2JNGA

Solution structure of the cul7-cph domain from homo sapiens; northeast structural genomics consortium target ht1.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
MRSEFASGNTYALYVRDTLQPGMRVRMLDDYEEISAGDEGEFRQSNNGVPPVQVFWESTGRTYWVHWHMLEILGFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Conserved CPH Domains of Cul7 and PARC Are Protein-Protein Interaction Modules That Bind the Tetramerization Domain of p53
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords Cullin-7
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11515 Cul7 Mouse development and cellular proliferation protein Cullin-7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2jngA00
2MI6A 3I55T 1VQLA 1M1GA 3CCSA 4YTLA 1IZ6A 1YJNA 1YBYA 3CCRA 1YI2A 3CCLT 1QVFS 3CCJA 3OYYA 1NJIC 3CD6A 1VQ8T 3CCVA 2CKKA 3CC4A 1KC8C 3CCVT 1NZ9A 2QA4A 3J7AF 2JOYA 1JJ2S 2QEXA 1K9MC 1YI2T 1KD1U 1YITT 3ER0A 1Q82U 1KQSS 3CXCS 3CMEA 1VQPA 2OTLA 2OTJT 2G3RA 2XHCA 3LGFA 3G71A 2OTLT 3CPWA 1QVGS 1VQOT 5J26A 1Q81U 3CCLA 3CC2A 3CCJT 1M1KU 1M90U 1KC8U 5DLQE 1VQNT 3DB3A 5HY6A 3CCST 1KHIA 3CCUT 3A5ZB 3G4SA 3DB4A 1Q82C 2KDSA 1N8RC 3CCMT 3CC4T 2JUFA 1VQ4T 3CCEA 1VQ9A 1BKBA 2E6ZA 3CMET 1VQPT 1VQKA 1K8AU 3HKSA 3DLLA 1W2BS 1M90C 3CC7T 1NJIU 3KBGA 4QQDA 1KQSA 3CXCA 3I56T 1VQMT 1NPRA 1YHQT 1VQOA 2IG0A 1VQ5T 1YJ9A 1YIJT 1N8RU 5LL6S 3G71T 3OW2S 2QEXT 3LH0A 1QVFA 1SSFA 1K8AC 3CCET 1K73C 1X6OA 3I56A 1YJWA 2OTJA 1Q7YC 1Q86U 1VQ5A 1YJWT 2L3RA 2MWOA 1EIFA 3CMAA 3CPFA 3J80E 1YITA 5IAYA 4TVRA 1VQ7T 3CCMA 5IT9E 2LVMA 1YJ9T 1VQ7A 1UEBA 1VQKT 4RG2A 3G4ST 1K73U 1JJ2A 5FLXE 1VQNA 3CD6T 1S72T 3CCUA 3CC2T 3TREA 1XTDA 2LQ8A 2EIFA 3CPWS 3CMAT 1VQ4A 1VQ8A 1VQ6A 3JAME 4X34A 3P8BB 3CCRT 4ZN1A 3G6ET 3OW2A 5J3BA 2DO3A 1VQ9T 3G6EA 1K9MU 3J81E 3CCQA 1KD1C 1Q7YU 1S72A 1Q86C 5DM7R 2KVQG 1YJNT 1QVGA 3LGLA 1Q81C 2JVVA 3CC7A 3PIOA 1VQ6T 1M1KC 4CRIA 3I55A 3CCQT 1VQLT 1YIJA 2MWPA 1XNIA 2JNGA 2E70A 1VQMA 1YHQA 2QA4T 1W2BA 1RL2A 3PIPA 2LCLA 1NPPA 5A2QE 4ZN3A
chains in the Genus database with same CATH superfamily
1IGQA 3ZBDA 5GANd 1SRLA 1IZ6A 1TUGB 1PRMC 5D6WA 1HK9A 5CIUA 2D0NA 3X24B 4C92C 1G2BA 1WGSA 2CKKA 2XDPA 4M75G 1RI9A 1NLOC 2OTLA 3G71A 2E3HA 3SWNA 3INZA 3M54A 2QQ9A 3CQTA 2O4XB 1QLYA 1EFNA 2X3WD 3OYAA 1ZSZA 1B34A 1D1BA 1QWFA 3A5ZB 4IKFA 1RAFB 3H6ZA 3CPWP 2NUZA 2HL5C 1R8OB 5LJ5g 1KD1R 1VQPT 4XTWA 4FT4A 4FYYB 1OULA 3KBGA 1QKWA 4ANJA 2EKHA 1VQOA 2YHTA 2CYZB 1UG1A 2M02A 3M55A 3OYKA 1I4K1 1K8AC 2RI5A 4OGEA 1X6OA 4C8QC 2LDMA 2QK0A 4AFQC 1Q86U 2RD1A 3JV3A 2QYZA 1EX4A 3CCJQ 2EYQA 4J9GA 5DLOA 3JB9J 2FYKA 1YJ9T 1YNZA 3M53A 2LNVA 2LT4A 1CKBA 3WVEB 5FLXE 7AT1B 1OV3A 4M77B 4IUVA 2W0ZA 3BDLA 1WJSA 4XU2A 5I11A 9ATCB 2DYIA 4PJMA 3M0QA 3OYHA 4M75D 2X4WA 2CDTA 1K9MU 2CP3A 5LJ3g 3RMSA 2EPDA 4PK4A 2LP5A 4BY6C 3LX7A 1XNIA 5KYYA 1LPLA 2QA4T 2LCLA 3RIRA 3HRUA 1Y07A 2CH4W 5M9OA 2LZ6B 5A2QE 1X43A 2FRWA 1I5OB 2A08A 2QQBA 2PTKA 4OMPA 4AT1B 1VQ8T 1ABQA 1ACMB 2CZ6B 4EPCA 5GAOm 4ORZA 3CXCS 2A36A 1GCQA 4C92G 3FJ5A 2JW4A 3OS0A 1KC8U 2J7IA 2MYSA 1ZSZC 4RTUA 2GGRA 1OEBA 3OMCA 4M77G 2RHUA 3OYCA 2YUQA 1K8AU 4KGVB 5KYXA 1VYTA 5GJVB 2RJDA 4PJLA 2SRCA 3HRTA 3C12A 3S3NA 2IG0A 1AZGB 1YJ9A 3VS1A 2K5LA 4X1VA 2NUTA 2RPNA 2HQHA 2YWWA 3A8OB 5GAMe 5GANh 2CP5A 4RTWA 4XTVA 4PLLA 5LJ5f 2DLPA 1VQ7A 1PNJA 4OB2B 3LWHA 1WQ7A 4JJBA 3VYGA 3CC7Q 2MAMA 1W4SA 1YWOA 1D1CA 1UHCA 4X34A 4KH0B 4OF1A 1WJQA 2GFUA 1RABB 2J6OA 5GANf 2K79A 1WHKA 2BE7D 1UGVA 1S72A 5HK0A 3LW5E 2KVQG 2XICA 4Q5WA 4KH1B 1Y7XA 5KYYB 2RI2A 2NLUA 3JCMQ 3C95A 3META 3BFMA 1Y0MA 2EWNA 3VUZA 4JDSA 5CAIA 2MI6A 2O9SA 2BZYA 1W70A 2YLBA 3QBYA 2VUBA 3URGA 3CCRA 3JCMP 3D7SB 1YI2A 3OYLA 1IHVA 1QP3A 2EQJA 3CCVA 1KC8C 1NZ9A 2JOYA 3EG9B 3CXCP 2CREA 1KQSP 3QDRB 4BE1A 4IUTA 1ZUUA 3OS1A 2G3RA 5GAN7 2EQKA 2RK2A 3MCAB 2DX1A 4XAXB 3V7SA 4ZNXA 1WZOA 4XTUA 3PFSA 1TU0B 2CS7A 3WVDB 3CCEQ 3M0PA 1ZUKA 1M27C 1N8RC 3JCMJ 3GPLA 3M0TA 1VQNQ 5J39A 5IN1A 3HKSA 2DIGA 2OI3A 4N4GA 1HJDA 1MMDA 4PKCC 2RJCA 1NJIU 3NMZC 1RACB 2MF2A 1AEYA 2VWFA 3L2WA 1I8FA 1M8VA 1UFFA 1NEBA 2KMTA 4Z8AA 3V7RA 2VGMA 3CCET 3I56A 3EFRA 4QVDA 2HQXA 4FT2A 1YCSB 5IAYA 2ZZDA 4C8QB 5IT9E 1HSQA 2DTIA 2QQRA 2ECZA 3A8HB 4J8OA 2XU8A 3MO8A 3JCMf 2QI2A 3JB9I 2DBKA 3M0SA 3G6EA 2JTFA 2OX7A 3OMGA 3OYMA 4E7JA 2AKLA 1YITQ 3SWNB 3T9NA 4C0GA 2RO0A 1ZSGA 1W2BA 3NTIA 1RL2A 1VYUA 2JN0A 1RAEB 1NPPA 1M2OA 1VQLA 1VQOQ 3EFOA 4E6RA 1NJIC 3EG3A 2CT4A 2WSEE 3MP8A 1PG5B 3GOXA 1D3BA 2M1HA 2DD5A 2O31A 1RAHB 1RADB 3L42A 3Q1JA 1WFWA 2OTLT 2V1QA 4BACA 3PVLA 2DNUA 5I2SA 2JS0A 2BTTA 4RG8A 1MNDA 1Q82C 2KDSA 1YFNA 3CCEA 3CMET 3UPUA 1M90C 1S1NA 4EMKA 3WXMB 4QQDA 1SKUB 2CUBA 1M3CA 3OW2S 4PFOA 1LJOA 