3A 2R5AA 3RKWA 1MMDA 4M78D 2ZPHB 4KGVB 1BI3A 2K7AA 4MZMA 4Y92A 2DBMA 2DL3A 2IVWA 4PFPA 1WHHA 1DJ7B 5LJ5g 1U06A 3L42A 1K8AR 3CCVT 3JSCA 2JW4A 2Y4YA 1VQ9A 2DTIA 1ZSZC 2CP2A 2QTVA 1QVGA 3OYEA 3A5ZB 4BB7A 3JCMP 2HMAA 1GBRA 1KSWA 4AFZC 2B8AA 1JB0E 3I35A 2FEIA 2GF7A 4PL6A 3CPWP 2NUPA 4EMKA 3BDLA 4D8DA 2CSIA 3M59A 1ZUYA 4C5IA 1VQ4Q 1TU0B 1H3ZA 1IHWA 2G6FX 1YITT 1QWEA 4C8QC 3HP9A 3CPFA 4E7SA 1OV3A 1QP3A 4PK4A 1M8MA 4J9FA 4E6RA 3SFMA 2AKLA 3O5ZA 3ULRB 4B9XA 2D8JA 1M90R 4F17A 1EZZB 3GOXA 2MAMA 4HA8A 4OP0A 1U1SA 1ZSGA 1BIAA 4J7FA 3CCRA 2DYBA 1CKBA 3G1JA 4M4ZA 1OPKA 2COWA 3OYMA 5DM7R 5CKDA 2V8KA 1VQKT 4OMNA 1TH7A 3OW2A 3CCVQ 1VQPA 2AZVA 3VRZA 3VYGA 2ROTA 2WSCE 4J6XA 4OMMA 2PVGB 3L2RA 2E3HA 2RQRA 3VJPA 4IUVA 4ZGJB 4FYXB 3KFVA 1OU9A 2AHJB 2CUBA 1ZBXA 4AFQC 1GCQA 2GCXA 2RO0A 1QP2A 3VKIA 3QZ9B 1AVZC 2HNIA 2MOXA 4M75F 2O31A 9ATCB 2EYXA 4GLKA 2BIVA 4BACA 4M75G 4EDUA 3CD6A 1M2VB 4E7ZA 2LTOA 1VQMA 2PU9B 3CC4Q 4FL6A 3HRSA 4M7AF 2QTXA 1AWWA 2RPNA 3CMET 4M78F 4KUDK 3GLXA 2JS0A 1QVPA 3PFSA 1KC8C 3OS0A 1KFZA 2EQMA 3PIOA 3H0IA 1WHLA 2JT4A 3OSVA 4LDVA 1SPKA 3L2ZA 3CPWS 1BI0A 3D7SB 1QQJA 1NJIU 1S72T 4BDZA 1C0MA 4BI4A 3PVQA 1YHQT 5D7UA 1KHIA 2DO3A 2MWOA 4ORZA 2E4HA 3NTIA 2RN8A 1KIKA 3ASKA 1UHFA 2OTJA 2EGCA 1OZ2A 2YRVA 3DB3A 4J9CA 4J7IA 4AT1B 1N27A 3A8OB 2J6KA 3PMTA 4FSSA 3X24B 2VB6A 3VS1A 3CD6T 2K5IA 2XDDA 2HDAA 1X27A 2XMFA 3OMGA 1V29B 1VYVA 3MJXA 4X9CA 1FWZA 3CMEA 5GANg 3EG9A 4A53A 1D3BB 2QQRA 3CCUQ 4WTOB 4FCYA 3DLMA 1M1KR 1AZGB 1FMWA 2BKDN 5CKBA 1QCFA 2ROLA 3S3MA 5GANh 3QBYA 4FYWB 1YJWQ 2CS7A 2EJFA 3OS2A 1BI2A 1WPYA 2O4XB 2LX7A 3EFOA 4OB2B 2JM9A 3X25B 4M7DA 5CR2A 4XTXA 3R6OA 4BUGA 1SSHA 1NEGA 3OY9A 4Z88A 4BY6C 2AT1B 2RF0A 1VQNQ 2O01E 4JRPA 1Y07A 3CCST 4PNOA 4IUUA 4R56A 2A7YA 4LD9K 5IXFA 2DRKA 4OB1B 4PKCC 4C8QG 2GNCA 3JCMf 4E7KA 1LNXA 2R57A 3HL8A 4M75E 2D0NA 1JRIA 1RI0A 2DVEA 2VUBA 3LW5E 1ZUUA 5GMKi 3J81E 3I9QA 2X3WD 4BD3A 2QGGA 2ENMA 1M90C 2KRNA 1UGSB 2COZA 4QVDA 5GMKh 3QXEB 3EGXB 4QVZA 1UGPB 1K73U 2NLUA 3V8JA 4M75B 4PJOA 4OGEA 3G71A 1W4SA 1BCMA 3CC4A 2KRMA 2OAUA 3OYBA 4LDXA 1SHFA 2QEXT 3V7RA 5IAYA 5KYYB 3OYCA 3M4GA 4FSXA 1MNEA 1M3CA 2E5QA 2P84A 5KE2A 3FLGA 5GAMg 1AHJB 4LDUA 1SG5A 3OS1A 1IGQA 3LWHA 1YJ9T 3A8LB 4E2FB 2MCNA 2FRYA 3DKMA 1ABQA 4OB0B 2YLBA 1I0CA 3JRZA 3CMEQ 2DF6A 1QVFS 4A4EA 3M0PA 1K73C 3PIPA 4J9EA 2DMOA 3JCMh 2L3QA 1T0HA 2G3RA 5KYYA 2QI2A 1Y96B 2JS2A 5IXBA 5FROA 4JJNK 1R0CB 4IUTA 1D0XA 2P4TA 3QDRB 3OYKA 2RNAA 3G6EQ 1EFNA 4RTZA 3BDUA 1G3YA 5HK0A 2EKOA 3HRTA 1RAFB 1T0JA 4XU2A 2YUOA 3G71Q 3EH1A 2PNIA 5GANf 2RHZA 4JJBA 1S1NA 2LX9A 1BB9A 5GAN5 4CI0C 4AFSC 2OI3A 3OMCA 4M78B 3E19A 2K57A 1KJWA 2C0TA 4JRQA 4IIMA 2CP0A 2RHIA 3MEUA 2YRCA 1SHGA 2KBTA 3BE3A 2M0YA 1N5ZA 4M77G 4QW2A 2DXUA 2KT8A 3EGUA 3NHNA 5GMKm 1OI1A 3LWIA 5IN1A 2RQVA 2VGMA 2SRCA 2DIQA 2CH4A 3QSUA 3JCMb 1GCQC 4VUBA 1K9MC 1VQ5Q 2E64A 8AT1B 3OW2P 3MEWA 3VS5A 1RUWA 2PTKA 2QGFB 1BKBA 4PJOF 4LDYA 3KBGA 1BI1A 3EG0A 3X28B 5LJ5h 3A8HB 1K1ZA 5J3BA 1I8FA 2DK3A 3MCAB 3WXMB 2A36A 1IHVA 3JCMg 4C92G 5LJ3g 4Z8AA 2CP6A 4FT4A 3CC7T 2FPFA 4XK8E 4QQGA 1PSEA 4M78A 4LN2A 3EAEA 5KYNA 1WFWA 2E12A 4EPCA 2EGEA 5KH6A 2F2XA 5LJ3j 2KMTA 3MO8A 1X43A 2FG0A 2ED0A 3H6ZA 3QJYA 5LJ3d 1GFCA 3PMIA 2KRSA 3R6NA 4M77B 3KXTA 1W6XA 3CQTA 1YI2Q 2MMPA 3VS7A 2RMOA 4NOYA 1NJIC 1YP5A 4FT2A 4OMFB 3REBB 2YUPA 1QW1A 3C4SA 4JS4A 2GGRA 3CCSA 4O6JA 1HK9A 1G5VA 1RAIB 2F1LA 2X4JA 4C5HA 1QMCA 3FB9A 2LNHB 3OS5A 2HSEB 4E7HA 2M1HA 4ZN1A 4OGCA 4PJOE 1VQ8Q 2J06A 1QLYA 3CCLA 5FU7C 3M58A 4XTUA 2DX1A 2Y4XA 1VQ6A 1U3OA 4OB3B 1VQLT 1AOJA 2JTEA 2YWWA 2QDLA 1Q86C 2B86A 3CCJQ 1N8RU 4A4FA 2QEXQ 1B3QA 1M5Q1 4E47A 3G6EA 2DTOA 1K9MR 2HBPA 2DIGA 1OU8A 4C0ZA 2HL5C 4M7DG 1JJ2A 1QVGP 2DD5A 3PNWC 1OULA 4IKFA 3EGDB 1SRLA 2M02A 1VQ7T 1M3AA 4O5VA 1U5SA 3FJPA 4HVWA 5CK9A 4MDXA 2LCLA 3OA6A 1AT1B 1TOVA 2L0AA 4ZTJA 2E65A 3H0HA 1Q82R 7AT1B 1Q7YU 1AWXA 4A54A 4V2SA 2AK5A 1W2BA 1VQ7A 5I11A 1PM3A 1UGQB 1TUCA 2YLCA 2WSFE 2PVDB 4P5NA 4Z02A 1QVGS 3RNJA 4DA4A 4QKUA 1EIFA 3E1SA 4PJNA 3ME9A 5GAOq 1VQ8T 5CO7A 1NG2A 4J5YA 1N8RC 2RM4A 2K2MA 3SD4A 3M0RA 4RTYA 1YWOA 3OYIA 1VQOQ 1YIJQ 3ZFJA 2BE9B 1KQSA 1XQHA 1VQLQ 4IURA 3RDVA 3M55A 2FZKB 2VGNA 2DZ9A 1YJNT 1RAEB 1LJOA 5LJ3h 2CZ6B 2VWFA 3CCMQ 1UHCA 2CZ0B 5M9OA 4AG1C 3UDCA 4J9BA 1FMVA 3A1PA 2QXFA 4C8QD 3FJ5A 3H41A 2P0PA 1ZSZB 2EYZA 3E9GA 1XNIA 3MEVA 4B6MA 2FVUA 4C8QF 2YRDA 4N4GA 3M53A 4K11A 1M1KU 1TG0A 4FU6A 4OMPA 3RERA 3I56Q 1VYTA 3QJ6A 4M77C 1H641 4J6WA 5GAOr 1I4K1 4RMOA 2CDTA 4ELZC 2QAZA 1X6BA 2EVRA 4N4IA 1JEGA 4OMQA 1NE8A 2VXEA 4N4HA 2KROA 1X6GA 1M1GA 2BTTA 3C94A 1G2BA 4EMGA 4X34A 3L2QA 1UFFA 1W70A 3H8ZA 5GAMf 2NYSA 2F2VA 1VQPQ 3FIFA 2FB7A 3EHRA 4PFOA 2NUTB 3CCJA 4F04B 2SEMA 4YTLA 3UT1A 4C92C 1KD1R 4LE9A 1NBEB 2YUNA 4RTXA 3EFSA 1X2KA 1K4US 4J6YA 2YT6A 3JCMJ 2IG0A 3CCEQ 4M7AC 3AT1B 1K8AU 5CCAA 3QUIA 2DILA 3V8LA 4DEXA 3CCQQ 2PUOB 5LJ5f 2A28A 2CZ7B 2P4RA 2XHCA 1M1FA 1NYGA 2W0ZA 3CEYA 3I56A 5CVIA 4C0DB 5CKEA 3VRYA 3QKJA 2L3SA 4PJOD 3HRUA 1BBZA 4M7DC 4XU0A 2FZGB 4JZ3A 3DB4A 4R55A 3JV3A 4CC7A 4GLMA 3CCUT 2COYA 4J83A 5A2QE 1G3TA 2DL5A 3NTKA 4KH1B 4BE1A 1G8XA 4PLIA 3VV0A 3JB9I 2L3RA 1B34B 3HPWA 2K3XA 2AKKA 2X35A 3M0UA 1Q86U 1NPRA 2KXDA 5GANe 4Z89A 3EG1A 2X4YA 4J9GA 2OTLQ 2RQTA 5GAN7 5KYWA 1I07A 1WYXA 2O88A 1AD5A 4JRIA 3CCRT 2LP5A 2KNBB 2HBWA 2VASA 5I2SA 1YI2T 1ACMB 3F70A 2V8JA 1NZ9A 3S6WA 1SSFA 1U1TA 3V8KA 1GBQA 3L2WA 3QZ5B 3M56A 4J9DA 3PGGA 1VQ8A 2JMAA 1BYMA 2EBPA 3JCMW 2XDBA 2QK0A 5FU6C 4AG2C 4KH0B 4QQ6A 3QPHA 1P92A 2ZPFB 1XTDA 2JMCA 4IUQA 1PC0A 1R77A 2EIFA 3EGXA 3LH5A 2O9SA 3L2VA 3TCJA 2K9GA 2LZ6B 3DLLA 3BY7A 1UEBA 4ZGEB 2CREA 2OAWA 2DZCA 2RK2A 3V7SA 1N9SA 2EAYA 2KQWA 4QT7A 1FX7A 2JM8A 4C92B 5ECAA 2DPPB 3H9NA 4LNPA 2EYYA 1RABB 1YBYA 2CUDA 4RCBA 3CXCS 1BIBA 3G6ET 2EJ9A 2ZPBB 1K0SA 1GRIA 5KYXA 1VIEA 2KR3A 2HKNA 2ZPIB 2LQ8A 2DEUA 3CCRQ 1SEMA 1YJWT 2K6DA 2RB6A 2L8DA 3G7ZA 2JXBA 2VV5A 1K9MU 4BI3A 5CKFA 1Y96A 1X01A 2CZ1B 1BU1A 2JTFA 3SWNB 1WJQA 4KGXB 1W2BP 3OYYA 5GJVB 2DXCA 3META 2XI9A 2GQVA 3FDRA 4C0GA 4M78G 1Q82U 2EFIA 1R0BG 4RTTA 3M57A 4RTVA 3CCEA 