1K73C 3ME9A 4RTXA 3QO3A 4ZGJB 2EQMA 3CCRQ 1NG2A 4AG2C 2HL3A 4FW2A 4FYXB 3M0RA 2RHYA 4A4HA 2LVMA 1CKAA 3EAEA 1G3TA 1GFCA 3TQ7P 2DKGA 2BIVA 2SEMA 4HCCA 4E7KA 1KK7A 1T0HA 2EFIA 4XU0A 4M78A 5C6SA 1B3QA 1YCYA 4M77E 1VQ4A 3JB9H 3REBB 5GJWB 1QVFP 2EYYA 3VS6A 3CCRT 1T0JA 1GL5A 3L2QA 4Z02A 3QZ5B 1R0BG 2RJEA 1VQ9T 1UJYA 1WHHA 2DBMA 4B6MA 1OI1A 1U1SA 4EMGA 4M4ZA 5CO7A 3X20B 2C0TA 4J9BA 2HSPA 2ESWA 4Y92A 1K8AR 1Q81C 1X75C 1YIJA 2ABLA 4AFUC 4FIBA 2JNGA 3SEMA 2O01E 4PNOA 2NYSA 1F1BB 1U3OA 4M77A 2ZPEB 1VQ9Q 1M1GA 4C8QF 1YBYA 8AT1B 4J7IA 4F7UA 1UGSB 1ZHIA 3OYYA 1VIFA 1I5LA 4NOYA 5I2MA 4PFZA 1KQ1A 2P4TA 3E19A 1K9MC 2DEUA 4KUDK 2JT4A 1YN8A 1D09B 5GAN4 4M7DF 1QVGS 1GBQA 1VQOT 3OA6A 2DFUA 1TG0A 2LC4A 3CCJT 2DEQA 1KG1A 2J6FA 2GF7A 5A0DA 2YRVA 2MCNA 1WX6A 2L5QA 5DY9A 2D1XA 3MEWA 4B9WA 2JUFA 4EMKB 3FJPA 4BY6B 1OQKA 1R77A 2KSSA 2OTJQ 2RK1A 3CCVQ 4FSXA 1QP2A 1WLPB 2CSQA 5CR2A 1QMCA 3QWYA 2KYBA 1SHFA 3OYDA 3LH5A 4PJOA 1NLPC 4QQ6A 3LH0A 1TS9A 4M78E 3OYIA 2X35A 5KYWB 2DIQA 2EGEA 4QT7A 2ZPHB 4F04B 2I2LA 4B9XA 3J80E 1YITA 4K11A 1BBZA 4LUEA 5CK9A 1VQMQ 4MMLA 3QYHB 4FYVB 1JJ2A 4M78B 4OMLA 1YP5A 3H0IA 1W1FA 4D6WA 4BE2A 3CCLQ 1PSEA 2A3LA 1RAIB 2P84A 1FWZA 2HBPA 2QTVA 4LNPA 4QW2A 1D0XA 5L8RE 2R5MA 2QGGA 3VU3C 5ECAA 4M75F 1VQ5Q 3MEVA 2DVEA 1ZLMA 2F2VA 4J6XA 3S3MA 4CC4B 4DA4A 1VQKQ 2PVOB 2BE9B 2K9GA 2JTMA 2KROA 3PIPA 4P5NA 5A0LA 2RB6A 4PJNA 1BIBA 3CCLT 2L3SA 4ZGDB 1JO8A 4C8QD 3OW2P 5GMKl 1G8XA 3QWXX 4JPBW 2ZPFB 3KFVA 3LGFA 4KUIA 1X2KA 1O9SA 2PVGB 4JJNK 5LJ3e 3UWNA 1U8RA 1H3HA 1TTHB 3BY7A 1PWTA 4XTXA 2DJQA 2QGFB 1N5ZA 2EJ9A 3FIFA 5GAMj 3E9FA 3H9NA 4F14A 1NPRA 3V7CA 4D8DA 3QPHA 2QEXT 2KYMA 3ZEHA 1BYMA 3QHSA 5IXBA 1G3YA 1FMVA 4C0DC 2F5TX 3G6EQ 4E7HA 4A54A 1O75A 1NYGA 1JRIA 1WHJA 4XQ3A 2YRDA 2LCCA 1TUDA 2IIMA 3JCMe 2DXTA 1WA7A 4HKEA 2V8IA 4M7AA 1AWOA 3JB9F 2Y4XA 4AMCA 3MP1A 3BE3A 2YUOA 4LE9A 2EAYA 2JMCA 4IIOA 4F7UG 1Q86C 1DJ7B 1OZ3A 5DM7R 1JQQA 1QWEA 1S72Q 2LQKA 5LJ3j 3HL8A 1A0NB 4JRKA 1HD3A 3JSCA 3BDUA 1NE8A 1GCPA 4J9CA 1KC8R 1X69A 4ME7A 3CCSA 4IIMA 4C5HA 2BZ8A 1W6XA 1R0CB 2EYXA 3CCUQ 3LLRA 2VV5A 4C0DB 3V8JA 1PKSA 2ROLA 2HKQB 1QCFA 1YI2T 8ATCB 1Q82U 2KRNA 4A63B 3CBMA 1ZA1B 3SWNC 1XJWB 1ZA2B 1PHTA 4DEYA 1M90U 3SFMA 5CKDA 3CC4Q 1OU8A 1VQ8Q 1GXIE 2O4XA 4M75B 1WDXA 1X2QA 1RLQC 1WXTA 1BKBA 2E4HA 1W2BS 4FU6A 1RAAB 2HNIA 4N4HA 2GQVA 5KYUB 3VS2A 1KQSA 3LYIA 5LJ3h 3QZ9B 1XQHA 3HFNA 2QDLA 5GAMg 1WYXA 2RN8A 3GLXA 3SD4A 3GP8A 1WHLA 4JJDA 1VQ7T 4BI4A 2X3XD 1VQLQ 1Y57A 1FYNA 1VQKT 2F69A 1K73U 2YSQA 1X6BA 4BB7A 4BI3A 1XOVA 4M7AB 3CD6T 2PUOB 2KGTA 2LNHB 2RMOA 5AT1B 1AVZC 2FEIA 1I1JA 2QDYB 3TSZA 1WI7A 2L0AA 2XI9A 1LVKA 3QJ6A 2AK5A 3KXTA 3X28B 4OVAA 2KT1A 2V8KA 4FW1A 4EMKC 3IQLA 2ZPGB 1Q81R 1RLPC 2F1LA 2YUNA 2Y4YA 4MZMA 3CC2Q 1VQLT 3CCQT 4DOWA 2DZCA 3JCMg 4RCBA 5GMKh 2X9HA 2DF6A 4PJOG 1M1KR 5IHNA 3PMTA 3U23A 4M78D 1D3BB 3MHXA 2LTOA 2RHZA 1KQ2A 1H641 3FLGA 2QEXA 2JM8A 2JXBA 2DMOA 2OTJT 4GLMA 2ED0A 5D6YA 1Y96B 2XMFA 5KYWA 2PVDB 3OYBA 1WHMA 4F17A 2G6FX 2LJ1A 2EGAA 5GAOl 2DXBA 1M30A 2FHDA 2KK4A 1RI0A 4LUDA 2X51A 4AFZC 5LJ3d 4A4KA 1IHWA 2WSCE 2GNCA 2PNIA 3JCMh 1ZBXA 1PRLC 3DLLA 1VYVA 1G3SA 4X9CA 5FROA 3CBOA 3VS3A 2X4XA 1M5Q1 1MMGA 1J3TA 3HRSA 4A4FA 4Z89A 2DXUA 2DTHA 5LJ5h 4L6V5 1YIJQ 2J6KA 1HYOA 3RNJA 3QG1A 3OB9A 2Y90A 2KAFA 2K7AA 1MMAA 1BI3A 4TVRA 2LRQA 1YHQQ 4OGCA 1WXUA 2DYBA 1UE9A 2H8HA 4O5VA 5GMKj 2RA2A 3CC2T 2HEQA 4RUGA 4RTYA 2EIFA 4MDXA 3JCMd 4M78G 2RQRA 1SPKA 3AT1B 1ABOA 2WACA 2OJ2A 2E10A 1KHCA 3R6OA 4M7DC 2CP2A 1B07A 5CKBA 1YJNT 5GANg 2LT1A 1V29B 2M9UA 3OYGA 1PC0A 3MP6A 4UC4A 1SRMA 4F7UB 1VQ7Q 4IUPA 2YT6A 2DA9A 1K9MR 2HD0A 2C06A 5KCHA 2VXEA 1H3ZA 1OU9A 2K5IA 3A8MB 1VOMA 2QG9B 3O8VA 2JM9A 1PD0A 2DM1A 3OBYA 3OSVA 1MUZA 2D6FA 3MEAA 4J7FA 3CBPA 3G4SA 3JCMc 2E41A 1VQKA 1WPYA 2D8JA 1NEGA 2NUTB 2A7YA 1BU1A 2L3QA 5GAMd 1YI2Q 1YIJT 2K3YA 3M5AA 5FU6B 2CZ1B 2R5AA 4OMNA 1D0ZA 3EG2A 1YJWT 1EIFA 2GFAA 3THKA 2DE0X 3M4YA 1LOJA 3CCMA 2D0QB 4VUBA 1QVGP 4HT9A 3JRZA 5CQYA 2RI3A 4C5EA 2QEXQ 4C92A 1M2VB 2PUKB 2D8HA 3G4SQ 2DRKA 1QCOA 3CMAT 4C8QE 1TUCA 1VQ6A 3M9QA 1B7TA 3VKIA 3MKDA 3UT1A 3J81E 3L1AA 1KD1C 1I07A 2VGNA 2AHJB 4OB0B 4PLIA 5LJ5e 4QKUA 1JJ2P 3H8ZA 2VASA 3H41A 1MHNA 4NS5A 1OPLA 2DL4A 4FM4B 1Q86R 3HTRA 1D1AA 3HFOA 1IRXA 4J9EA 4KRTA 1Q7YR 3CCMQ 4C0ZA 3M56A 2L8DA 3EHQA 1QVFS 3CCJA 2A28A 5GANe 3CD6A 5HKCA 3CCVT 1ARKA 2CP0A 3J7AF 2MPXC 1JJ2S 2XKOC 1UHFA 3A8LB 1KQSS 3PTAA 1VQPA 1WJRA 1H92A 2I0NA 1K73R 2ATCB 2GQIA 3EHRA 3DB4A 1ZSZB 4M7DB 5GAMh 1VQ4T 3TEEA 1BCMA 1FMWA 2KRSA 1BCOA 4FCYA 3KUFA 2NUPB 1M1FA 2CP7A 3HHTB 1YHQT 2XDBA 2NWMA 3GNFB 1I0CA 3VUBA 3I35A 4ZTFA 1QVFA 1SSFA 1VUBA 4KT0E 4C0FA 1YJWA 2OTJA 1K76A 2DILA 2L3RA 2JMAA 1HXDA 1BK2A 3NTHA 2QASA 2GTOA 2AKKA 4R0KA 4OB3B 1U06A 2KXDA 1NM7A 4HVWA 4CC7A 1QVPA 1UEBA 4M7AE 2M0OA 4RG2A 2QTXA 4LD6A 1QKXA 4M7AD 1AD5A 5C0MA 1N9SA 1MMNA 2EVRA 4QQGA 3CCUA 1ZQ1A 4RTTA 6AT1B 2GCXA 3CPWS 1AHJB 3RDVA 1UUEA 3QYGB 2EYZA 3HP9A 3P8BB 5KE2A 1K4US 3ZFJA 1G3WA 2DO3A 2HZYA 3PE0A 2EKOA 2K2MA 3VS5A 3S3OA 2E3IA 1IB8A 2RQVA 1WXBA 1Q82R 1B34B 1YHQA 3EG0A 2LJ3A 2O2OA 2FL7A 2KY9A 4MDWA 3FEOA 5KE3A 4IUUA 1N8RR 5FWCA 5FU7B 4GBQA 3X25B 2A0FB 4KGZB 3GBQA 3CC4A 1PSFA 5L23A 3CCQQ 1AWWA 3QIIA 3OYNA 4LXCA 4LDUA 3A1PA 1LNXA 3OYJA 1JEGA 2W10A 4R56A 3CCST 4N0AC 3UA6A 5GMKm 3P8DA 4CC2A 1M3BA 2CH4A 4J6YA 1KHIA 2BZXA 3GIBA 3V8LA 2F2XA 3EGDB 3CC4T 2NUPA 4M7AG 2DETA 3JCMW 3CD6Q 2EQUA 2CGHA 4MZPA 2HDAA 2RQUA 4JUVA 4JZ4A 3G71T 2KBTA 4PJOC 3QSUA 2A37A 3REAB 3HPWA 1Q7YC 1T3SA 2QXFA 4DOVA 2CT3A 4CI0C 1U5SA 1BB9A 1E6HA 2CSIA 4PJOF 4XK8E 3TU4K 1K0XA 3EG1A 1FMKA 2EJGA 1OPKA 4E2FB 3BW1A 4XU3A 3CMEQ 1VQNA 2MMPA 1S72T 2E1HA 1Y71A 4KBMB 5A0GA 2J06A 5CKEA 1VQ8A 1YWPA 2V1RA 2V26A 1JXOA 4OMMA 5J3BA 4RTZA 1N9RA 1BIAA 3G7ZA 3TVTA 3QUIA 4WF2A 1JU5C 2LQNA 2R58A 2JVVA 2FVUA 1M1KC 2EYWA 3I55A 3FRNA 5IXFA 5GAN5 5IHKA 2P0QA 4C92F 3EGXA 1M8MA 2E5QA 3EGUA 4ZN3A 2RJFA 4M77F 3JCMX 3E1SA 2K5FA 3OS2A 2JZ2A 4F7UE 2AZVA 2COWA 2PU9B 3UATA 2LX9A 4QVCA 3PVQA 1AOJA 2XIDA 4O6JA 3MPUB 1UB4A 2FZKB 4HVVA 1QW1A 3C94A 1UGRB 2OAWA 1C6VX 4DEXA 4C8QG 1TSFA 2VB6A 3EGDA 3DB3A 5DLQE 3JCMV 3FC3A 4J83A 3LWIA 1OOTA 4ELZC 3VS7A 4CC3A 1IO6A 2VVKA 4EIKA 3DKMA 2PZ1A 5GAN3 2ENMA 4FSSA 4AFSC 2COZA 1VQ6Q 1MNEA 2DD4A 3SHWA 1JXMA 3PNWC 2HQEA 2KNBB 2YRCA 4X9DA 3NPFA 4RMOA 3CXCA 2O9VA 5GAMf 2DL3A 2X4YA 3E9GA 3JB9D 2K4YA 4JRPA 1D0YA 1M9SA 4HCZA 5GAOn 2C0OA 2EJFA 2WSFE 2XDDA 3EH1A 3VV0A 2QAZA 1Q95G 2HKNA 2C0IA 2LCSA 3VS4A 1UDLA 5GAOr 5AYFA 3PGGA 1G83A 4RTVA 4ZGEB 3MEUA 3M0UA 1E7OA 2DJZA 4ZN1A 2ED1A 4IUQA 3OW2A 1X27A 4LDYA 2RHIA 2CZ0B 3CEYA 1QVGA 4V2SA 4RCCA 3EGXB 3CC7A 1VQ6T 4CRIA 4OP0A 2KEAA 4F16A 2K2VA 2GTJA 4HXJA 2P0PA 3MJXA 4M77C 4M7DA 2RNAA 1PM3A 1LCKA 1VQ4Q 4YTLA 4BI8B 1JBMA 2DL7A 3UA7A 3CMAQ 4E7ZA 2VYTA 3EFOB 2QA4A 3VJPA 2FPFA 1UGPB 1KD1U 2DL8A 1Z9QA 3CMEA 2RHXA 1NYFA 2XHCA 4J5YA 5GAOq 3CCLA 3CC2A 3TSWA 2H3EB 4E7LA 1VQNT 3PT9A 4M7DE 1JB0E 2AZSA 1TXQA 1V1CA 1TOVA 3RR6A 1VQ9A 1FX7A 3RBBB 4BD3A 4OMQA 2DK3A 3O5ZA 4XTYA 4NL2A 1VQMT 1OX8A 3RESA 5KYUA 3R6NA 4BE0A 2IPOB 3TCJA 2XK0A 4J9HA 4BDZA 2YXYA 2MOXA 2DAQA 4WCIA 4JRQA 1RAGB 4C5IA 4LDXA 3GNGA 3OSSC 3NTKA 4C92B 3M58A 3VRYA 4E47A 2HMAA 4A4GA 2RH2A 5IHIA 5HCKA 1K9AA 2KI7A 2DERA 4LDVA 2X4JA 3OBWA 2LQ8A 4M78C 2M16A 5LJ5j 4KGXB 2FO0A 1X6GA 3G71Q 2OTLQ 5FRMA 4M78F 1MGQA 1C0MA 3H0FA 3EFSA 4DQ2A 4BDYA 1UTIA 1M90R 1N6AA 2RQTA 3LGLA 2FZGB 5CQXA 1IXDA 2DPPB 2QQSA 3I5SA 1WHGA 3SB2A 1WQWA 1PCXA 2V8JA 2M0YA 1H8KA 2JS2A 5GAOp 1VQMA 5GANj 1AT1B 2JTEA 3OS5A 1QQJA 1C1AA 1RUWA 4DBHA 2ROTA 1FXXA 2MK5A 2B8AA 3VYHB 3CCSQ 3RKXA 3FB9A 4F7UF 5CKHA 4LN2A 4M75E 1TH7A 2MIOA 2XD0A 2QA4Q 5FU6C 2DTOA 1EZZB 5CVIA 2RF0A 2P0KA 1Q81U 5FRNA 2F2WA 5HY6A 1UECA 4PJOE 5CKFA 3L2VA 3AHUA 4PJOD 4ATOA 2XG8D 2FPDA 1AWJA 3RKWA 3QKJA 2F5KA 2E64A 2AT1B 2CP6A 4XU1A 1YJ9Q 1I81A 4PL6A 2ZPIB 3NHNA 4II1A 2PQWA 5GAN6 5IH2A 2AIRB 1WIEA 4E7SA 4C92D 5FU7C 1Y96A 1PD1A 5KH6A 4PJJA 5EC7A 1UJ0A 2DXCA 1UGQB 4QVZA 3CMAA 4M77D 2EGCA 2LQWA 4JRIA 4J9IA 2LMJA 2OAUA 1VQPQ 2E12A 3HSBA 5CCAA 4GY5A 4JS4A 4OMFB 3UF4A 4ELYC 1N27A 4A4EA 5FWBA 2VKNA 3OYEA 2BKDN 3I5RA 5KYNA 2JJ9A 2CUDA 5GAN2 1GFDA 2DZ9A 2GBQA 2KT8A 5LJ3f 1Q7YU 4EMHA 1M4ZA 2B86A 2Z0WA 3G1JA 3PIOA 2IVWA 2KRMA 3L2ZA 4J9DA 4M7AF 1AZEA 1OX9A 1WNLA 4LD9K 2MWPA 2E70A 3OQ5A 2BUDA 2YDLA 3E2UA 4FL6A 2ZGWA 1ZX6A 4KULA 3EH2A 1K0SA 1T3LA 4R55A 4DBQA 1KFZA 1QCNA 1BI2A 4GLKA 2ZCFB 1PKTA 2CZ7B 3NFCA 4M7AC 3ZL7C 4JS5A 3ASKA 4AG1C 1YITT 3VS0A 4Y91A 1U1TA 4C5GA 1GRIA 2HBWA 3CPWA 5J26A 1YJWQ 2KR3A 4XTZA 1BI1A 3GF5A 4MZTA 1M1KU 4L5GA 3V8KA 3DLMA 3N5BB 3QDFA 2H3JA 4RKUE 5I21A 1SSHA 3CCMT 3QXEB 3JCMb 4HVUA 4ESRA 2P4RA 4HA8A 4IURA 3OYFA 1V76A 2ZPBB 3ULRB 4PJOB 2L3PA 3I56T 5D7UA 3JB9G 2EQIA 3A8GB 3I9QA 3VRZA 2QQAA 4A53A 4N0AA 1VIEA 2YLCA 2D9TA 5D6XA 1AWXA 2KXCA 5HK3A 3RKYA 2DVJA 4Z88A 3G4ST 2FB7A 3RERA 4C8QA 4E7IA 3SDZA 2J05A 5KYXB 1P92A 2DRMA 3TREA 4DBFA 1Z9ZA 2COYA 1GBRA 1M2VA 4D8KA 2M51A 2VC8A 1K1ZA 4HCKA 3X26B 1ZUYA 3EG9A 1CSKA 1GCQC 2E6NA 4JZ3A 2VXFA 3CCQA 4HCBA 2K3BA 1NJIR 4JLGA 2K57A 5EG2A 2EBPA 1TWBA 3QJYA 4M75C 4DBRA 2KQWA 4N4IA 3I55T 1NBEB 3C0CA 4FYWB 1YJNA 4ZTJA 1OZ2A 2E5KA 2KE9A 4HT8A 3OY9A 3I56Q 3FDRA 3RMQA 3ER0A 4Y28E 5FW9A 2R57A 1IREB 5KCOA 2FZCB 5I22A 4OMOA 4J6WA 4WTOB 1KSWA 5GMKi 3CCUT 2FG0A 4PFPA 2FRYA 4JLIA 1VA7A 2FPEA 4BUGA 2E6ZA 3M4GA 3F70A 3M59A 4EDUA 2ZAEA 3CC7T 4MMKA 3L2RA 5GAN8 1KJWA 3H0HA 2E65A 1ZBJA 3C4SA 2K6DA 1VQ5T 3PMIA 3A98A 1N8RU 4M7DG 5LL6S 1YJNQ 4NL3A 2LX7A 3M57A 2L89A 1MV0B 4LDWA 1VQ5A 1SF9A 2MWOA 5GMKe 3CPFA 1IGUA 3I55Q 1MV3A 1SG5A 1G5VA 4C92E 1E6GA 1W2BP 1SHGA 2RM4A 4J9FA 1XTDA 2K3XA 4JJCA 2HAXA 3JAME 2HSEB 2YUPA 1X01A 3G6ET 1KIKA 3L2UA 2L2PA 2DL5A 2EW3A 5LJ5d 2LJ0A 2HCKA 3S6WA 4OB1B 1SEMA 1BI0A 4M7DD 3UDCA 4L59A 2O88A 1M3AA 3RUXA 1OYXA 4M75A 2RQWA 3NGPA 3P8HA