5A0GA 3MEAA 3HSBA 2DJQA 4PJLA 1M9SA 1M27C 2X4XA 2QA4A 2F69A 1WI7A 4XAXB 1PHTA 5KYUB 1WZOA 2MIOA 5GAMd 3QIIA 1PRLC 1O75A 2E1HA 1H3HA 1VUBA 1WQWA 2E6NA 4BE0A 1WX6A 1PNJA 3TQ7P 3CCET 2RHYA 3H0FA 2XD0A 1C6VX 1N9RA 4HCCA 2O2OA 3CMAT 2ZZDA 5HCKA 3QG1A 1K0XA 2GFAA 5GAN4 1BK2A 3OYHA 4M77A 1X6OA 1YI2A 1A0NB 1NJIR 2NUZA 3JCMX 3O8VA 1YFNA 4LUDA 1S72A 4M7DB 4JJCA 2EQIA 2KE9A 4PJMA 3CBPA 3MHXA 5LJ5j 2MF2A 3M0QA 2LQKA 2RQWA 3P8HA 4PJOB 3E9FA 4WF2A 1MMGA 2RJDA 2GTJA 4HT8A 2KYBA 2JN0A 3NMZC 5CAIA 1M2OA 2DL4A 3M5AA 3OYJA 3CXCP 5IHKA 2DRMA 5KYWB 5IT9E 1R8OB 1I81A 2J05A 1JO8A 2YXYA 1G83A 4JPBW 3OQ5A 5GMKe 1JXOA 4RCCA 1K73R 2W10A 1KHCA 3HTRA 5IHNA 2H3EB 1NLPC 2DNUA 5GAOp 1TTHB 3I5RA 3RESA 5KCHA 2RH2A 4FW2A 3GIBA 3UATA 3G4SA 4IIOA 2PVOB 3SWNA 1KG1A 2CSQA 4JUVA 1JBMA 2H8HA 3M9QA 3PTAA 1BCOA 2MPXC 2LT4A 3TSWA 4A4KA 4NS5A 4WCIA 4KUIA 3QHSA 4M7DF 1G3SA 2QQBA 4FYYB 3TEEA 4JS5A 4M78E 2XICA 1AWJA 1PSFA 2FYKA 4QQDA 4CC3A 3FRNA 3OSSC 5CQYA 4MMLA 2LCCA 4D8KA 2ABLA 1MHNA 2DM1A 1M4ZA 1GCPA 1K76A 2LQWA 2HAXA 2OJ2A 1OQKA 1NLOC 3SEMA 1JJ2P 2BUDA 4JLGA 2DXTA 2GQIA 2DTHA 2I2LA 3UA7A 2OTJQ 3L1AA 4C8QB 3VU3C 3PE0A 4IUPA 1NPPA 1J3TA 1Q95G 5FLXE 3FC3A 2QASA 1GL5A 1B07A 1LVKA 2X3XD 4B9WA 2PUKB 1MV3A 3NPFA 1MNDA 3VS0A 3LX7A 2FRWA 2A3LA 4XQ3A 2K79A 2YSQA 3CC4T 1WLPB 1MUZA 1WXUA 4EMKC 3GNGA 3UA6A 1RLQC 1VIFA 3CCLQ 4F7UG 1OYXA 1YJWA 3PVLA 1O9SA 3LH0A 1UJYA 4OF1A 4X9DA 2JVVA 4M7AA 2LC4A 1VQMT 2V1RA 1TUGB 2DAQA 2JJ9A 4JLIA 1OEBA 1ARKA 2HQXA 3RMQA 5I21A 4Y28E 1M30A 1MV0B 2M16A 3QWXX 4MZTA 5GAMe 4OVAA 1D09B 4XTYA 4XTZA 2EYWA 2LQNA 2DKGA 2E70A 5KCOA 3QYHB 2DD4A 5EC7A 1KQ2A 2CH4W 2E6ZA 3CCMT 3JAME 4FW1A 1VQ6Q 5LL6S 5HKCA 5EG2A 1RACB 2OX7A 1SRMA 2DVJA 3CXCA 2V1QA 1PCXA 2MI6A 1LPLA 3HFOA 3I55T 3INZA 3G4ST 4DBRA 3UWNA 4KBMB 4JRKA 2RHUA 1WA7A 1UB4A 3QYGB 3JCMQ 2E3IA 1Q81U 2DA9A 1VQKA 3I5SA 1Q81R 4BE2A 1JJ2S 2FL7A 1OPLA 1WIEA 4XU3A 5GJWB 2XDPA 3ER0A 4M75A 2RQUA 1I5OB 3C12A 4F16A 2ZGWA 4RUGA 3THKA 4DOVA 4RTUA 5GAN8 4HT9A 1PKTA 1QVFA 1JU5C 3VS6A 1IZ6A 3M4YA 2LVMA 2BZ8A 3A8GB 2KGTA 4F7UA 3A98A 4E7JA 2DERA 2XIDA 4HVVA 2GFUA 2AIRB 1RAAB 3NTHA 1VQ5T 1VQNT 2X9HA 2Y90A 4X1VA 3V7CA 1K9AA 1M90U 1Q86R 3T9NA 5L23A 1YCYA 2IIMA 2KDSA 5GAOn 2X51A 1JXMA 2RJEA 4KRTA 2EKHA 3CC2Q 5IHIA 2HL3A 3SWNC 2DBKA 4M7AD 1KD1C 1WXTA 3OYLA 3ZL7C 1LCKA 4OMLA 5LJ5d 2X4WA 4F14A 4KULA 1UDLA 4M77F 4ME7A 1SF9A 2DETA 2D0QB 1YHQA 1YIJA 1VQNA 2FZCB 2YHTA 3Q1JA 4RG8A 3CD6Q 2RJFA 3JB9F 3OB9A 2C0OA 1TUDA 1M3BA 2RJCA 4ZN3A 4L5GA 1D3BA 1VQ5A 1TS9A 5DLOA 3JB9D 4CC4B 1D1AA 1I5LA 3BW1A 4DQ2A 3J7AF 3J80E 1V1CA 2RD1A 3VYHB 4C92F 1QKWA 5I22A 1WHMA 1Y7XA 2KT1A 2XK0A 3PT9A 3VS4A 1VQOT 4M7DD 1OX9A 1WDXA 2BE7D 2CT3A 2ED1A 4ELYC 4KGZB 2D9TA 3VUBA 3HKSA 2C06A 1ZX6A 2KAFA 1IREB 2ZAEA 2ZCFB 2JZ2A 4GBQA 4JDSA 1TSFA 3CMAQ 2GBQA 5GAMh 3EG3A 1VQLA 2P0QA 5GMKl 1X75C 3AHUA 3CC2T 5IH2A 4ATOA 3JB9H 4Q5WA 4C92A 2RK1A 2J6FA 1M2VA 4M77E 1VQOA 5FRNA 5FW9A 1HSQA 2F5TX 2R58A 3OBYA 3JCMd 1GFDA 3C0CA 3EGDA 3EG9B 2CP5A 3G4SQ 1WHKA 1XOVA 3HHTB 1E7OA 1RLPC 1X2QA 2KK4A 2M0OA 4NL3A 3BFMA 4A4GA 3MPUB 4A4HA 2KSSA 5HK3A 2K2VA 2O4XA 3CCSQ 2XG8D 2ZPEB 5GANd 5LJ3f 4C5GA 5GAN3 1VQMQ 2LMJA 2CP7A 3QDFA 5LJ5e 3RKXA 4E7LA 2DFUA 4L59A 3I55A 3JB9J 4HKEA 6AT1B 1FYNA 3CPWA 2M51A 1ZHIA 2LNVA 4TVRA 5HY6A 4EIKA 2YUQA 1IRXA 1OZ3A 4C92D 5KYUA 2ECZA 4DOWA 4XTWA 1YJNQ 2QA4T 2E10A 3M54A 2CGHA 1VQ4T 2RHXA 2IPOB 1VQ9Q 4M75C 3GNFB 3CC7Q 2VXFA 2FPEA 2E5KA 1B34A 1SKUB 4F7UF 2FO0A 2NUTA 4DBQA 1KC8R 3UPUA 1YITA 3JCMc 2OTLA 2VVKA 2DYIA 3MP1A 1YNZA 1M1KC 4PJOG 2OTJT 1WQ7A 4PJJA 1KK7A 2DEQA 4N0AC 1UECA 3OW2S 1D0YA 1QKXA 4GY5A 3CCUA 3S3NA 2FPDA 1MMAA 3SB2A 1UG1A 5I2MA 2J7IA 2CYZB 2QDYB 4D6WA 5FWBA 1NYFA 3X26B 3TSZA 1OX8A 1CSKA 2HQEA 2MYSA 5L8RE 3KUFA 2KI7A 4M7DE 1ZUKA 3URGA 2KXCA 3CCLT 1ABOA 4J8OA 1WGSA 2BZXA 1RAGB 3GPLA 2CKKA 1G3WA 1YHQQ 5GAMj 1PWTA 3GP8A 1ZA1B 3A8MB 3MKDA 2L5QA 5GAOm 5C6SA 3NFCA 1KQ1A 3OBWA 1KD1U 1LOJA 1E6HA 2A08A 4PLLA 3RMSA 3JB9G 3P8DA 5J39A 1FXXA 2D1XA 1Y0MA 1YWPA 1UTIA 1YIJT 1V76A 2D6FA 4A63B 2HKQB 3SHWA 3LGFA 2K5LA 5KE3A 2CT4A 1Z9ZA 1RAHB 3WVDB 1OOTA 2LT1A 2NWMA 1VQPT 2EJGA 5DY9A 4Y91A 5CKHA 3CC7A 1PD1A 2JTMA 2R5MA 4M7AG 1RL2A 2RI5A 2AZSA 2QYZA 3OYNA 5D6YA 4MDWA 1QCNA 4LUEA 2DL7A 3RBBB 1PRMC 2DLPA 1ZLMA 3FEOA 3P8BB 4L6V5 1ZSZA 4C8QE
chains in the Genus database with same CATH topology
2EQMA 3M55A 3OSVA 2EWNA 4LDVA 2VGNA 5FLXE 3PIOA 3FC3A 2DZ9A 3L2ZA 1YJNT 2JNGA 5D6XA 3CPWS 1BI0A 1LJOA 5LJ3h 2CZ6B 4B9WA 2PUKB 1NJIU 1S72T 4BDZA 3TREA 3LX7A 4XQ3A 2A3LA 2CZ0B 5M9OA 4BI4A 3CC4T 1YHQT 2HD0A 1KHIA 2DO3A 3UDCA 3MP6A 4EMKC 3GNGA 2MWOA 1VIFA 2QXFA 4N0AA 4C8QD 4F7UG 1OYXA 2P0PA 3NTIA 3E9GA 4HCBA 1GXIE 3ASKA 4MZPA 1XNIA 3MEVA 2JUFA 1YJWA 5D6WA 1O9SA 3LH0A 5GAOl 4X9DA 4OF1A 3CCQA 2JVVA 5FRMA 2OTJA 1OZ2A 2FVUA 4C8QF 2QQSA 2YRVA 2LC4A 1VQMT 4M7AA 3DB3A 1MGQA 2JOYA 4J7IA 1N27A 3A8OB 2DAQA 2XKOC 4N4GA 3M53A 4JLIA 2HQXA 3S3OA 1M1KU 4FU6A 3RMQA 5I21A 3PMTA 4Y28E 3X24B 1WJSA 3RERA 2M16A 4MZTA 3C95A 5GAMe 4KT0E 1K8AC 4OVAA 3CD6T 3QJ6A 2K5IA 2XDDA 4M77C 1H641 4XTYA 4XTZA 4J6WA 4EMHA 2DKGA 2E70A 1I4K1 1V29B 2L89A 3OMGA 3QYHB 3VUZA 5KCOA 4RMOA 3LGLA 4X9CA 1FWZA 4ELZC 3RIRA 2DD4A 3CMEA 1KQ2A 5GANg 5GAN2 2E6ZA 4N4IA 3CCMT 4A53A 3JAME 1D3BB 2QQRA 1NE8A 5LL6S 2VXEA 3L2UA 5GAN6 4N4HA 5AYFA 5HKCA 5EG2A 3C94A 1M1GA 4EMGA 3DLMA 4X34A 3L2QA 4DOWA 2BKDN 3H8ZA 4LD6A 3WVEB 5CKBA 3CXCA 3GF5A 5GAMf 2MI6A 3FIFA 2FB7A 4MMKA 4RKUE 5GMKj 3S3MA 5GANh 4C8QA 3HFOA 3QBYA 4ZGDB 3CCJA 3CCQT 3I55T 3CMAA 3INZA 3G4ST 5J26A 3UWNA 2CS7A 2EJFA 4KBMB 4YTLA 3OS2A 1BI2A 1WPYA 4JRKA 3UT1A 2O4XB 2RHUA 4C92C 4OB2B 3X25B 1VQ4A 4M7DA 5CR2A 4XTXA 1UB4A 3QYGB 3EFSA 4RG2A 3JCMQ 4XU1A 2K3YA 3R6OA 2RI3A 4J6YA 1Q81C 1Q81U 4BUGA 1VQKA 3OY9A 4BY6C 2DXBA 4BE2A 3JCMJ 2IG0A 1JJ2S 2FL7A 4M7AC 3CBMA 1K8AU 4XU3A 2O01E 2XU8A 4JRPA 4LDWA 2XDPA 3ER0A 5CCAA 4M75A 3CCVA 1Y07A 3CCST 3QUIA 4BDYA 3V8LA 3C12A 4PNOA 2PUOB 2ZGWA 4IUUA 3OYAA 2MWPA 3OYDA 4R56A 2A7YA 5LJ5f 4DOVA 4LD9K 5GAN8 2QEXA 4HT9A 4OB1B 4PKCC 4C8QG 1QVFA 1YJ9A 3JCMf 4FIBA 2CZ7B 2F5KA 1LNXA 2R57A 