chains in the Genus database with same CATH topology
4M77C 4F7UB 2ZPEB 4M7DA 1M1GA 4IUPA 3ZBDA 5GANd 4C8QF 4YTLA 1IZ6A 4BI8B 1YBYA 1JBMA 2HD0A 2C06A 5D6WA 4J7IA 5KCHA 1HK9A 2VXEA 5CIUA 3X24B 1UGSB 1ZHIA 3OYYA 4C92C 4F7UA 2VYTA 1H3ZA 2K5IA 1VIFA 3A8MB 1WGSA 1I5LA 2CKKA 4NOYA 2XDPA 4M75G 5I2MA 2QA4A 1KQ1A 2P4TA 3E19A 3O8VA 3VJPA 1K9MC 1UGPB 1KD1U 4KUDK 2OTLA 3OBYA 3CMEA 2RHXA 2XHCA 3OSVA 4J5YA 5GAN4 3G71A 5GAOq 3SWNA 3INZA 4M7DF 1QVGS 3M54A 2QQ9A 3OA6A 1VQOT 2O4XB 2LC4A 3CC2A 3OYAA 3CCJT 3CCLA 2DEQA 2D6FA 1KG1A 3MEAA 4E7LA 1VQNT 2GF7A 3PT9A 5A0DA 1B34A 2YRVA 4J7FA 4M7DE 1JB0E 3CBPA 2L5QA 3A5ZB 3JCMc 3G4SA 5DY9A 4IKFA 3MEWA 3H6ZA 4B9WA 1R8OB 5LJ5g 2JUFA 4EMKB 1VQ9A 1FX7A 2E41A 3FJPA 1VQPT 1VQKA 4XTWA 1WPYA 4BD3A 4BY6B 2DK3A 2KSSA 2RK1A 4FT4A 3KBGA 4XTYA 4FSXA 1QP2A 4NL2A 5CR2A 1VQMT 2A7YA 1VQOA 2YHTA 2CYZB 3M55A 5GAMd 1YIJT 3OYDA 3OYKA 1I4K1 3RESA 2K3YA 3M5AA 4BE0A 4PJOA 4QQ6A 3LH0A 2XK0A 3TCJA 5FU6B 1K8AC 2RI5A 4OGEA 1X6OA 2CZ1B 4C8QC 2LDMA 4M78E 2R5AA 1Q86U 2RD1A 3OYIA 2X35A 4BDZA 1YJWT 2DIQA 2DAQA 4JRQA 2EYQA 1EIFA 2ZPHB 2GFAA 4C5IA 2I2LA 4B9XA 3J80E 3M4YA 1YITA 1LOJA 4LDXA 3GNGA 3OSSC 5DLOA 2D0QB 4VUBA 3CCMA 3JB9J 2FYKA 5CK9A 3JRZA 1YJ9T 3NTKA 4C92B 3M53A 3M58A 2LNVA 4MMLA 2LT4A 3QYHB 5CQYA 2RI3A 4C5EA 4E47A 3WVEB 1JJ2A 4A4GA 5FLXE 4M78B 2RH2A 4C92A 4M77B 4LDVA 2PUKB 4IUVA 2X4JA 3OBWA 4D6WA 3BDLA 1WJSA 2LQ8A 4XU2A 4M78C 4BE2A 3CMAT 4C8QE 1VQ6A 1PSEA 2M16A 5LJ5j 2A3LA 3M9QA 1FWZA 3OYHA 2HBPA 3VKIA 4QW2A 4M75D 2X4WA 5L8RE 3UT1A 5FRMA 4M78F 1K9MU 3J81E 1MGQA 2R5MA 3VU3C 3L1AA 5LJ3g 3RMSA 1KD1C 3EFSA 4M75F 4DQ2A 4BDYA 2VGNA 2AHJB 1N6AA 4OB0B 4PLIA 3MEVA 5LJ5e 2DVEA 3LGLA 5CQXA 4BY6C 4J6XA 3S3MA 2DPPB 2QQSA 3H8ZA 4DA4A 3SB2A 1WQWA 3LX7A 1MHNA 1XNIA 4NS5A 2V8JA 2PVOB 5GAOp 1VQMA 2QA4T 5GANj 2JTMA 4FM4B 3PIPA 2LCLA 3OS5A 3RIRA 3HRUA 1Y07A 5M9OA 5A2QE 4P5NA 3HFOA 5A0LA 2RB6A 4C0ZA 1BIBA 3M56A 1FXXA 2L8DA 3CCLT 2QQBA 1QVFS 2B8AA 3VYHB 3CCJA 4ZGDB 4C8QD 5GANe 1VQ8T 3CD6A 3RKXA 5HKCA 2CZ6B 5GMKl 3CCVT 3J7AF 3FB9A 4EPCA 4F7UF 1JJ2S 2XKOC 5CKHA 3A8LB 5GAOm 4M75E 1TH7A 2XD0A 5FU6C 1KQSS 2DTOA 3PTAA 3CXCS 2ZPFB 1VQPA 1WJRA 3LGFA 5CVIA 4C92G 2P0KA 1Q81U 4KUIA 3OS0A 1KC8U 5FRNA 1O9SA 2PVGB 4JJNK 5HY6A 4PJOE 3OMCA 4M77G 5CKFA 3UWNA 5LJ3e 2RHUA 3L2VA 1U8RA 3AHUA 3BY7A 3DB4A 4PJOD 4ATOA 4M7DB 2XG8D 4XTXA 5GAMh 3OYCA 1VQ4T 3RKWA 3TEEA 3QKJA 2F5KA 1K8AU 3KUFA 2EJ9A 3FIFA 5GAMj 2E64A 3E9FA 1M1FA 4XU1A 3HHTB 1I81A 1YHQT 1NPRA 3HRTA 4PL6A 3V7CA 3C12A 3S3NA 2ZPIB 2IG0A 1YJ9A 2XDBA 3QPHA 3GNFB 2K5LA 2PQWA 4II1A 3VUBA 5GAN6 2QEXT 4ZTFA 3ZEHA 1QVFA 1SSFA 3A8OB 5GAMe 1VUBA 5GANh 1BYMA 4C92D 5FU7C 1Y96A 4KT0E 4C0FA 3QHSA 1YJWA 2OTJA 4XTVA 5KH6A 2L3RA 1G3YA 2DXCA 4PLLA 4C0DC 1HXDA 1UGQB 4QVZA 3CMAA 2F5TX 4M77D 3NTHA 4E7HA 4A54A 5LJ5f 1O75A 4OB3B 1VQ7A 4M7AE 1QVPA 1UEBA 1JRIA 2M0OA 4JRIA 4RG2A 4XQ3A 2QTXA 4OB2B 3LWHA 4LD6A 4M7AD 1WQ7A 2OAUA 2LCCA 1N9SA 3VYGA 2E12A 5C0MA 2MAMA 4QQGA 1W4SA 3HSBA 3JCMe 3CCUA 2DXTA 5CCAA 1ZQ1A 4GY5A 4JS4A 2GCXA 4HKEA 2V8IA 4OMFB 3CPWS 4M7AA 1AHJB 4ELYC 1N27A 3JB9F 2Y4XA 3QYGB 3MP1A 4X34A 4A4EA 3HP9A 3P8BB 4OF1A 1WJQA 2GFUA 1G3WA 2BKDN 3ZFJA 5KE2A 3OYEA 5GAN2 5GANf 2DO3A 2EAYA 2DZ9A 4F7UG 2EKOA 5LJ3f 1Q7YU 4EMHA 1S72A 5HK0A 1Q86C 1DJ7B 1OZ3A 3LW5E 5DM7R 2KVQG 2XICA 1M4ZA 4Q5WA 1Y7XA 2LQKA 5LJ3j 3PIOA 2IVWA 2RI2A 3L2ZA 3S3OA 4M7AF 3HL8A 2NLUA 4JRKA 1WNLA 3JSCA 2MWPA 4LD9K 3JCMQ 2E70A 1B34B 3BDUA 1YHQA 3OQ5A 3C95A 2BUDA 3META 3BFMA 2EWNA 1NE8A 3VUZA 4JDSA 4FL6A 2ZGWA 5CAIA 2MI6A 2FL7A 2KY9A 4MDWA 3FEOA 4KULA 5KE3A 4IUUA 4ME7A 3CCSA 2YLBA 4C5HA 3QBYA 2VUBA 3URGA 4R55A 5FU7B 3CCRA 3JCMP 1YI2A 3OYLA 1QP3A 3X25B 2EQJA 1BI2A 4GLKA 3CCVA 2ZCFB 3LLRA 2VV5A 2CZ7B 3NFCA 4C0DB 3V8JA 1PSFA 1KC8C 3CC4A 1NZ9A 4M7AC 2JOYA 4JS5A 3ASKA 1YI2T 3QDRB 4BE1A 1YITT 1Q82U 4IUTA 3OS1A 4Y91A 1U1TA 2G3RA 3QIIA 3OYNA 3CBMA 4C5GA 5GAN7 3SWNC 3CPWA 2EQKA 2RK2A 3MCAB 4LDUA 5J26A 1LNXA 4XTZA 1BI1A 3GF5A 4MZTA 3OYJA 3SFMA 4XAXB 3V7SA 5CKDA 1M90U 1M1KU 4R56A 3CCST 1GXIE 4N0AC 5GMKm 3P8DA 4L5GA 3PFSA 4XTUA 3V8KA 1KHIA 2O4XA 2CS7A 3DLMA 4J6YA 3N5BB 4M75B 2H3JA 4RKUE 3WVDB 5I21A 3GIBA 3V8LA 1N8RC 3CCMT 3JCMJ 3CC4T 3QXEB 