3HL8A 4E7KA 2XHCA 3JCMe 2LRQA 1M1FA 1IZ6A 3M4YA 3CEYA 2LVMA 4M75E 5CVIA 3A8GB 4C0DB 4F7UA 3I56A 5CKEA 1JRIA 3QKJA 1RI0A 2DVEA 2VUBA 3LW5E 5GMKi 4E7JA 2XIDA 4NL2A 2GFUA 3ZBDA 3J81E 3NTHA 1VQ5T 4PJOD 3HRUA 2OTLT 1VQNT 4BD3A 3LYIA 2Y90A 4M7DC 2PQWA 4XTVA 1WNLA 3V7CA 4C0FA 1M90U 1M90C 4XU0A 3T9NA 1UGSB 3DB4A 1YCYA 4R55A 1KQSS 4F7UE 4QVDA 2KDSA 5GMKh 5GAOn 3QXEB 3CCUT 4QVZA 1UGPB 1VQ6T 1K73U 4J83A 2NLUA 3V8JA 2RJEA 5A2QE 4M75B 1G3TA 3NTKA 4OGEA 4PJOA 4BE1A 4PLIA 3G71A 1W4SA 3CC4A 3VV0A 3JB9I 2L3RA 1B34B 2RI2A 5DLQE 4PJOC 2VYTA 2OAUA 2K3XA 3HPWA 2P0KA 3LLRA 3SWNC 5C0MA 2X35A 4M75D 3OYBA 4LDXA 4M7AD 1KD1C 1Q86U 2EQJA 2QEXT 1NPRA 5GANe 1Q7YC 3MP8A 3OYLA 2DJZA 5LJ5d 2X4YA 3V7RA 5IAYA 4M7AB 2X4WA 3M4GA 3OYCA 4FSXA 4M78C 2E5QA 5KE2A 5GAN7 4KULA 3FLGA 3N5BB 4M77F 4ME7A 5GAMg 2D0QB 1AHJB 1YHQA 4LDUA 1ZQ1A 4JRIA 3CBOA 1N6AA 4EMKB 4C92E 3CCRT 1YIJA 1VQNA 3OS1A 3LWHA 1YJ9T 2YHTA 3A8LB 3Q1JA 1W2BS 4RG8A 5I2SA 1VQ9T 1YI2T 2RJFA 3F70A 3I56T 3DKMA 3RUXA 3JB9F 5FU7B 3OB9A 4OB0B 2YLBA 3QO3A 2RJCA 2V8JA 4M7AE 5CQXA 4ZN3A 4L5GA 1D3BA 3JRZA 1VQ5A 1NZ9A 3S6WA 5DLOA 3JB9D 1SSFA 1U1TA 1QVFS 3G71T 3V8KA 4ZTFA 4A4EA 3L2WA 4II1A 3EFRA 1K73C 1I5LA 3PIPA 2LDMA 2RA2A 3BW1A 1M8VA 3QZ5B 3M56A 4DQ2A 3JCMh 3J7AF 3PGGA 3RKYA 3J80E 2RD1A 3VYHB 4C92F 2KVQG 2H3JA 1VQ8A 1BYMA 2G3RA 1Y7XA 2QI2A 1Y96B 2XK0A 3PT9A 3JCMW 1VQOT 2XDBA 4M7DD 5FROA 5FU6C 4JJNK 1HXDA 4IUTA 3QDRB 2P4TA 3OYKA 4ELYC 3OYGA 5A0DA 4QQ6A 3QPHA 1P92A 2ZPFB 1XTDA 1G3YA 2D9TA 3BDUA 4IUQA 1U8RA 5HK0A 2EIFA 2EKOA 2K5FA 3HKSA 3HRTA 3VUBA 2C06A 2V8IA 2KAFA 4XU2A 1IREB 2WACA 3CCJT 1KC8U 3L2VA 5GANf 2RHZA 2ZCFB 3TCJA 2LX9A 2JZ2A 4JDSA 3DLLA 5GAN5 3BY7A 4CI0C 4M77D 1UEBA 5GAMh 4ZGEB 2M9UA 4HCZA 2DZCA 2RK2A 3V7SA 1VQLA 3OMCA 1N9SA 2EAYA 4M78B 4C5EA 2KQWA 2P0QA 3E19A 2K4YA 1FX7A 2K57A 5GMKl 4C0DC 4C92B 2DPPB 1X75C 3AHUA 3CC2T 4JRQA 2RHIA 1YBYA 3MEUA 4RCBA 3CXCS 4BI8B 4ATOA 1BIBA 5LJ3e 3JB9H 3G6ET 4Q5WA 2EJ9A 4C92A 4E7IA 2ZPBB 2RK1A 2FHDA 4M77G 2KY9A 4QW2A 5A0LA 2DXUA 5GMKm 4M77E 2WSEE 1VIEA 3OYFA 2EQKA 1VQOA 1OI1A 3LWIA 5FRNA 2ZPIB 5IN1A 2LQ8A 2F5TX 2R58A 2VGMA 3OBYA 3JCMd 3TU4K 1YJWT 2DIQA 2RB6A 2L8DA 3JCMb 2VC8A 3QSUA 3G7ZA 2VV5A 4VUBA 1K9MU 1K9MC 2E64A 4BI3A 5CKFA 1Y96A 3MEWA 1X01A 2CZ1B 3X20B 2EQUA 2JTFA 1XOVA 3HHTB 3SWNB 1WJQA 1BKBA 3OYYA 2ZPGB 4PJOF 2QQ9A 3KBGA 1BI1A 4LDYA 2DXCA 3ZEHA 3X28B 3META 5LJ5h 2XI9A 4UC4A 2GQVA 2KK4A 2M0OA 3A8HB 3FDRA 5J3BA 1I8FA 4C0GA 2DK3A 5GAOr 4FM4B 3MCAB 5GANj 4M78G 3BFMA 4NL3A 3WXMB 4A4GA 2E41A 3JCMg 1Y71A 3HFNA 2KSSA 3JCMV 4A4HA 4C92G 1Q82U 2EFIA 1Q82C 5HK3A 2K2VA 3M57A 5LJ3g 2O4XA 2XG8D 5CIUA 2ZPEB 4FT4A 5A0GA 5GANd 3CCEA 3CC7T 3CCMA 5LJ3f 3MEAA 3SDZA 4C5GA 2QQAA 5GAN3 4XK8E 4QQGA 3HSBA 1PSEA 5FU6B 5LJ5e 1M9SA 2X4XA 4M78A 3RKXA 4L59A 2QA4A 4E7LA 3EAEA 3I55A 3JB9J 4HKEA 3CPWA 2F69A 1ZHIA 4XAXB 5GAMd 2E12A 4CRIA 3QIIA 1O75A 2E1HA 2LNVA 4TVRA 5HY6A 4EPCA 4F7UB 3CC2A 1VUBA 4BY6B 2EYQA 5KH6A 5LJ3j 2KMTA 3MO8A 1UGRB 1WQWA 1OZ3A 2E6NA 4QVCA 4BE0A 1WJRA 4C92D 1YJNA 3H6ZA 2R5AA 3QJYA 4M78D 2RHYA 3RKWA 2ZPHB 4XTWA 3PMIA 5LJ3d 3CCET 2XD0A 1N9RA 1BI3A 4MZMA 4M77B 4HCCA 3KXTA 3CMAT 2ZZDA 2QA4T 3QG1A 2E10A 2GFAA 2IVWA 2CGHA 3M54A 1VQ4T 5GAN4 2RHXA 2MMPA 4M75C 1DJ7B 5LJ5g 3L42A 3GNFB 3OYHA 4M77A 3CCVT 3JSCA 4NOYA 1NJIC 2Y4YA 1X6OA 1YI2A 1VQ9A 2VXFA 2DTIA 4FT2A 1QVGA 4OMFB 3JCMX 3O8VA 1B34A 3OYEA 1QW1A 4F7UF 3C4SA 4JS4A 3A5ZB 1S72A 3CCSA 4O6JA 1HK9A 4M7DB 1G5VA 3UPUA 4BB7A 3JCMP 3CBPA 3MHXA 5LJ5j 2MF2A 2X4JA 4C5HA 1YITA 3JCMc 2LQKA 2OTLA 3FB9A 2B8AA 1JB0E 3OS5A 3P8HA 4E7HA 4PJOB 3E9FA 2GF7A 3MP1A 4PL6A 4WF2A 2RJDA 2M1HA 4ZN1A 1M1KC 4HT8A 4PJOG 4EMKA 2JN0A 5CAIA 1WQ7A 3M5AA 4OGCA 3OYJA 2OTJT 4PJOE 3BDLA 2DEQA 4N0AC 5IT9E 1R8OB 1I81A 3OW2S 3M59A 4GY5A 3M58A 5FU7C 4XTUA 4C5IA 3CCLA 1H3ZA 2Y4XA 3CCUA 3S3NA 1VQ6A 4OB3B 1VQLT 3SB2A 3OQ5A 5GMKe 1YITT 4RCCA 4C8QC 5I2MA 3HP9A 3CPFA 2CYZB 2QDYB 1Q86C 4D6WA 1N8RU 4A4FA 1QP3A 1KHCA 3X26B 1M5Q1 4E47A 3G6EA 2HQEA 3SFMA 5GAOp 2DTOA 5L8RE 2HBPA 3RESA 4B9XA 2DIGA 2RH2A 3KUFA 5KCHA 4M7DE 4C0ZA 3GIBA 3URGA 4M7DG 3CCLT 1JJ2A 3G4SA 4J8OA 2DD5A 1WGSA 3PNWC 3GOXA 4IKFA 2PVOB 2MAMA 3SWNA 3GPLA 2CKKA 4HA8A 4OP0A 1KG1A 1G3WA 1U1SA 1VQ7T 5GAMj 4JUVA 4O5VA 1BIAA 4J7FA 3FJPA 3GP8A 1JBMA 3A8MB 3CCRA 2L5QA 5GAOm 5C6SA 5CK9A 2LCLA 4MDXA 3OYMA 5DM7R 5CKDA 3OA6A 3NFCA 1KQ1A 4ZTJA 2E65A 3M9QA 2V8KA 3OBWA 1KD1U 1LOJA 4PLLA 3RMSA 3PTAA 3JB9G 1VQKT 3P8DA 1Q7YU 4A54A 1TH7A 3OW2A 2LT4A 5J39A 4V2SA 1VQPA 1FXXA 3VYGA 4A4KA 4NS5A 2D6FA 1YIJT 2WSCE 1W2BA 4J6XA 4KUIA 3QHSA 4M7DF 2PVGB 3L2RA 1VQ7A 1G3SA 2QQBA 3TEEA 3VJPA 4IUVA 4ZGJB 1UGQB 4JS5A 3LGFA 2K5LA 2YLCA 4M78E 2XICA 2WSFE 1PSFA 2AHJB 2FYKA 5KE3A 4QQDA 1ZBXA 3FRNA 3OSSC 5CQYA 4MMLA 2LCCA 2PVDB 4P5NA 3WVDB 2GCXA 2RO0A 1QP2A 1MHNA 3QZ9B 2LT1A 3VKIA 2HNIA 4Z02A 4M75F 1QVGS 1M4ZA 1VQPT 2EJGA 5DY9A 4Y91A 4DA4A 5CKHA 1EIFA 3E1SA 2BIVA 4GLKA 3CC7A 2HAXA 3ME9A 2JTMA 4M75G 2R5MA 5GAOq 5CO7A 4BACA 1RL2A 2RI5A 4J5YA 1VQ8T 4M7AG 4EDUA 3CD6A 1N8RC 2BUDA 2LTOA 1VQMA 2PU9B 2RM4A 4JLGA 3OYNA 4FL6A 2DXTA 5D6YA 3HRSA 2DTHA 4MDWA 3SD4A 4M7AF 2QTXA 3OYIA 2I2LA 3CMET 4M78F 4KUDK 3L1AA 3GLXA 4C8QB 1QVPA 3VU3C 3PFSA 3FEOA 3P8BB 1KC8C 3OS0A 3ZFJA 1KQSA 1XQHA 4IUPA 4L6V5 4IURA 1NPPA 4C8QE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIO A;  1UEB A;  5FLX E;  2OTL A;  2XHC A;  1VQL A;  1IZ6 A;  2LVM A;  3I56 A;  1YJN T;  2JNG A;  3CPW S;  4ZN1 A;  1NJI U;  1M1K C;  1S72 T;  2OTJ T;  3J81 E;  1VQ5 T;  3CC2 T;  2OTL T;  1VQN T;  3TRE A;  1YBY A;  3CXC S;  3G6E T;  3CC4 T;  5IT9 E;  1YHQ T;  3OW2 S;  1M90 U;  1M90 C;  1KHI A;  2DO3 A;  3CCL A;  3CCU A;  1VQ6 A;  3DB4 A;  1KQS S;  2MWO A;  1VQL T;  2KDS A;  1YIT T;  1VQO A;  3CCU T;  1VQ6 T;  1K73 U;  3CPF A;  1Q86 C;  1XNI A;  1YJW A;  2JUF A;  2LQ8 A;  1N8R U;  5A2Q E;  3LH0 A;  2OTJ A;  3CCQ A;  2JVV A;  3G71 A;  1VQM T;  3DB3 A;  1YJW T;  2JOY A;  3G6E A;  3CC4 A;  1K9M C;  1K9M U;  2L3R A;  5DLQ E;  1M1K U;  1KD1 C;  3CCL T;  1JJ2 A;  1BKB A;  1Q86 U;  2QEX T;  1NPR A;  3OYY A;  3G4S A;  1Q7Y C;  1K8A C;  