3JCMb 3GPLA 5J39A 1BKBA 4M7AG 4HA8A 5IN1A 3HKSA 2DIGA 4IURA 4N4GA 4FU6A 3OYFA 4PKCC 2ZPBB 3JCMW 1W2BS 2HNIA 2RJCA 4N4HA 2EQUA 1NJIU 2CGHA 2GQVA 4MZPA 4PJOB 1KQSA 3I56T 2MF2A 3LYIA 4JUVA 3L2WA 1I8FA 3JB9G 1M8VA 5LJ3h 3A8GB 3QZ9B 2KMTA 3G71T 1XQHA 2QQAA 3HFNA 3V7RA 2VGMA 4A53A 4PJOC 5GAMg 4N0AA 1VIEA 3QSUA 3CCET 3I56A 3HPWA 3EFRA 1Q7YC 2QXFA 3GLXA 3SD4A 4DOVA 2YLCA 2D9TA 2HQXA 4QVDA 3GP8A 4CI0C 5D6XA 4PJOF 4FT2A 5HK3A 5IAYA 2ZZDA 4XK8E 4BI4A 4C8QB 3TU4K 1VQ7T 3RKYA 5IT9E 2DTIA 2EJGA 1VQKT 2F69A 3G4ST 1K73U 2FB7A 4BB7A 2QQRA 3RERA 4BI3A 1XOVA 3A8HB 3BW1A 4XU3A 4M7AB 4C8QA 4J8OA 2PUOB 2XU8A 3SDZA 4E7IA 2MMPA 1S72T 1VQNA 3CD6T 3MO8A 1P92A 2E1HA 3TREA 1Y71A 2QDYB 4KBMB 5A0GA 2XI9A 5CKEA 3JCMf 2QI2A 1VQ8A 3JB9I 2VC8A 4HT9A 3QJ6A 3KXTA 3X28B 4OVAA 2V8KA 3X26B 5J3BA 3G6EA 2E6NA 1N9RA 1BIAA 2JTFA 2VXFA 3CCQA 4HCBA 3G7ZA 3QUIA 4WF2A 3OMGA 4JLGA 4EMKC 3OYMA 4E7JA 2K57A 2ZPGB 2R58A 5EG2A 3SWNB 4MZMA 3T9NA 2JVVA 2Y4YA 2FVUA 1M1KC 3I55A 3CCQT 1VQLT 4C0GA 3FRNA 4DOWA 5GAN5 2RO0A 2DZCA 1W2BA 3JCMg 2P0QA 3NTIA 1RL2A 3QJYA 2JN0A 4M75C 4RCBA 4C92F 5GMKh 1NPPA 2E5QA 2KQWA 4PJOG 4ZN3A 4N4IA 3I55T 1VQLA 2RJFA 4M77F 3JCMX 3E1SA 2K5FA 3PMTA 3OS2A 2JZ2A 4M78D 4ZTJA 4F7UE 1YJNA 1OZ2A 1D3BB 1NJIC 3MHXA 2LTOA 2PU9B 2RHZA 3OY9A 4HT8A 1KQ2A 2WSEE 2LX9A 3MP8A 4QVCA 1H641 3GOXA 1D3BA 2M1HA 3FLGA 3FDRA 2QEXA 2DD5A 3RMQA 2XIDA 4O6JA 3ER0A 1UB4A 2OTJT 3L42A 1QW1A 3Q1JA 3C94A 4Y28E 1UGRB 1Y96B 2R57A 5D6YA 2OTLT 2PVDB 3OYBA 4C8QG 4BACA 1IREB 5KCOA 5I2SA 5DLQE 3JCMV 3DB3A 5GAOl 3FC3A 4J6WA 4J83A 3LWIA 4ELZC 2DXBA 5GMKi 3CCUT 2FHDA 2KK4A 1RI0A 3DKMA 4RG8A 5GAN3 1Q82C 2KDSA 4JLIA 5LJ3d 4A4KA 2WSCE 3CCEA 4BUGA 3JCMh 3CMET 2DD4A 2E6ZA 3M4GA 1ZBXA 3F70A 3M59A 4EDUA 3UPUA 3DLLA 1M90C 3CC7T 1G3SA 4MMKA 4X9CA 3L2RA 3CBOA 2HQEA 3PNWC 5FROA 4X9DA 4QQDA 3WXMB 4EMKA 2E65A 5GAN8 4RMOA 3CXCA 3C4SA 2X4XA 1M5Q1 5GAMf 1VQ5T 3PMIA 3HRSA 1N8RU 4M7DG 2X4YA 5LL6S 3OW2S 4A4FA 2DXUA 2DTHA 4NL3A 5LJ5h 1LJOA 3E9GA 1K73C 3M57A 3JB9D 2L89A 3ME9A 2K4YA 4L6V5 4LDWA 1VQ5A 2MWOA 3QG1A 3OB9A 3QO3A 4JRPA 2Y90A 4ZGJB 2EQMA 2KAFA 5GMKe 3CPFA 1BI3A 4TVRA 1M9SA 4A4HA 2RHYA 4HCZA 2LVMA 5GAOn 2LRQA 1G3TA 2EJFA 3EAEA 2WSFE 2DKGA 4OGCA 3VV0A 2XDDA 1G5VA 2BIVA 4C92E 4HCCA 4E7KA 4O5VA 2EFIA 4XU0A 5GMKj 2RA2A 3CC2T 2RM4A 5GAOr 5AYFA 1XTDA 2K3XA 3PGGA 2EIFA 4M78A 4ZGEB 5C6SA 1YCYA 3MEUA 4M77E 2HAXA 3JCMd 1VQ4A 4M78G 3JB9H 4MDXA 3JAME 3CCRT 2DJZA 4ZN1A 1X01A 4IUQA 3L2QA 4Z02A 3G6ET 3QZ5B 2WACA 3OW2A 2RJEA 4LDYA 3L2UA 2E10A 1VQ9T 1KHCA 4EMGA 2RHIA 1OI1A 1U1SA 5LJ5d 3R6OA 4M7DC 2CZ0B 5CO7A 3X20B 5CKBA 3S6WA 3CEYA 4OB1B 1YJNT 5GANg 1QVGA 4V2SA 1BI0A 2LT1A 1Q81C 4RCCA 3CC7A 1VQ6T 1V29B 2M9UA 4CRIA 4OP0A 1X75C 1YIJA 4M7DD 3UDCA 3OYGA 4L59A 4FIBA 2JNGA 2O01E 3MP6A 4UC4A 3RUXA 1OYXA 4M75A 2K2VA 4PNOA 2RJDA 2P0PA 3P8HA 4M77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MI6 A;  3I55 T;  1VQL A;  1M1G A;  3CCS A;  4YTL A;  1IZ6 A;  1YJN A;  1YBY A;  3CCR A;  1YI2 A;  3CCL T;  1QVF S;  3CCJ A;  3OYY A;  1NJI C;  3CD6 A;  1VQ8 T;  3CCV A;  2CKK A;  3CC4 A;  1KC8 C;  3CCV T;  1NZ9 A;  2QA4 A;  3J7A F;  2JOY A;  1JJ2 S;  2QEX A;  1K9M C;  1YI2 T;  1KD1 U;  1YIT T;  3ER0 A;  1Q82 U;  1KQS S;  3CXC S;  3CME A;  1VQP A;  2OTL A;  2OTJ T;  2G3R A;  2XHC A;  3LGF A;  3G71 A;  2OTL T;  3CPW A;  1QVG S;  1VQO T;  5J26 A;  1Q81 U;  3CCL A;  3CC2 A;  3CCJ T;  1M1K U;  1M90 U;  1KC8 U;  5DLQ E;  1VQN T;  3DB3 A;  5HY6 A;  3CCS T;  1KHI A;  3CCU T;  3A5Z B;  3G4S A;  3DB4 A;  1Q82 C;  2KDS A;  1N8R C;  3CCM T;  3CC4 T;  2JUF A;  1VQ4 T;  3CCE A;  1VQ9 A;  1BKB A;  2E6Z A;  3CME T;  1VQP T;  1VQK A;  1K8A U;  3HKS A;  3DLL A;  1W2B S;  1M90 C;  3CC7 T;  1NJI U;  3KBG A;  4QQD A;  1KQS A;  3CXC A;  3I56 T;  1VQM T;  1NPR A;  1YHQ T;  1VQO A;  2IG0 A;  1VQ5 T;  1YJ9 A;  1YIJ T;  1N8R U;  5LL6 S;  3G71 T;  3OW2 S;  2QEX T;  3LH0 A;  1QVF A;  1SSF A;  1K8A C;  3CCE T;  1K73 C;  1X6O A;  3I56 A;  1YJW A;  2OTJ A;  1Q7Y C;  1Q86 U;  1VQ5 A;  1YJW T;  2L3R A;  2MWO A;  1EIF A;  3CMA A;  3CPF A;  3J80 E;  1YIT A;  5IAY A;  4TVR A;  1VQ7 T;  3CCM A;  5IT9 E;  2LVM A;  1YJ9 T;  1VQ7 A;  1UEB A;  1VQK T;  4RG2 A;  3G4S T;  1K73 U;  1JJ2 A;  5FLX E;  1VQN A;  3CD6 T;  1S72 T;  3CCU A;  3CC2 T;  3TRE A;  1XTD A;  2LQ8 A;  2EIF A;  3CPW S;  3CMA T;  1VQ4 A;  1VQ8 A;  1VQ6 A;  3JAM E;  4X34 A;  3P8B B;  3CCR T;  4ZN1 A;  3G6E T;  3OW2 A;  5J3B A;  2DO3 A;  1VQ9 T;  3G6E A;  1K9M U;  3J81 E;  3CCQ A;  1KD1 C;  1Q7Y U;  1S72 A;  1Q86 C;  5DM7 R;  2KVQ G;  1YJN T;  1QVG A;  3LGL A;  1Q81 C;  2JVV A;  3CC7 A;  3PIO A;  1VQ6 T;  1M1K C;  4CRI A;  3I55 A;  3CCQ T;  1VQL T;  1YIJ A;  2MWP A;  1XNI A;  2JNG A;  2E70 A;  1VQM A;  1YHQ A;  2QA4 T;  1W2B A;  1RL2 A;  3PIP A;  2LCL A;  1NPP A;  5A2Q E;  4ZN3 A; 