3KBG A;  3CD6 T;  5IAY A;  2CKK A;  1VQ7 T;  5J3B A;  2E70 A;  3LGL A;  3CCR A;  3CME A;  1YHQ A;  2LCL A;  2E6Z A;  3CCM T;  5DM7 R;  3JAM E;  1Q82 U;  1Q82 C;  3CCR T;  1YIJ A;  5LL6 S;  1KD1 U;  1VQN A;  3CCE A;  1VQK T;  3CC7 T;  3CCM A;  1YJ9 T;  1M1G A;  1Q7Y U;  1W2B S;  3OW2 A;  4X34 A;  2QA4 A;  1VQ9 T;  1VQP A;  1YI2 T;  3I55 A;  3I56 T;  3CXC A;  3CPW A;  1YIJ T;  2MI6 A;  1W2B A;  4CRI A;  4TVR A;  5HY6 A;  1VQ7 A;  4ZN3 A;  1VQ5 A;  3CC2 A;  1NZ9 A;  3LGF A;  3CCJ A;  3CCQ T;  3I55 T;  3CMA A;  1SSF A;  3G4S T;  1QVF S;  5J26 A;  3G71 T;  4QQD A;  4YTL A;  1YJN A;  1K73 C;  3PIP A;  3CCE T;  1VQ4 A;  3J7A F;  3CMA T;  3J80 E;  1QVG S;  4RG2 A;  2QA4 T;  3DLL A;  1VQP T;  2KVQ G;  1VQ4 T;  1VQ8 A;  2G3R A;  1Q81 C;  1VQO T;  1Q81 U;  1EIF A;  3CC7 A;  1VQK A;  1VQ8 T;  1JJ2 S;  1RL2 A;  2IG0 A;  3CCV T;  3CD6 A;  1NJI C;  1N8R C;  1X6O A;  1YI2 A;  1K8A U;  1VQ9 A;  1VQM A;  3ER0 A;  1QVG A;  3CCV A;  3CCS T;  1XTD A;  2EIF A;  3HKS A;  3CME T;  3A5Z B;  1S72 A;  3CCS A;  2MWP A;  3P8B B;  3CCJ T;  1KC8 C;  1KC8 U;  2QEX A;  1KQS A;  1QVF A;  1YJ9 A;  1NPP A;  1YIT A; 
#chains in the Genus database with same CATH topology
 2EWN A;  2BZY A;  4LXC A;  2JNG A;  5D6X A;  1H8K A;  1WXB A;  3TRE A;  2KYM A;  4J9H A;  4ANJ A;  2NUP B;  2HD0 A;  3EHQ A;  3MP6 A;  1D0Z A;  1WHJ A;  4N0A A;  4HCB A;  1GXI E;  4MZP A;  2JUF A;  5D6W A;  5GAO l;  3CCQ A;  5FRM A;  1UE9 A;  2QQS A;  1MGQ A;  2JOY A;  3TVT A;  1UJ0 A;  2XKO C;  3U23 A;  3S3O A;  1FMK A;  2ESW A;  1WJS A;  2EW3 A;  1RI9 A;  4HXJ A;  3C95 A;  1K8A C;  4KT0 E;  1HYO A;  4EMH A;  3VUZ A;  2QG9 B;  2L89 A;  1VOM A;  3LGL A;  3RIR A;  5GAN 2;  3EFO B;  1I1J A;  3L2U A;  5GAN 6;  5AYF A;  1AZE A;  4HCK A;  4LD6 A;  3WVE B;  3GF5 A;  1VQ7 Q;  4RKU E;  4MMK A;  5GMK j;  4C8Q A;  4ZGD B;  3CCQ T;  1X69 A;  3CMA A;  5J26 A;  1E6G A;  1D1C A;  1B7T A;  1IB8 A;  1VQ4 A;  1Q7Y R;  1AWO A;  1YCS B;  4RG2 A;  4XU1 A;  2K3Y A;  2RI3 A;  1Q81 C;  2LJ1 A;  3IQL A;  2DXB A;  1T3S A;  3CBM A;  2XU8 A;  4LDW A;  1IO6 A;  3CCV A;  4DBF A;  4BDY A;  2L2P A;  2EPD A;  4JZ4 A;  3OYA A;  2LJ3 A;  2MWP A;  1YIT Q;  3OYD A;  2QEX A;  1EX4 A;  2K3B A;  1YJ9 A;  4FIB A;  5AT1 B;  2F5K A;  3JCM e;  2LRQ A;  1N8R R;  3EH2 A;  4NL2 A;  3ZBD A;  2YDL A;  2OTL T;  3LYI A;  1CKA A;  2PQW A;  4XTV A;  1WNL A;  4C0F A;  2HSP A;  2LJ0 A;  1TWB A;  1D1B A;  1ZBJ A;  1KQS S;  4F7U E;  2CP3 A;  2O9V A;  2DE0 X;  1MMN A;  1VQ6 T;  1S72 Q;  2RI2 A;  5DLQ E;  3M0T A;  2VYT A;  3VS3 A;  4PJO C;  3LLR A;  2P0K A;  5C0M A;  4DBH A;  1PG5 B;  4M75 D;  4OMO A;  2LCS A;  2EQJ A;  4RTW A;  2EGA A;  1Q7Y C;  3MP8 A;  2DJZ A;  2VKN A;  4M7A B;  1YJ9 Q;  2MK5 A;  4M78 C;  1W1F A;  3RR6 A;  2HQH A;  1WHG A;  3N5B B;  1QVF P;  1F1B B;  2HEQ A;  1ZQ1 A;  3CBO A;  1N6A A;  1Y57 A;  4C92 E;  4EMK B;  3GBQ A;  1IGU A;  1W2B S;  1XJW B;  4DEY A;  1VQ9 T;  3I56 T;  1KQS P;  1VA7 A;  3RUX A;  5FU7 B;  2QA4 Q;  3QO3 A;  1NM7 A;  1VYU A;  4M7A E;  5CQX A;  1T3L A;  1UUE A;  3G71 T;  4ZTF A;  3NGP A;  1RAD B;  4CC2 A;  4II1 A;  3EFR A;  1PD0 A;  2LDM A;  2RA2 A;  1M8V A;  3RKY A;  2C0I A;  2KVQ G;  2H3J A;  1IXD A;  4JJD A;  4PFZ A;  1HXD A;  1VQK Q;  2Z0W A;  3OYG A;  1YN8 A;  5A0D A;  1U8R A;  2J6O A;  2HZY A;  2K5F A;  2V8I A;  2WAC A;  3CCJ T;  1KC8 U;  1C1A A;  4M77 D;  2GTO A;  2M9U A;  3M0S A;  4HCZ A;  1JQQ A;  4ESR A;  4C5E A;  3QWY A;  3REA B;  2K4Y A;  4C0D C;  3UF4 A;  1NEB A;  8ATC B;  4AFU C;  4BI8 B;  4R0K A;  4J9I A;  5LJ3 e;  3E2U A;  4E7I A;  1AEY A;  3VS2 A;  2FHD A;  5A0L A;  2KY9 A;  2WSE E;  3OYF A;  2EQK A;  3TU4 K;  3I55 Q;  2VC8 A;  2ATC B;  1H92 A;  5FWC A;  4ZNX A;  1QCO A;  1ZA2 B;  2HCK A;  3X20 B;  2EQU A;  2DL8 A;  2ZPG B;  2QQ9 A;  3ZEH A;  1Z9Q A;  5KYX B;  4UC4 A;  1UGV A;  4FM4 B;  5GAN j;  4AMC A;  2E41 A;  2F2W A;  1Y71 A;  2KEA A;  3HFN A;  3JCM V;  1Q82 C;  5CIU A;  2V26 A;  4HVU A;  3CCM A;  3SDZ A;  2QQA A;  3EG2 A;  4FYV B;  5FU6 B;  2I0N A;  2L3P A;  2A37 A;  4CRI A;  1QWF A;  4F7U B;  1TXQ A;  3CC2 A;  2PZ1 A;  4BY6 B;  2EYQ A;  2A0F B;  1UGR B;  2D8H A;  4QVC A;  1PKS A;  1WJR A;  1YJN A;  1HJD A;  1HD3 A;  2R5A A;  3RKW A;  1MMD A;  4M78 D;  2ZPH B;  4KGV B;  1BI3 A;  2K7A A;  4MZM A;  4Y92 A;  2DBM A;  2DL3 A;  2IVW A;  4PFP A;  1WHH A;  1DJ7 B;  5LJ5 g;  1U06 A;  3L42 A;  1K8A R;  3CCV T;  3JSC A;  2JW4 A;  2Y4Y A;  1VQ9 A;  2DTI A;  1ZSZ C;  2CP2 A;  2QTV A;  1QVG A;  3OYE A;  3A5Z B;  4BB7 A;  3JCM P;  2HMA A;  1GBR A;  1KSW A;  4AFZ C;  2B8A A;  1JB0 E;  3I35 A;  2FEI A;  2GF7 A;  4PL6 A;  3CPW P;  2NUP A;  4EMK A;  3BDL A;  4D8D A;  2CSI A;  3M59 A;  1ZUY A;  4C5I A;  1VQ4 Q;  1TU0 B;  1H3Z A;  1IHW A;  2G6F X;  1YIT T;  1QWE A;  4C8Q C;  3HP9 A;  3CPF A;  4E7S A;  1OV3 A;  1QP3 A;  4PK4 A;  1M8M A;  4J9F A;  4E6R A;  3SFM A;  2AKL A;  3O5Z A;  3ULR B;  4B9X A;  2D8J A;  1M90 R;  4F17 A;  1EZZ B;  3GOX A;  2MAM A;  4HA8 A;  4OP0 A;  1U1S A;  1ZSG A;  1BIA A;  4J7F A;  3CCR A;  2DYB A;  1CKB A;  3G1J A;  4M4Z A;  1OPK A;  2COW A;  3OYM A;  5DM7 R;  5CKD A;  2V8K A;  1VQK T;  4OMN A;  1TH7 A;  3OW2 A;  3CCV Q;  1VQP A;  2AZV A;  3VRZ A;  3VYG A;  2ROT A;  2WSC E;  4J6X A;  4OMM A;  2PVG B;  3L2R A;  2E3H A;  2RQR A;  3VJP A;  4IUV A;  4ZGJ B;  4FYX B;  3KFV A;  1OU9 A;  2AHJ B;  2CUB A;  1ZBX A;  4AFQ C;  1GCQ A;  2GCX A;  2RO0 A;  1QP2 A;  3VKI A;  3QZ9 B;  1AVZ C;  2HNI A;  2MOX A;  4M75 F;  2O31 A;  9ATC B;  2EYX A;  4GLK A;  2BIV A;  4BAC A;  4M75 G;  4EDU A;  3CD6 A;  1M2V B;  4E7Z A;  2LTO A;  1VQM A;  2PU9 B;  3CC4 Q;  4FL6 A;  3HRS A;  4M7A F;  2QTX A;  1AWW A;  2RPN A;  3CME T;  4M78 F;  4KUD K;  3GLX A;  2JS0 A;  1QVP A;  3PFS A;  1KC8 C;  3OS0 A;  1KFZ A;  2EQM A;  3PIO A;  3H0I A;  1WHL A;  2JT4 A;  3OSV A;  4LDV A;  1SPK A;  3L2Z A;  3CPW S;  1BI0 A;  3D7S B;  1QQJ A;  1NJI U;  1S72 T;  4BDZ A;  1C0M A;  4BI4 A;  3PVQ A;  1YHQ T;  5D7U A;  1KHI A;  2DO3 A;  2MWO A;  4ORZ A;  2E4H A;  3NTI A;  2RN8 A;  1KIK A;  3ASK A;  1UHF A;  2OTJ A;  2EGC A;  1OZ2 A;  2YRV A;  3DB3 A;  4J9C A;  4J7I A;  4AT1 B;  1N27 A;  3A8O B;  2J6K A;  3PMT A;  4FSS A;  3X24 B;  2VB6 A;  3VS1 A;  3CD6 T;  2K5I A;  2XDD A;  2HDA A;  1X27 A;  2XMF A;  3OMG A;  1V29 B;  1VYV A;  3MJX A;  4X9C A;  1FWZ A;  3CME A;  5GAN g;  3EG9 A;  4A53 A;  1D3B B;  2QQR A;  3CCU Q;  4WTO B;  4FCY A;  3DLM A;  1M1K R;  1AZG B;  1FMW A;  2BKD N;  5CKB A;  1QCF A;  2ROL A;  3S3M A;  5GAN h;  3QBY A;  4FYW B;  1YJW Q;  2CS7 A;  2EJF A;  3OS2 A;  1BI2 A;  1WPY A;  2O4X B;  2LX7 A;  3EFO A;  4OB2 B;  2JM9 A;  3X25 B;  4M7D A;  5CR2 A;  4XTX A;  3R6O A;  4BUG A;  1SSH A;  1NEG A;  3OY9 A;  4Z88 A;  4BY6 C;  2AT1 B;  2RF0 A;  1VQN Q;  2O01 E;  4JRP A;  1Y07 A;  3CCS T;  4PNO A;  4IUU A;  4R56 A;  2A7Y A;  4LD9 K;  5IXF A;  2DRK A;  4OB1 B;  4PKC C;  4C8Q G;  2GNC A;  3JCM f;  4E7K A;  1LNX A;  2R57 A;  3HL8 A;  4M75 E;  2D0N A;  1JRI A;  1RI0 A;  2DVE A;  2VUB A;  3LW5 E;  1ZUU A;  5GMK i;  3J81 E;  3I9Q A;  2X3W D;  4BD3 A;  2QGG A;  2ENM A;  1M90 C;  2KRN A;  1UGS B;  2COZ A;  4QVD A;  5GMK h;  3QXE B;  3EGX B;  4QVZ A;  1UGP B;  1K73 U;  2NLU A;  3V8J A;  4M75 B;  4PJO A;  4OGE A;  3G71 A;  1W4S A;  1BCM A;  3CC4 A;  2KRM A;  2OAU A;  3OYB A;  4LDX A;  1SHF A;  2QEX T;  3V7R A;  5IAY A;  5KYY B;  3OYC A;  3M4G A;  4FSX A;  1MNE A;  1M3C A;  2E5Q A;  2P84 A;  5KE2 A;  3FLG A;  5GAM g;  1AHJ B;  4LDU A;  1SG5 A;  3OS1 A;  1IGQ A;  3LWH A;  1YJ9 T;  3A8L B;  4E2F B;  2MCN A;  2FRY A;  3DKM A;  1ABQ A;  4OB0 B;  2YLB A;  1I0C A;  3JRZ A;  3CME Q;  2DF6 A;  1QVF S;  4A4E A;  3M0P A;  1K73 C;  3PIP A;  4J9E A;  2DMO A;  3JCM h;  2L3Q A;  1T0H A;  2G3R A;  5KYY A;  2QI2 A;  1Y96 B;  2JS2 A;  5IXB A;  5FRO A;  4JJN K;  1R0C B;  4IUT A;  1D0X A;  2P4T A;  3QDR B;  3OYK A;  2RNA A;  3G6E Q;  1EFN A;  4RTZ A;  3BDU A;  1G3Y A;  5HK0 A;  2EKO A;  3HRT A;  1RAF B;  1T0J A;  4XU2 A;  2YUO A;  3G71 Q;  3EH1 A;  2PNI A;  5GAN f;  2RHZ A;  4JJB A;  1S1N A;  2LX9 A;  1BB9 A;  5GAN 5;  4CI0 C;  4AFS C;  2OI3 A;  3OMC A;  4M78 B;  3E19 A;  2K57 A;  1KJW A;  2C0T A;  4JRQ A;  4IIM A;  2CP0 A;  2RHI A;  3MEU A;  2YRC A;  1SHG A;  2KBT A;  3BE3 A;  2M0Y A;  1N5Z A;  4M77 G;  4QW2 A;  2DXU A;  2KT8 A;  3EGU A;  3NHN A;  5GMK m;  1OI1 A;  3LWI A;  5IN1 A;  2RQV A;  2VGM A;  2SRC A;  2DIQ A;  2CH4 A;  3QSU A;  3JCM b;  1GCQ C;  4VUB A;  1K9M C;  1VQ5 Q;  2E64 A;  8AT1 B;  3OW2 P;  3MEW A;  3VS5 A;  1RUW A;  2PTK A;  2QGF B;  1BKB A;  4PJO F;  4LDY A;  3KBG A;  1BI1 A;  3EG0 A;  3X28 B;  5LJ5 h;  3A8H B;  1K1Z A;  5J3B A;  1I8F A;  2DK3 A;  3MCA B;  3WXM B;  2A36 A;  1IHV A;  3JCM g;  4C92 G;  5LJ3 g;  4Z8A A;  2CP6 A;  4FT4 A;  3CC7 T;  2FPF A;  4XK8 E;  4QQG A;  1PSE A;  4M78 A;  4LN2 A;  3EAE A;  5KYN A;  1WFW A;  2E12 A;  4EPC A;  2EGE A;  5KH6 A;  2F2X A;  5LJ3 j;  2KMT A;  3MO8 A;  1X43 A;  2FG0 A;  2ED0 A;  3H6Z A;  3QJY A;  5LJ3 d;  1GFC A;  3PMI A;  2KRS A;  3R6N A;  4M77 B;  3KXT A;  1W6X A;  3CQT A;  1YI2 Q;  2MMP A;  3VS7 A;  2RMO A;  4NOY A;  1NJI C;  1YP5 A;  4FT2 A;  4OMF B;  3REB B;  2YUP A;  1QW1 A;  3C4S A;  4JS4 A;  2GGR A;  3CCS A;  4O6J A;  1HK9 A;  1G5V A;  1RAI B;  2F1L A;  2X4J A;  4C5H A;  1QMC A;  3FB9 A;  2LNH B;  3OS5 A;  2HSE B;  4E7H A;  2M1H A;  4ZN1 A;  4OGC A;  4PJO E;  1VQ8 Q;  2J06 A;  1QLY A;  3CCL A;  5FU7 C;  3M58 A;  4XTU A;  2DX1 A;  2Y4X A;  1VQ6 A;  1U3O A;  4OB3 B;  1VQL T;  1AOJ A;  2JTE A;  2YWW A;  2QDL A;  1Q86 C;  2B86 A;  3CCJ Q;  1N8R U;  4A4F A;  2QEX Q;  1B3Q A;  1M5Q 1;  4E47 A;  3G6E A;  2DTO A;  1K9M R;  2HBP A;  2DIG A;  1OU8 A;  4C0Z A;  2HL5 C;  4M7D G;  1JJ2 A;  1QVG P;  2DD5 A;  3PNW C;  1OUL A;  4IKF A;  3EGD B;  1SRL A;  2M02 A;  1VQ7 T;  1M3A A;  4O5V A;  1U5S A;  3FJP A;  4HVW A;  5CK9 A;  4MDX A;  2LCL A;  3OA6 A;  1AT1 B;  1TOV A;  2L0A A;  4ZTJ A;  2E65 A;  3H0H A;  1Q82 R;  7AT1 B;  1Q7Y U;  1AWX A;  4A54 A;  4V2S A;  2AK5 A;  1W2B A;  1VQ7 A;  5I11 A;  1PM3 A;  1UGQ B;  1TUC A;  2YLC A;  2WSF E;  2PVD B;  4P5N A;  4Z02 A;  1QVG S;  3RNJ A;  4DA4 A;  4QKU A;  1EIF A;  3E1S A;  4PJN A;  3ME9 A;  5GAO q;  1VQ8 T;  5CO7 A;  1NG2 A;  4J5Y A;  1N8R C;  2RM4 A;  2K2M A;  3SD4 A;  3M0R A;  4RTY A;  1YWO A;  3OYI A;  1VQO Q;  1YIJ Q;  3ZFJ A;  2BE9 B;  1KQS A;  1XQH A;  1VQL Q;  4IUR A;  3RDV A;  3M55 A;  2FZK B;  2VGN A;  2DZ9 A;  1YJN T;  1RAE B;  1LJO A;  5LJ3 h;  2CZ6 B;  2VWF A;  3CCM Q;  1UHC A;  2CZ0 B;  5M9O A;  4AG1 C;  3UDC A;  4J9B A;  1FMV A;  3A1P A;  2QXF A;  4C8Q D;  3FJ5 A;  3H41 A;  2P0P A;  1ZSZ B;  2EYZ A;  3E9G A;  1XNI A;  3MEV A;  4B6M A;  2FVU A;  4C8Q F;  2YRD A;  4N4G A;  3M53 A;  4K11 A;  1M1K U;  1TG0 A;  4FU6 A;  4OMP A;  3RER A;  3I56 Q;  1VYT A;  3QJ6 A;  4M77 C;  1H64 1;  4J6W A;  5GAO r;  1I4K 1;  4RMO A;  2CDT A;  4ELZ C;  2QAZ A;  1X6B A;  2EVR A;  4N4I A;  1JEG A;  4OMQ A;  1NE8 A;  2VXE A;  4N4H A;  2KRO A;  1X6G A;  1M1G A;  2BTT A;  3C94 A;  1G2B A;  4EMG A;  4X34 A;  3L2Q A;  1UFF A;  1W70 A;  3H8Z A;  5GAM f;  2NYS A;  2F2V A;  1VQP Q;  3FIF A;  2FB7 A;  3EHR A;  4PFO A;  2NUT B;  3CCJ A;  4F04 B;  2SEM A;  4YTL A;  3UT1 A;  4C92 C;  1KD1 R;  4LE9 A;  1NBE B;  2YUN A;  4RTX A;  3EFS A;  1X2K A;  1K4U S;  4J6Y A;  2YT6 A;  3JCM J;  2IG0 A;  3CCE Q;  4M7A C;  3AT1 B;  1K8A U;  5CCA A;  3QUI A;  2DIL A;  3V8L A;  4DEX A;  3CCQ Q;  2PUO B;  5LJ5 f;  2A28 A;  2CZ7 B;  2P4R A;  2XHC A;  1M1F A;  1NYG A;  2W0Z A;  3CEY A;  3I56 A;  5CVI A;  4C0D B;  5CKE A;  3VRY A;  3QKJ A;  2L3S A;  4PJO D;  3HRU A;  1BBZ A;  4M7D C;  4XU0 A;  2FZG B;  4JZ3 A;  3DB4 A;  4R55 A;  3JV3 A;  4CC7 A;  4GLM A;  3CCU T;  2COY A;  4J83 A;  5A2Q E;  1G3T A;  2DL5 A;  3NTK A;  4KH1 B;  4BE1 A;  1G8X A;  4PLI A;  3VV0 A;  3JB9 I;  2L3R A;  1B34 B;  3HPW A;  2K3X A;  2AKK A;  2X35 A;  3M0U A;  1Q86 U;  1NPR A;  2KXD A;  5GAN e;  4Z89 A;  3EG1 A;  2X4Y A;  4J9G A;  2OTL Q;  2RQT A;  5GAN 7;  5KYW A;  1I07 A;  1WYX