#chains in the Genus database with same CATH topology
 1IGQ A;  3ZBD A;  5GAN d;  1SRL A;  1IZ6 A;  1TUG B;  1PRM C;  5D6W A;  1HK9 A;  5CIU A;  2D0N A;  3X24 B;  4C92 C;  1G2B A;  1WGS A;  2CKK A;  2XDP A;  4M75 G;  1RI9 A;  1NLO C;  2OTL A;  3G71 A;  2E3H A;  3SWN A;  3INZ A;  3M54 A;  2QQ9 A;  3CQT A;  2O4X B;  1QLY A;  1EFN A;  2X3W D;  3OYA A;  1ZSZ A;  1B34 A;  1D1B A;  1QWF A;  3A5Z B;  4IKF A;  1RAF B;  3H6Z A;  3CPW P;  2NUZ A;  2HL5 C;  1R8O B;  5LJ5 g;  1KD1 R;  1VQP T;  4XTW A;  4FT4 A;  4FYY B;  1OUL A;  3KBG A;  1QKW A;  4ANJ A;  2EKH A;  1VQO A;  2YHT A;  2CYZ B;  1UG1 A;  2M02 A;  3M55 A;  3OYK A;  1I4K 1;  1K8A C;  2RI5 A;  4OGE A;  1X6O A;  4C8Q C;  2LDM A;  2QK0 A;  4AFQ C;  1Q86 U;  2RD1 A;  3JV3 A;  2QYZ A;  1EX4 A;  3CCJ Q;  2EYQ A;  4J9G A;  5DLO A;  3JB9 J;  2FYK A;  1YJ9 T;  1YNZ A;  3M53 A;  2LNV A;  2LT4 A;  1CKB A;  3WVE B;  5FLX E;  7AT1 B;  1OV3 A;  4M77 B;  4IUV A;  2W0Z A;  3BDL A;  1WJS A;  4XU2 A;  5I11 A;  9ATC B;  2DYI A;  4PJM A;  3M0Q A;  3OYH A;  4M75 D;  2X4W A;  2CDT A;  1K9M U;  2CP3 A;  5LJ3 g;  3RMS A;  2EPD A;  4PK4 A;  2LP5 A;  4BY6 C;  3LX7 A;  1XNI A;  5KYY A;  1LPL A;  2QA4 T;  2LCL A;  3RIR A;  3HRU A;  1Y07 A;  2CH4 W;  5M9O A;  2LZ6 B;  5A2Q E;  1X43 A;  2FRW A;  1I5O B;  2A08 A;  2QQB A;  2PTK A;  4OMP A;  4AT1 B;  1VQ8 T;  1ABQ A;  1ACM B;  2CZ6 B;  4EPC A;  5GAO m;  4ORZ A;  3CXC S;  2A36 A;  1GCQ A;  4C92 G;  3FJ5 A;  2JW4 A;  3OS0 A;  1KC8 U;  2J7I A;  2MYS A;  1ZSZ C;  4RTU A;  2GGR A;  1OEB A;  3OMC A;  4M77 G;  2RHU A;  3OYC A;  2YUQ A;  1K8A U;  4KGV B;  5KYX A;  1VYT A;  5GJV B;  2RJD A;  4PJL A;  2SRC A;  3HRT A;  3C12 A;  3S3N A;  2IG0 A;  1AZG B;  1YJ9 A;  3VS1 A;  2K5L A;  4X1V A;  2NUT A;  2RPN A;  2HQH A;  2YWW A;  3A8O B;  5GAM e;  5GAN h;  2CP5 A;  4RTW A;  4XTV A;  4PLL A;  5LJ5 f;  2DLP A;  1VQ7 A;  1PNJ A;  4OB2 B;  3LWH A;  1WQ7 A;  4JJB A;  3VYG A;  3CC7 Q;  2MAM A;  1W4S A;  1YWO A;  1D1C A;  1UHC A;  4X34 A;  4KH0 B;  4OF1 A;  1WJQ A;  2GFU A;  1RAB B;  2J6O A;  5GAN f;  2K79 A;  1WHK A;  2BE7 D;  1UGV A;  1S72 A;  5HK0 A;  3LW5 E;  2KVQ G;  2XIC A;  4Q5W A;  4KH1 B;  1Y7X A;  5KYY B;  2RI2 A;  2NLU A;  3JCM Q;  3C95 A;  3MET A;  3BFM A;  1Y0M A;  2EWN A;  3VUZ A;  4JDS A;  5CAI A;  2MI6 A;  2O9S A;  2BZY A;  1W70 A;  2YLB A;  3QBY A;  2VUB A;  3URG A;  3CCR A;  3JCM P;  3D7S B;  1YI2 A;  3OYL A;  1IHV A;  1QP3 A;  2EQJ A;  3CCV A;  1KC8 C;  1NZ9 A;  2JOY A;  3EG9 B;  3CXC P;  2CRE A;  1KQS P;  3QDR B;  4BE1 A;  4IUT A;  1ZUU A;  3OS1 A;  2G3R A;  5GAN 7;  2EQK A;  2RK2 A;  3MCA B;  2DX1 A;  4XAX B;  3V7S A;  4ZNX A;  1WZO A;  4XTU A;  3PFS A;  1TU0 B;  2CS7 A;  3WVD B;  3CCE Q;  3M0P A;  1ZUK A;  1M27 C;  1N8R C;  3JCM J;  3GPL A;  3M0T A;  1VQN Q;  5J39 A;  5IN1 A;  3HKS A;  2DIG A;  2OI3 A;  4N4G A;  1HJD A;  1MMD A;  4PKC C;  2RJC A;  1NJI U;  3NMZ C;  1RAC B;  2MF2 A;  1AEY A;  2VWF A;  3L2W A;  1I8F A;  1M8V A;  1UFF A;  1NEB A;  2KMT A;  4Z8A A;  3V7R A;  2VGM A;  3CCE T;  3I56 A;  3EFR A;  4QVD A;  2HQX A;  4FT2 A;  1YCS B;  5IAY A;  2ZZD A;  4C8Q B;  5IT9 E;  1HSQ A;  2DTI A;  2QQR A;  2ECZ A;  3A8H B;  4J8O A;  2XU8 A;  3MO8 A;  3JCM f;  2QI2 A;  3JB9 I;  2DBK A;  3M0S A;  3G6E A;  2JTF A;  2OX7 A;  3OMG A;  3OYM A;  4E7J A;  2AKL A;  1YIT Q;  3SWN B;  3T9N A;  4C0G A;  2RO0 A;  1ZSG A;  1W2B A;  3NTI A;  1RL2 A;  1VYU A;  2JN0 A;  1RAE B;  1NPP A;  1M2O A;  1VQL A;  1VQO Q;  3EFO A;  4E6R A;  1NJI C;  3EG3 A;  2CT4 A;  2WSE E;  3MP8 A;  1PG5 B;  3GOX A;  1D3B A;  2M1H A;  2DD5 A;  2O31 A;  1RAH B;  1RAD B;  3L42 A;  3Q1J A;  1WFW A;  2OTL T;  2V1Q A;  4BAC A;  3PVL A;  2DNU A;  5I2S A;  2JS0 A;  2BTT A;  4RG8 A;  1MND A;  1Q82 C;  2KDS A;  1YFN A;  3CCE A;  3CME T;  3UPU A;  1M90 C;  1S1N A;  4EMK A;  3WXM B;  4QQD A;  1SKU B;  2CUB A;  1M3C A;  3OW2 S;  4PFO A;  1LJO A;  1K73 C;  3ME9 A;  4RTX A;  3QO3 A;  4ZGJ B;  2EQM A;  3CCR Q;  1NG2 A;  4AG2 C;  2HL3 A;  4FW2 A;  4FYX B;  3M0R A;  2RHY A;  4A4H A;  2LVM A;  1CKA A;  3EAE A;  1G3T A;  1GFC A;  3TQ7 P;  2DKG A;  2BIV A;  2SEM A;  4HCC A;  4E7K A;  1KK7 A;  1T0H A;  2EFI A;  4XU0 A;  4M78 A;  5C6S A;  1B3Q A;  1YCY A;  4M77 E;  1VQ4 A;  3JB9 H;  3REB B;  5GJW B;  1QVF P;  2EYY A;  3VS6 A;  3CCR T;  1T0J A;  1GL5 A;  3L2Q A;  4Z02 A;  3QZ5 B;  1R0B G;  2RJE A;  1VQ9 T;  1UJY A;  1WHH A;  2DBM A;  4B6M A;  1OI1 A;  1U1S A;  4EMG