A;  2O88 A;  1AD5 A;  4JRI A;  3CCR T;  2LP5 A;  2KNB B;  2HBW A;  2VAS A;  5I2S A;  1YI2 T;  1ACM B;  3F70 A;  2V8J A;  1NZ9 A;  3S6W A;  1SSF A;  1U1T A;  3V8K A;  1GBQ A;  3L2W A;  3QZ5 B;  3M56 A;  4J9D A;  3PGG A;  1VQ8 A;  2JMA A;  1BYM A;  2EBP A;  3JCM W;  2XDB A;  2QK0 A;  5FU6 C;  4AG2 C;  4KH0 B;  4QQ6 A;  3QPH A;  1P92 A;  2ZPF B;  1XTD A;  2JMC A;  4IUQ A;  1PC0 A;  1R77 A;  2EIF A;  3EGX A;  3LH5 A;  2O9S A;  3L2V A;  3TCJ A;  2K9G A;  2LZ6 B;  3DLL A;  3BY7 A;  1UEB A;  4ZGE B;  2CRE A;  2OAW A;  2DZC A;  2RK2 A;  3V7S A;  1N9S A;  2EAY A;  2KQW A;  4QT7 A;  1FX7 A;  2JM8 A;  4C92 B;  5ECA A;  2DPP B;  3H9N A;  4LNP A;  2EYY A;  1RAB B;  1YBY A;  2CUD A;  4RCB A;  3CXC S;  1BIB A;  3G6E T;  2EJ9 A;  2ZPB B;  1K0S A;  1GRI A;  5KYX A;  1VIE A;  2KR3 A;  2HKN A;  2ZPI B;  2LQ8 A;  2DEU A;  3CCR Q;  1SEM A;  1YJW T;  2K6D A;  2RB6 A;  2L8D A;  3G7Z A;  2JXB A;  2VV5 A;  1K9M U;  4BI3 A;  5CKF A;  1Y96 A;  1X01 A;  2CZ1 B;  1BU1 A;  2JTF A;  3SWN B;  1WJQ A;  4KGX B;  1W2B P;  3OYY A;  5GJV B;  2DXC A;  3MET A;  2XI9 A;  2GQV A;  3FDR A;  4C0G A;  4M78 G;  1Q82 U;  2EFI A;  1R0B G;  4RTT A;  3M57 A;  4RTV A;  3CCE A;  5A0G A;  3MEA A;  3HSB A;  2DJQ A;  4PJL A;  1M9S A;  1M27 C;  2X4X A;  2QA4 A;  2F69 A;  1WI7 A;  4XAX B;  1PHT A;  5KYU B;  1WZO A;  2MIO A;  5GAM d;  3QII A;  1PRL C;  1O75 A;  2E1H A;  1H3H A;  1VUB A;  1WQW A;  2E6N A;  4BE0 A;  1WX6 A;  1PNJ A;  3TQ7 P;  3CCE T;  2RHY A;  3H0F A;  2XD0 A;  1C6V X;  1N9R A;  4HCC A;  2O2O A;  3CMA T;  2ZZD A;  5HCK A;  3QG1 A;  1K0X A;  2GFA A;  5GAN 4;  1BK2 A;  3OYH A;  4M77 A;  1X6O A;  1YI2 A;  1A0N B;  1NJI R;  2NUZ A;  3JCM X;  3O8V A;  1YFN A;  4LUD A;  1S72 A;  4M7D B;  4JJC A;  2EQI A;  2KE9 A;  4PJM A;  3CBP A;  3MHX A;  5LJ5 j;  2MF2 A;  3M0Q A;  2LQK A;  2RQW A;  3P8H A;  4PJO B;  3E9F A;  4WF2 A;  1MMG A;  2RJD A;  2GTJ A;  4HT8 A;  2KYB A;  2JN0 A;  3NMZ C;  5CAI A;  1M2O A;  2DL4 A;  3M5A A;  3OYJ A;  3CXC P;  5IHK A;  2DRM A;  5KYW B;  5IT9 E;  1R8O B;  1I81 A;  2J05 A;  1JO8 A;  2YXY A;  1G83 A;  4JPB W;  3OQ5 A;  5GMK e;  1JXO A;  4RCC A;  1K73 R;  2W10 A;  1KHC A;  3HTR A;  5IHN A;  2H3E B;  1NLP C;  2DNU A;  5GAO p;  1TTH B;  3I5R A;  3RES A;  5KCH A;  2RH2 A;  4FW2 A;  3GIB A;  3UAT A;  3G4S A;  4IIO A;  2PVO B;  3SWN A;  1KG1 A;  2CSQ A;  4JUV A;  1JBM A;  2H8H A;  3M9Q A;  3PTA A;  1BCO A;  2MPX C;  2LT4 A;  3TSW A;  4A4K A;  4NS5 A;  4WCI A;  4KUI A;  3QHS A;  4M7D F;  1G3S A;  2QQB A;  4FYY B;  3TEE A;  4JS5 A;  4M78 E;  2XIC A;  1AWJ A;  1PSF A;  2FYK A;  4QQD A;  4CC3 A;  3FRN A;  3OSS C;  5CQY A;  4MML A;  2LCC A;  4D8K A;  2ABL A;  1MHN A;  2DM1 A;  1M4Z A;  1GCP A;  1K76 A;  2LQW A;  2HAX A;  2OJ2 A;  1OQK A;  1NLO C;  3SEM A;  1JJ2 P;  2BUD A;  4JLG A;  2DXT A;  2GQI A;  2DTH A;  2I2L A;  3UA7 A;  2OTJ Q;  3L1A A;  4C8Q B;  3VU3 C;  3PE0 A;  4IUP A;  1NPP A;  1J3T A;  1Q95 G;  5FLX E;  3FC3 A;  2QAS A;  1GL5 A;  1B07 A;  1LVK A;  2X3X D;  4B9W A;  2PUK B;  1MV3 A;  3NPF A;  1MND A;  3VS0 A;  3LX7 A;  2FRW A;  2A3L A;  4XQ3 A;  2K79 A;  2YSQ A;  3CC4 T;  1WLP B;  1MUZ A;  1WXU A;  4EMK C;  3GNG A;  3UA6 A;  1RLQ C;  1VIF A;  3CCL Q;  4F7U G;  1OYX A;  1YJW A;  3PVL A;  1O9S A;  3LH0 A;  1UJY A;  4OF1 A;  4X9D A;  2JVV A;  4M7A A;  2LC4 A;  1VQM T;  2V1R A;  1TUG B;  2DAQ A;  2JJ9 A;  4JLI A;  1OEB A;  1ARK A;  2HQX A;  3RMQ A;  5I21 A;  4Y28 E;  1M30 A;  1MV0 B;  2M16 A;  3QWX X;  4MZT A;  5GAM e;  4OVA A;  1D09 B;  4XTY A;  4XTZ A;  2EYW A;  2LQN A;  2DKG A;  2E70 A;  5KCO A;  3QYH B;  2DD4 A;  5EC7 A;  1KQ2 A;  2CH4 W;  2E6Z A;  3CCM T;  3JAM E;  4FW1 A;  1VQ6 Q;  5LL6 S;  5HKC A;  5EG2 A;  1RAC B;  2OX7 A;  1SRM A;  2DVJ A;  3CXC A;  2V1Q A;  1PCX A;  2MI6 A;  1LPL A;  3HFO A;  3I55 T;  3INZ A;  3G4S T;  4DBR A;  3UWN A;  4KBM B;  4JRK A;  2RHU A;  1WA7 A;  1UB4 A;  3QYG B;  3JCM Q;  2E3I A;  1Q81 U;  2DA9 A;  1VQK A;  3I5S A;  1Q81 R;  4BE2 A;  1JJ2 S;  2FL7 A;  1OPL A;  1WIE A;  4XU3 A;  5GJW B;  2XDP A;  3ER0 A;  4M75 A;  2RQU A;  1I5O B;  3C12 A;  4F16 A;  2ZGW A;  4RUG A;  3THK A;  4DOV A;  4RTU A;  5GAN 8;  4HT9 A;  1PKT A;  1QVF A;  1JU5 C;  3VS6 A;  1IZ6 A;  3M4Y A;  2LVM A;  2BZ8 A;  3A8G B;  2KGT A;  4F7U A;  3A98 A;  4E7J A;  2DER A;  2XID A;  4HVV A;  2GFU A;  2AIR B;  1RAA B;  3NTH A;  1VQ5 T;  1VQN T;  2X9H A;  2Y90 A;  4X1V A;  3V7C A;  1K9A A;  1M90 U;  1Q86 R;  3T9N A;  5L23 A;  1YCY A;  2IIM A;  2KDS A;  5GAO n;  2X51 A;  1JXM A;  2RJE A;  4KRT A;  2EKH A;  3CC2 Q;  5IHI A;  2HL3 A;  3SWN C;  2DBK A;  4M7A D;  1KD1 C;  1WXT A;  3OYL A;  3ZL7 C;  1LCK A;  4OML A;  5LJ5 d;  2X4W A;  4F14 A;  4KUL A;  1UDL A;  4M77 F;  4ME7 A;  1SF9 A;  2DET A;  2D0Q B;  1YHQ A;  1YIJ A;  1VQN A;  2FZC B;  2YHT A;  3Q1J A;  4RG8 A;  3CD6 Q;  2RJF A;  3JB9 F;  3OB9 A;  2C0O A;  1TUD A;  1M3B A;  2RJC A;  4ZN3 A;  4L5G A;  1D3B A;  1VQ5 A;  1TS9 A;  5DLO A;  3JB9 D;  4CC4 B;  1D1A A;  1I5L A;  3BW1 A;  4DQ2 A;  3J7A F;  3J80 E;  1V1C A;  2RD1 A;  3VYH B;  4C92 F;  1QKW A;  5I22 A;  1WHM A;  1Y7X A;  2KT1 A;  2XK0 A;  3PT9 A;  3VS4 A;  1VQO T;  4M7D D;  1OX9 A;  1WDX A;  2BE7 D;  2CT3 A;  2ED1 A;  4ELY C;  4KGZ B;  2D9T A;  3VUB A;  3HKS A;  2C06 A;  1ZX6 A;  2KAF A;  1IRE B;  2ZAE A;  2ZCF B;  2JZ2 A;  4GBQ A;  4JDS A;  1TSF A;  3CMA Q;  2GBQ A;  5GAM h;  3EG3 A;  1VQL A;  2P0Q A;  5GMK l;  1X75 C;  3AHU A;  3CC2 T;  5IH2 A;  4ATO A;  3JB9 H;  4Q5W A;  4C92 A;  2RK1 A;  2J6F A;  1M2V A;  4M77 E;  1VQO A;  5FRN A;  5FW9 A;  1HSQ A;  2F5T X;  2R58 A;  3OBY A;  3JCM d;  1GFD A;  3C0C A;  3EGD A;  3EG9 B;  2CP5 A;  3G4S Q;  1WHK A;  1XOV A;  3HHT B;  1E7O A;  1RLP C;  1X2Q A;  2KK4 A;  2M0O A;  4NL3 A;  3BFM A;  4A4G A;  3MPU B;  4A4H A;  2KSS A;  5HK3 A;  2K2V A;  2O4X A;  3CCS Q;  2XG8 D;  2ZPE B;  5GAN d;  5LJ3 f;  4C5G A;  5GAN 3;  1VQM Q;  2LMJ A;  2CP7 A;  3QDF A;  5LJ5 e;  3RKX A;  4E7L A;  2DFU A;  4L59 A;  3I55 A;  3JB9 J;  4HKE A;  6AT1 B;  1FYN A;  3CPW A;  2M51 A;  1ZHI A;  2LNV A;  4TVR A;  5HY6 A;  4EIK A;  2YUQ A;  1IRX A;  1OZ3 A;  4C92 D;  5KYU A;  2ECZ A;  4DOW A;  4XTW A;  1YJN Q;  2QA4 T;  2E10 A;  3M54 A;  2CGH A;  1VQ4 T;  2RHX A;  2IPO B;  1VQ9 Q;  4M75 C;  3GNF B;  3CC7 Q;  2VXF A;  2FPE A;  2E5K A;  1B34 A;  1SKU B;  4F7U F;  2FO0 A;  2NUT A;  4DBQ A;  1KC8 R;  3UPU A;  1YIT A;  3JCM c;  2OTL A;  2VVK A;  2DYI A;  3MP1 A;  1YNZ A;  1M1K C;  4PJO G;  2OTJ T;  1WQ7 A;  4PJJ A;  1KK7 A;  2DEQ A;  4N0A C;  1UEC A;  3OW2 S;  1D0Y A;  1QKX A;  4GY5 A;  3CCU A;  3S3N A;  2FPD A;  1MMA A;  3SB2 A;  1UG1 A;  5I2M A;  2J7I A;  2CYZ B;  2QDY B;  4D6W A;  5FWB A;  1NYF A;  3X26 B;  3TSZ A;  1OX8 A;  1CSK A;  2HQE A;  2MYS A;  5L8R E;  3KUF A;  2KI7 A;  4M7D E;  1ZUK A;  3URG A;  2KXC A;  3CCL T;  1ABO A;  4J8O A;  1WGS A;  2BZX A;  1RAG B;  3GPL A;  2CKK A;  1G3W A;  1YHQ Q;  5GAM j;  1PWT A;  3GP8 A;  1ZA1 B;  3A8M B;  3MKD A;  2L5Q A;  5GAO m;  5C6S A;  3NFC A;  1KQ1 A;  3OBW A;  1KD1 U;  1LOJ A;  1E6H A;  2A08 A;  4PLL A;  3RMS A;  3JB9 G;  3P8D A;  5J39 A;  1FXX A;  2D1X A;  1Y0M A;  1YWP A;  1UTI A;  1YIJ T;  1V76 A;  2D6F A;  4A63 B;  2HKQ B;  3SHW A;  3LGF A;  2K5L A;  5KE3 A;  2CT4 A;  1Z9Z A;  1RAH B;  3WVD B;  1OOT A;  2LT1 A;  2NWM A;  1VQP T;  2EJG A;  5DY9 A;  4Y91 A;  5CKH A;  3CC7 A;  1PD1 A;  2JTM A;  2R5M A;  4M7A G;  1RL2 A;  2RI5 A;  2AZS A;  2QYZ A;  3OYN A;  5D6Y A;  4MDW A;  1QCN A;  4LUE A;  2DL7 A;  3RBB B;  1PRM C;  2DLP A;  1ZLM A;  3FEO A;  3P8B B;  4L6V 5;  1ZSZ A;  4C8Q E; 
#chains in the Genus database with same CATH homology
 2EQM A;  3M55 A;  3OSV A;  2EWN A;  4LDV A;  2VGN A;  5FLX E;  3PIO A;  3FC3 A;  2DZ9 A;  3L2Z A;  1YJN T;  2JNG A;  5D6X A;  3CPW S;  1BI0 A;  1LJO A;  5LJ3 h;  2CZ6 B;  4B9W A;  2PUK B;  1NJI U;  1S72 T;  4BDZ A;  3TRE A;  3LX7 A;  4XQ3 A;  2A3L A;  2CZ0 B;  5M9O A;  4BI4 A;  3CC4 T;  1YHQ T;  2HD0 A;  1KHI A;  2DO3 A;  3UDC A;  3MP6 A;  4EMK C;  3GNG A;  2MWO A;  1VIF A;  2QXF A;  4N0A A;  4C8Q D;  4F7U G;  1OYX A;  2P0P A;  3NTI A;  3E9G A;  4HCB A;  1GXI E;  3ASK A;  4MZP A;  1XNI A;  3MEV A;  2JUF A;  1YJW A;  5D6W A;  1O9S A;  3LH0 A;  5GAO l;  4X9D A;  4OF1 A;  3CCQ A;  2JVV A;  5FRM A;  2OTJ A;  1OZ2 A;  2FVU A;  4C8Q F;  2QQS A;  2YRV A;  2LC4 A;  1VQM T;  4M7A A;  3DB3 A;  1MGQ A;  2JOY A;  4J7I A;  1N27 A;  3A8O B;  2DAQ A;  2XKO C;  4N4G A;  3M53 A;  4JLI A;  2HQX A;  3S3O A;  1M1K U;  4FU6 A;  3RMQ A;  5I21 A;  3PMT A;  4Y28 E;  3X24 B;  1WJS A;  3RER A;  2M16 A;  4MZT A;  3C95 A;  5GAM e;  4KT0 E;  1K8A C;  4OVA A;  3CD6 T;  3QJ6 A;  2K5I A;  2XDD A;  4M77 C;  1H64 1;  4XTY A;  4XTZ A;  4J6W A;  4EMH A;  2DKG A;  2E70 A;  1I4K 1;  1V29 B;  2L89 A;  3OMG A;  3QYH B;  3VUZ A;  5KCO A;  4RMO A;  3LGL A;  4X9C A;  1FWZ A;  4ELZ C;  3RIR A;  2DD4 A;  3CME A;  1KQ2 A;  5GAN g;  5GAN 2;  2E6Z A;  4N4I A;  3CCM T;  4A53 A;  3JAM E;  1D3B B;  2QQR A;  1NE8 A;  5LL6 S;  2VXE A;  3L2U A;  5GAN 6;  4N4H A;  5AYF A;  5HKC A;  5EG2 A;  3C94 A;  1M1G A;  4EMG A;  3DLM A;  4X34 A;  3L2Q A;  4DOW A;  2BKD N;  3H8Z A;  4LD6 A;  3WVE B;  5CKB A;  3CXC A;  3GF5 A;  5GAM f;  2MI6 A;  3FIF A;  2FB7 A;  4MMK A;  4RKU E;  5GMK j;  3S3M A;  5GAN h;  4C8Q A;  3HFO A;  3QBY A;  4ZGD B;  3CCJ A;  3CCQ T;  3I55 T;  3CMA A;  3INZ A;  3G4S T;  5J26 A;  3UWN A;  2CS7 A;  2EJF A;  4KBM B;  4YTL A;  3OS2 A;  1BI2 A;  1WPY A;  4JRK A;  3UT1 A;  2O4X B;  2RHU A;  4C92 C;  4OB2 B;  3X25 B;  1VQ4 A;  4M7D A;  5CR2 A;  4XTX A;  1UB4 A;  3QYG B;  3EFS A;  4RG2 A;  3JCM Q;  4XU1 A;  2K3Y A;  3R6O A;  2RI3 A;  4J6Y A;  1Q81 C;  1Q81 U;  4BUG A;  1VQK A;  3OY9 A;  4BY6 C;  2DXB A;  4BE2 A;  3JCM J;  2IG0 A;  1JJ2 S;  2FL7 A;  4M7A C;  3CBM A;  1K8A U;  4XU3 A;  2O01 E;  2XU8 A;  4JRP A;  4LDW A;  2XDP A;  3ER0 A;  5CCA A;  4M75 A;  3CCV A;  1Y07 A;  3CCS T;  3QUI A;  4BDY A;  3V8L A;  3C12 A;  4PNO A;  2PUO B;  2ZGW A;  4IUU A;  3OYA A;  2MWP A;  3OYD A;  4R56 A;  2A7Y A;  5LJ5 f;  4DOV A;  4LD9 K;  5GAN 8;  2QEX A;  4HT9 A;  4OB1 B;  4PKC C;  4C8Q G;  1QVF A;  1YJ9 A;  3JCM f;  4FIB A;  2CZ7 B;  2F5K A;  1LNX A;  2R57 A;  3HL8 A;  4E7K A;  2XHC A;  3JCM e;  2LRQ A;  1M1F A;  1IZ6 A;  3M4Y A;  3CEY A;  2LVM A;  4M75 E;  5CVI A;  3A8G B;  4C0D B;  4F7U A;  3I56 A;  5CKE A;  1JRI A;  3QKJ A;  1RI0 A;  2DVE A;  2VUB A;  3LW5 E;  5GMK i;  4E7J A;  2XID A;  4NL2 A;  2GFU A;  3ZBD A;  3J81 E;  3NTH A;  1VQ5 T;  4PJO D;  3HRU A;  2OTL T;  1VQN T;  4BD3 A;  3LYI A;  2Y90 A;  4M7D C;  2PQW A;  4XTV A;  1WNL A;  3V7C A;  4C0F A;  1M90 U;  1M90 C;  4XU0 A;  3T9N A;  1UGS B;  3DB4 A;  1YCY A;  4R55 A;  1KQS S;  4F7U E;  4QVD A;  2KDS A;  5GMK h;  5GAO n;  3QXE B;  3CCU T;  4QVZ A;  1UGP B;  1VQ6 T;  1K73 U;  4J83 A;  2NLU A;  3V8J A;  2RJE A;  5A2Q E;  4M75 B;  1G3T A;  3NTK A;  4OGE A;  4PJO A;  4BE1 A;  4PLI A;  3G71 A;  1W4S A;  3CC4 A;  3VV0 A;  3JB9 I;  2L3R A;  1B34 B;  2RI2 A;  5DLQ E;  4PJO C;  2VYT A;  2OAU A;  2K3X A;  3HPW A;  2P0K A;  3LLR A;  3SWN C;  5C0M A;  2X35 A;  4M75 D;  3OYB A;  4LDX A;  4M7A D;  1KD1 C;  1Q86 U;  2EQJ A;  2QEX T;  1NPR A;  5GAN e;  1Q7Y C;  3MP8 A;  3OYL A;  2DJZ A;  5LJ5 d;  2X4Y A;  3V7R A;  5IAY A;  4M7A B;  2X4W A;  3M4G A;  3OYC A;  4FSX A;  4M78 C;  2E5Q A;  5KE2 A;  5GAN 7;  4KUL A;  3FLG A;  3N5B B;  4M77 F;  4ME7 A;  5GAM g;  2D0Q B;  1AHJ B;  1YHQ A;  4LDU A;  1ZQ1 A;  4JRI A;  3CBO A;  1N6A A;  4EMK B;  4C92 E;  3CCR T;  1YIJ A;  1VQN A;  3OS1 A;  3LWH A;  1YJ9 T;  2YHT A;  3A8L B;  3Q1J A;  1W2B S;  4RG8 A;  5I2S A;  1VQ9 T;  1YI2 T;  2RJF A;  3F70 A;  3I56 T;  3DKM A;  3RUX A;  3JB9 F;  5FU7 B;  3OB9 A;  4OB0 B;  2YLB A;  3QO3 A;  2RJC A;  2V8J A;  4M7A E;  5CQX A;  4ZN3 A;  4L5G A;  1D3B A;  3JRZ A;  1VQ5 A;  1NZ9 A;  3S6W A;  5DLO A;  3JB9 D;  1SSF A;  1U1T A;  1QVF S;  3G71 T;  3V8K A;  4ZTF A;  4A4E A;  3L2W A;  4II1 A;  3EFR A;  1K73 C;  1I5L A;  3PIP A;  2LDM A;  2RA2 A;  3BW1 A;  1M8V A;  