A;  4M4Z A;  5CO7 A;  3X20 B;  2C0T A;  4J9B A;  2HSP A;  2ESW A;  4Y92 A;  1K8A R;  1Q81 C;  1X75 C;  1YIJ A;  2ABL A;  4AFU C;  4FIB A;  2JNG A;  3SEM A;  2O01 E;  4PNO A;  2NYS A;  1F1B B;  1U3O A;  4M77 A;  2ZPE B;  1VQ9 Q;  1M1G A;  4C8Q F;  1YBY A;  8AT1 B;  4J7I A;  4F7U A;  1UGS B;  1ZHI A;  3OYY A;  1VIF A;  1I5L A;  4NOY A;  5I2M A;  4PFZ A;  1KQ1 A;  2P4T A;  3E19 A;  1K9M C;  2DEU A;  4KUD K;  2JT4 A;  1YN8 A;  1D09 B;  5GAN 4;  4M7D F;  1QVG S;  1GBQ A;  1VQO T;  3OA6 A;  2DFU A;  1TG0 A;  2LC4 A;  3CCJ T;  2DEQ A;  1KG1 A;  2J6F A;  2GF7 A;  5A0D A;  2YRV A;  2MCN A;  1WX6 A;  2L5Q A;  5DY9 A;  2D1X A;  3MEW A;  4B9W A;  2JUF A;  4EMK B;  3FJP A;  4BY6 B;  1OQK A;  1R77 A;  2KSS A;  2OTJ Q;  2RK1 A;  3CCV Q;  4FSX A;  1QP2 A;  1WLP B;  2CSQ A;  5CR2 A;  1QMC A;  3QWY A;  2KYB A;  1SHF A;  3OYD A;  3LH5 A;  4PJO A;  1NLP C;  4QQ6 A;  3LH0 A;  1TS9 A;  4M78 E;  3OYI A;  2X35 A;  5KYW B;  2DIQ A;  2EGE A;  4QT7 A;  2ZPH B;  4F04 B;  2I2L A;  4B9X A;  3J80 E;  1YIT A;  4K11 A;  1BBZ A;  4LUE A;  5CK9 A;  1VQM Q;  4MML A;  3QYH B;  4FYV B;  1JJ2 A;  4M78 B;  4OML A;  1YP5 A;  3H0I A;  1W1F A;  4D6W A;  4BE2 A;  3CCL Q;  1PSE A;  2A3L A;  1RAI B;  2P84 A;  1FWZ A;  2HBP A;  2QTV A;  4LNP A;  4QW2 A;  1D0X A;  5L8R E;  2R5M A;  2QGG A;  3VU3 C;  5ECA A;  4M75 F;  1VQ5 Q;  3MEV A;  2DVE A;  1ZLM A;  2F2V A;  4J6X A;  3S3M A;  4CC4 B;  4DA4 A;  1VQK Q;  2PVO B;  2BE9 B;  2K9G A;  2JTM A;  2KRO A;  3PIP A;  4P5N A;  5A0L A;  2RB6 A;  4PJN A;  1BIB A;  3CCL T;  2L3S A;  4ZGD B;  1JO8 A;  4C8Q D;  3OW2 P;  5GMK l;  1G8X A;  3QWX X;  4JPB W;  2ZPF B;  3KFV A;  3LGF A;  4KUI A;  1X2K A;  1O9S A;  2PVG B;  4JJN K;  5LJ3 e;  3UWN A;  1U8R A;  1H3H A;  1TTH B;  3BY7 A;  1PWT A;  4XTX A;  2DJQ A;  2QGF B;  1N5Z A;  2EJ9 A;  3FIF A;  5GAM j;  3E9F A;  3H9N A;  4F14 A;  1NPR A;  3V7C A;  4D8D A;  3QPH A;  2QEX T;  2KYM A;  3ZEH A;  1BYM A;  3QHS A;  5IXB A;  1G3Y A;  1FMV A;  4C0D C;  2F5T X;  3G6E Q;  4E7H A;  4A54 A;  1O75 A;  1NYG A;  1JRI A;  1WHJ A;  4XQ3 A;  2YRD A;  2LCC A;  1TUD A;  2IIM A;  3JCM e;  2DXT A;  1WA7 A;  4HKE A;  2V8I A;  4M7A A;  1AWO A;  3JB9 F;  2Y4X A;  4AMC A;  3MP1 A;  3BE3 A;  2YUO A;  4LE9 A;  2EAY A;  2JMC A;  4IIO A;  4F7U G;  1Q86 C;  1DJ7 B;  1OZ3 A;  5DM7 R;  1JQQ A;  1QWE A;  1S72 Q;  2LQK A;  5LJ3 j;  3HL8 A;  1A0N B;  4JRK A;  1HD3 A;  3JSC A;  3BDU A;  1NE8 A;  1GCP A;  4J9C A;  1KC8 R;  1X69 A;  4ME7 A;  3CCS A;  4IIM A;  4C5H A;  2BZ8 A;  1W6X A;  1R0C B;  2EYX A;  3CCU Q;  3LLR A;  2VV5 A;  4C0D B;  3V8J A;  1PKS A;  2ROL A;  2HKQ B;  1QCF A;  1YI2 T;  8ATC B;  1Q82 U;  2KRN A;  4A63 B;  3CBM A;  1ZA1 B;  3SWN C;  1XJW B;  1ZA2 B;  1PHT A;  4DEY A;  1M90 U;  3SFM A;  5CKD A;  3CC4 Q;  1OU8 A;  1VQ8 Q;  1GXI E;  2O4X A;  4M75 B;  1WDX A;  1X2Q A;  1RLQ C;  1WXT A;  1BKB A;  2E4H A;  1W2B S;  4FU6 A;  1RAA B;  2HNI A;  4N4H A;  2GQV A;  5KYU B;  3VS2 A;  1KQS A;  3LYI A;  5LJ3 h;  3QZ9 B;  1XQH A;  3HFN A;  2QDL A;  5GAM g;  1WYX A;  2RN8 A;  3GLX A;  3SD4 A;  3GP8 A;  1WHL A;  4JJD A;  1VQ7 T;  4BI4 A;  2X3X D;  1VQL Q;  1Y57 A;  1FYN A;  1VQK T;  2F69 A;  1K73 U;  2YSQ A;  1X6B A;  4BB7 A;  4BI3 A;  1XOV A;  4M7A B;  3CD6 T;  2PUO B;  2KGT A;  2LNH B;  2RMO A;  5AT1 B;  1AVZ C;  2FEI A;  1I1J A;  2QDY B;  3TSZ A;  1WI7 A;  2L0A A;  2XI9 A;  1LVK A;  3QJ6 A;  2AK5 A;  3KXT A;  3X28 B;  4OVA A;  2KT1 A;  2V8K A;  4FW1 A;  4EMK C;  3IQL A;  2ZPG B;  1Q81 R;  1RLP C;  2F1L A;  2YUN A;  2Y4Y A;  4MZM A;  3CC2 Q;  1VQL T;  3CCQ T;  4DOW A;  2DZC A;  3JCM g;  4RCB A;  5GMK h;  2X9H A;  2DF6 A;  4PJO G;  1M1K R;  5IHN A;  3PMT A;  3U23 A;  4M78 D;  1D3B B;  3MHX A;  2LTO A;  2RHZ A;  1KQ2 A;  1H64 1;  3FLG A;  2QEX A;  2JM8 A;  2JXB A;  2DMO A;  2OTJ T;  4GLM A;  2ED0 A;  5D6Y A;  1Y96 B;  2XMF A;  5KYW A;  2PVD B;  3OYB A;  1WHM A;  4F17 A;  2G6F X;  2LJ1 A;  2EGA A;  5GAO l;  2DXB A;  1M30 A;  2FHD A;  2KK4 A;  1RI0 A;  4LUD A;  2X51 A;  4AFZ C;  5LJ3 d;  4A4K A;  1IHW A;  2WSC E;  2GNC A;  2PNI A;  3JCM h;  1ZBX A;  1PRL C;  3DLL A;  1VYV A;  1G3S A;  4X9C A;  5FRO A;  3CBO A;  3VS3 A;  2X4X A;  1M5Q 1;  1MMG A;  1J3T A;  3HRS A;  4A4F A;  4Z89 A;  2DXU A;  2DTH A;  5LJ5 h;  4L6V 5;  1YIJ Q;  2J6K A;  1HYO A;  3RNJ A;  3QG1 A;  3OB9 A;  2Y90 A;  2KAF A;  2K7A A;  1MMA A;  1BI3 A;  4TVR A;  2LRQ A;  1YHQ Q;  4OGC A;  1WXU A;  2DYB A;  1UE9 A;  2H8H A;  4O5V A;  5GMK j;  2RA2 A;  3CC2 T;  2HEQ A;  4RUG A;  4RTY A;  2EIF A;  4MDX A;  3JCM d;  4M78 G;  2RQR A;  1SPK A;  3AT1 B;  1ABO A;  2WAC A;  