3QZ5 B;  3M56 A;  4DQ2 A;  3JCM h;  3J7A F;  3PGG A;  3RKY A;  3J80 E;  2RD1 A;  3VYH B;  4C92 F;  2KVQ G;  2H3J A;  1VQ8 A;  1BYM A;  2G3R A;  1Y7X A;  2QI2 A;  1Y96 B;  2XK0 A;  3PT9 A;  3JCM W;  1VQO T;  2XDB A;  4M7D D;  5FRO A;  5FU6 C;  4JJN K;  1HXD A;  4IUT A;  3QDR B;  2P4T A;  3OYK A;  4ELY C;  3OYG A;  5A0D A;  4QQ6 A;  3QPH A;  1P92 A;  2ZPF B;  1XTD A;  1G3Y A;  2D9T A;  3BDU A;  4IUQ A;  1U8R A;  5HK0 A;  2EIF A;  2EKO A;  2K5F A;  3HKS A;  3HRT A;  3VUB A;  2C06 A;  2V8I A;  2KAF A;  4XU2 A;  1IRE B;  2WAC A;  3CCJ T;  1KC8 U;  3L2V A;  5GAN f;  2RHZ A;  2ZCF B;  3TCJ A;  2LX9 A;  2JZ2 A;  4JDS A;  3DLL A;  5GAN 5;  3BY7 A;  4CI0 C;  4M77 D;  1UEB A;  5GAM h;  4ZGE B;  2M9U A;  4HCZ A;  2DZC A;  2RK2 A;  3V7S A;  1VQL A;  3OMC A;  1N9S A;  2EAY A;  4M78 B;  4C5E A;  2KQW A;  2P0Q A;  3E19 A;  2K4Y A;  1FX7 A;  2K57 A;  5GMK l;  4C0D C;  4C92 B;  2DPP B;  1X75 C;  3AHU A;  3CC2 T;  4JRQ A;  2RHI A;  1YBY A;  3MEU A;  4RCB A;  3CXC S;  4BI8 B;  4ATO A;  1BIB A;  5LJ3 e;  3JB9 H;  3G6E T;  4Q5W A;  2EJ9 A;  4C92 A;  4E7I A;  2ZPB B;  2RK1 A;  2FHD A;  4M77 G;  2KY9 A;  4QW2 A;  5A0L A;  2DXU A;  5GMK m;  4M77 E;  2WSE E;  1VIE A;  3OYF A;  2EQK A;  1VQO A;  1OI1 A;  3LWI A;  5FRN A;  2ZPI B;  5IN1 A;  2LQ8 A;  2F5T X;  2R58 A;  2VGM A;  3OBY A;  3JCM d;  3TU4 K;  1YJW T;  2DIQ A;  2RB6 A;  2L8D A;  3JCM b;  2VC8 A;  3QSU A;  3G7Z A;  2VV5 A;  4VUB A;  1K9M U;  1K9M C;  2E64 A;  4BI3 A;  5CKF A;  1Y96 A;  3MEW A;  1X01 A;  2CZ1 B;  3X20 B;  2EQU A;  2JTF A;  1XOV A;  3HHT B;  3SWN B;  1WJQ A;  1BKB A;  3OYY A;  2ZPG B;  4PJO F;  2QQ9 A;  3KBG A;  1BI1 A;  4LDY A;  2DXC A;  3ZEH A;  3X28 B;  3MET A;  5LJ5 h;  2XI9 A;  4UC4 A;  2GQV A;  2KK4 A;  2M0O A;  3A8H B;  3FDR A;  5J3B A;  1I8F A;  4C0G A;  2DK3 A;  5GAO r;  4FM4 B;  3MCA B;  5GAN j;  4M78 G;  3BFM A;  4NL3 A;  3WXM B;  4A4G A;  2E41 A;  3JCM g;  1Y71 A;  3HFN A;  2KSS A;  3JCM V;  4A4H A;  4C92 G;  1Q82 U;  2EFI A;  1Q82 C;  5HK3 A;  2K2V A;  3M57 A;  5LJ3 g;  2O4X A;  2XG8 D;  5CIU A;  2ZPE B;  4FT4 A;  5A0G A;  5GAN d;  3CCE A;  3CC7 T;  3CCM A;  5LJ3 f;  3MEA A;  3SDZ A;  4C5G A;  2QQA A;  5GAN 3;  4XK8 E;  4QQG A;  3HSB A;  1PSE A;  5FU6 B;  5LJ5 e;  1M9S A;  2X4X A;  4M78 A;  3RKX A;  4L59 A;  2QA4 A;  4E7L A;  3EAE A;  3I55 A;  3JB9 J;  4HKE A;  3CPW A;  2F69 A;  1ZHI A;  4XAX B;  5GAM d;  2E12 A;  4CRI A;  3QII A;  1O75 A;  2E1H A;  2LNV A;  4TVR A;  5HY6 A;  4EPC A;  4F7U B;  3CC2 A;  1VUB A;  4BY6 B;  2EYQ A;  5KH6 A;  5LJ3 j;  2KMT A;  3MO8 A;  1UGR B;  1WQW A;  1OZ3 A;  2E6N A;  4QVC A;  4BE0 A;  1WJR A;  4C92 D;  1YJN A;  3H6Z A;  2R5A A;  3QJY A;  4M78 D;  2RHY A;  3RKW A;  2ZPH B;  4XTW A;  3PMI A;  5LJ3 d;  3CCE T;  2XD0 A;  1N9R A;  1BI3 A;  4MZM A;  4M77 B;  4HCC A;  3KXT A;  3CMA T;  2ZZD A;  2QA4 T;  3QG1 A;  2E10 A;  2GFA A;  2IVW A;  2CGH A;  3M54 A;  1VQ4 T;  5GAN 4;  2RHX A;  2MMP A;  4M75 C;  1DJ7 B;  5LJ5 g;  3L42 A;  3GNF B;  3OYH A;  4M77 A;  3CCV T;  3JSC A;  4NOY A;  1NJI C;  2Y4Y A;  1X6O A;  1YI2 A;  1VQ9 A;  2VXF A;  2DTI A;  4FT2 A;  1QVG A;  4OMF B;  3JCM X;  3O8V A;  1B34 A;  3OYE A;  1QW1 A;  4F7U F;  3C4S A;  4JS4 A;  3A5Z B;  1S72 A;  3CCS A;  4O6J A;  1HK9 A;  4M7D B;  1G5V A;  3UPU A;  4BB7 A;  3JCM P;  3CBP A;  3MHX A;  5LJ5 j;  2MF2 A;  2X4J A;  4C5H A;  1YIT A;  3JCM c;  2LQK A;  2OTL A;  3FB9 A;  2B8A A;  1JB0 E;  3OS5 A;  3P8H A;  4E7H A;  4PJO B;  3E9F A;  2GF7 A;  3MP1 A;  4PL6 A;  4WF2 A;  2RJD A;  2M1H A;  4ZN1 A;  1M1K C;  4HT8 A;  4PJO G;  4EMK A;  2JN0 A;  5CAI A;  1WQ7 A;  3M5A A;  4OGC A;  3OYJ A;  2OTJ T;  4PJO E;  3BDL A;  2DEQ A;  4N0A C;  5IT9 E;  1R8O B;  1I81 A;  3OW2 S;  3M59 A;  4GY5 A;  3M58 A;  5FU7 C;  4XTU A;  4C5I A;  3CCL A;  1H3Z A;  2Y4X A;  3CCU A;  3S3N A;  1VQ6 A;  4OB3 B;  1VQL T;  3SB2 A;  3OQ5 A;  5GMK e;  1YIT T;  4RCC A;  4C8Q C;  5I2M A;  3HP9 A;  3CPF A;  2CYZ B;  2QDY B;  1Q86 C;  4D6W A;  1N8R U;  4A4F A;  1QP3 A;  1KHC A;  3X26 B;  1M5Q 1;  4E47 A;  3G6E A;  2HQE A;  3SFM A;  5GAO p;  2DTO A;  5L8R E;  2HBP A;  3RES A;  4B9X A;  2DIG A;  2RH2 A;  3KUF A;  5KCH A;  4M7D E;  4C0Z A;  3GIB A;  3URG A;  4M7D G;  3CCL T;  1JJ2 A;  3G4S A;  4J8O A;  2DD5 A;  1WGS A;  3PNW C;  3GOX A;  4IKF A;  2PVO B;  2MAM A;  3SWN A;  3GPL A;  2CKK A;  4HA8 A;  4OP0 A;  1KG1 A;  1G3W A;  1U1S A;  1VQ7 T;  5GAM j;  4JUV A;  4O5V A;  1BIA A;  4J7F A;  3FJP A;  3GP8 A;  1JBM A;  3A8M B;  3CCR A;  2L5Q A;  5GAO m;  5C6S A;  5CK9 A;  2LCL A;  4MDX A;  3OYM A;  5DM7 R;  5CKD A;  3OA6 A;  3NFC A;  1KQ1 A;  4ZTJ A;  2E65 A;  3M9Q A;  2V8K A;  3OBW A;  1KD1 U;  1LOJ A;  4PLL A;  3RMS A;  3PTA A;  3JB9 G;  1VQK T;  3P8D A;  1Q7Y U;  4A54 A;  1TH7 A;  3OW2 A;  2LT4 A;  5J39 A;  4V2S A;  1VQP A;  1FXX A;  3VYG A;  4A4K A;  4NS5 A;  2D6F A;  1YIJ T;  2WSC E;  1W2B A;  4J6X A;  4KUI A;  3QHS A;  4M7D F;  2PVG B;  3L2R A;  1VQ7 A;  1G3S A;  2QQB A;  3TEE A;  3VJP A;  4IUV A;  4ZGJ B;  1UGQ B;  4JS5 A;  3LGF A;  2K5L A;  2YLC A;  4M78 E;  2XIC A;  2WSF E;  1PSF A;  2AHJ B;  2FYK A;  5KE3 A;  4QQD A;  1ZBX A;  3FRN A;  3OSS C;  5CQY A;  4MML A;  2LCC A;  2PVD B;  4P5N A;  3WVD B;  2GCX A;  2RO0 A;  1QP2 A;  1MHN A;  3QZ9 B;  2LT1 A;  3VKI A;  2HNI A;  4Z02 A;  4M75 F;  1QVG S;  1M4Z A;  1VQP T;  2EJG A;  5DY9 A;  4Y91 A;  4DA4 A;  5CKH A;  1EIF A;  3E1S A;  2BIV A;  4GLK A;  3CC7 A;  2HAX A;  3ME9 A;  2JTM A;  4M75 G;  2R5M A;  5GAO q;  5CO7 A;  4BAC A;  1RL2 A;  2RI5 A;  4J5Y A;  1VQ8 T;  4M7A G;  4EDU A;  3CD6 A;  1N8R C;  2BUD A;  2LTO A;  1VQM A;  2PU9 B;  2RM4 A;  4JLG A;  3OYN A;  4FL6 A;  2DXT A;  5D6Y A;  3HRS A;  2DTH A;  4MDW A;  3SD4 A;  4M7A F;  2QTX A;  3OYI A;  2I2L A;  3CME T;  4M78 F;  4KUD K;  3L1A A;  3GLX A;  4C8Q B;  1QVP A;  3VU3 C;  3PFS A;  3FEO A;  3P8B B;  1KC8 C;  3OS0 A;  3ZFJ A;  1KQS A;  1XQH A;  4IUP A;  4L6V 5;  4IUR A;  1NPP A;  4C8Q E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...