2OJ2 A;  2E10 A;  1KHC A;  3R6O A;  4M7D C;  2CP2 A;  1B07 A;  5CKB A;  1YJN T;  5GAN g;  2LT1 A;  1V29 B;  2M9U A;  3OYG A;  1PC0 A;  3MP6 A;  4UC4 A;  1SRM A;  4F7U B;  1VQ7 Q;  4IUP A;  2YT6 A;  2DA9 A;  1K9M R;  2HD0 A;  2C06 A;  5KCH A;  2VXE A;  1H3Z A;  1OU9 A;  2K5I A;  3A8M B;  1VOM A;  2QG9 B;  3O8V A;  2JM9 A;  1PD0 A;  2DM1 A;  3OBY A;  3OSV A;  1MUZ A;  2D6F A;  3MEA A;  4J7F A;  3CBP A;  3G4S A;  3JCM c;  2E41 A;  1VQK A;  1WPY A;  2D8J A;  1NEG A;  2NUT B;  2A7Y A;  1BU1 A;  2L3Q A;  5GAM d;  1YI2 Q;  1YIJ T;  2K3Y A;  3M5A A;  5FU6 B;  2CZ1 B;  2R5A A;  4OMN A;  1D0Z A;  3EG2 A;  1YJW T;  1EIF A;  2GFA A;  3THK A;  2DE0 X;  3M4Y A;  1LOJ A;  3CCM A;  2D0Q B;  4VUB A;  1QVG P;  4HT9 A;  3JRZ A;  5CQY A;  2RI3 A;  4C5E A;  2QEX Q;  4C92 A;  1M2V B;  2PUK B;  2D8H A;  3G4S Q;  2DRK A;  1QCO A;  3CMA T;  4C8Q E;  1TUC A;  1VQ6 A;  3M9Q A;  1B7T A;  3VKI A;  3MKD A;  3UT1 A;  3J81 E;  3L1A A;  1KD1 C;  1I07 A;  2VGN A;  2AHJ B;  4OB0 B;  4PLI A;  5LJ5 e;  4QKU A;  1JJ2 P;  3H8Z A;  2VAS A;  3H41 A;  1MHN A;  4NS5 A;  1OPL A;  2DL4 A;  4FM4 B;  1Q86 R;  3HTR A;  1D1A A;  3HFO A;  1IRX A;  4J9E A;  4KRT A;  1Q7Y R;  3CCM Q;  4C0Z A;  3M56 A;  2L8D A;  3EHQ A;  1QVF S;  3CCJ A;  2A28 A;  5GAN e;  3CD6 A;  5HKC A;  3CCV T;  1ARK A;  2CP0 A;  3J7A F;  2MPX C;  1JJ2 S;  2XKO C;  1UHF A;  3A8L B;  1KQS S;  3PTA A;  1VQP A;  1WJR A;  1H92 A;  2I0N A;  1K73 R;  2ATC B;  2GQI A;  3EHR A;  3DB4 A;  1ZSZ B;  4M7D B;  5GAM h;  1VQ4 T;  3TEE A;  1BCM A;  1FMW A;  2KRS A;  1BCO A;  4FCY A;  3KUF A;  2NUP B;  1M1F A;  2CP7 A;  3HHT B;  1YHQ T;  2XDB A;  2NWM A;  3GNF B;  1I0C A;  3VUB A;  3I35 A;  4ZTF A;  1QVF A;  1SSF A;  1VUB A;  4KT0 E;  4C0F A;  1YJW A;  2OTJ A;  1K76 A;  2DIL A;  2L3R A;  2JMA A;  1HXD A;  1BK2 A;  3NTH A;  2QAS A;  2GTO A;  2AKK A;  4R0K A;  4OB3 B;  1U06 A;  2KXD A;  1NM7 A;  4HVW A;  4CC7 A;  1QVP A;  1UEB A;  4M7A E;  2M0O A;  4RG2 A;  2QTX A;  4LD6 A;  1QKX A;  4M7A D;  1AD5 A;  5C0M A;  1N9S A;  1MMN A;  2EVR A;  4QQG A;  3CCU A;  1ZQ1 A;  4RTT A;  6AT1 B;  2GCX A;  3CPW S;  1AHJ B;  3RDV A;  1UUE A;  3QYG B;  2EYZ A;  3HP9 A;  3P8B B;  5KE2 A;  1K4U S;  3ZFJ A;  1G3W A;  2DO3 A;  2HZY A;  3PE0 A;  2EKO A;  2K2M A;  3VS5 A;  3S3O A;  2E3I A;  1IB8 A;  2RQV A;  1WXB A;  1Q82 R;  1B34 B;  1YHQ A;  3EG0 A;  2LJ3 A;  2O2O A;  2FL7 A;  2KY9 A;  4MDW A;  3FEO A;  5KE3 A;  4IUU A;  1N8R R;  5FWC A;  5FU7 B;  4GBQ A;  3X25 B;  2A0F B;  4KGZ B;  3GBQ A;  3CC4 A;  1PSF A;  5L23 A;  3CCQ Q;  1AWW A;  3QII A;  3OYN A;  4LXC A;  4LDU A;  3A1P A;  1LNX A;  3OYJ A;  1JEG A;  2W10 A;  4R56 A;  3CCS T;  4N0A C;  3UA6 A;  5GMK m;  3P8D A;  4CC2 A;  1M3B A;  2CH4 A;  4J6Y A;  1KHI A;  2BZX A;  3GIB A;  3V8L A;  2F2X A;  3EGD B;  3CC4 T;  2NUP A;  4M7A G;  2DET A;  3JCM W;  3CD6 Q;  2EQU A;  2CGH A;  4MZP A;  2HDA A;  2RQU A;  4JUV A;  4JZ4 A;  3G71 T;  2KBT A;  4PJO C;  3QSU A;  2A37 A;  3REA B;  3HPW A;  1Q7Y C;  1T3S A;  2QXF A;  4DOV A;  2CT3 A;  4CI0 C;  1U5S A;  1BB9 A;  1E6H A;  2CSI A;  4PJO F;  4XK8 E;  3TU4 K;  1K0X A;  3EG1 A;  1FMK A;  2EJG A;  1OPK A;  4E2F B;  3BW1 A;  4XU3 A;  3CME Q;  1VQN A;  2MMP A;  1S72 T;  2E1H A;  1Y71 A;  4KBM B;  5A0G A;  2J06 A;  5CKE A;  1VQ8 A;  1YWP A;  2V1R A;  2V26 A;  1JXO A;  4OMM A;  5J3B A;  4RTZ A;  1N9R A;  1BIA A;  3G7Z A;  3TVT A;  3QUI A;  4WF2 A;  1JU5 C;  2LQN A;  2R58 A;  2JVV A;  2FVU A;  1M1K C;  2EYW A;  3I55 A;  3FRN A;  5IXF A;  5GAN 5;  5IHK A;  2P0Q A;  4C92 F;  3EGX A;  1M8M A;  2E5Q A;  3EGU A;  4ZN3 A;  2RJF A;  4M77 F;  3JCM X;  3E1S A;  2K5F A;  3OS2 A;  2JZ2 A;  4F7U E;  2AZV A;  2COW A;  2PU9 B;  3UAT A;  2LX9 A;  4QVC A;  3PVQ A;  1AOJ A;  2XID A;  4O6J A;  3MPU B;  1UB4 A;  2FZK B;  4HVV A;  1QW1 A;  3C94 A;  1UGR B;  2OAW A;  1C6V X;  4DEX A;  4C8Q G;  1TSF A;  2VB6 A;  3EGD A;  3DB3 A;  5DLQ E;  3JCM V;  3FC3 A;  4J83 A;  3LWI A;  1OOT A;  4ELZ C;  3VS7 A;  4CC3 A;  1IO6 A;  2VVK A;  4EIK A;  3DKM A;  2PZ1 A;  5GAN 3;  2ENM A;  4FSS A;  4AFS C;  2COZ A;  1VQ6 Q;  1MNE A;  2DD4 A;  3SHW A;  1JXM A;  3PNW C;  2HQE A;  2KNB B;  2YRC A;  4X9D A;  3NPF A;  4RMO A;  3CXC A;  2O9V A;  5GAM f;  2DL3 A;  2X4Y A;  3E9G A;  3JB9 D;  2K4Y A;  4JRP A;  1D0Y A;  1M9S A;  4HCZ A;  5GAO n;  2C0O A;  2EJF A;  2WSF E;  2XDD A;  3EH1 A;  3VV0 A;  2QAZ A;  1Q95 G;  2HKN A;  2C0I A;  2LCS A;  3VS4 A;  1UDL A;  5GAO r;  5AYF A;  3PGG A;  1G83 A;  4RTV A;  4ZGE B;  3MEU A;  3M0U A;  1E7O A;  2DJZ A;  4ZN1 A;  2ED1 A;  4IUQ A;  3OW2 A;  1X27 A;  4LDY A;  2RHI A;  2CZ0 B;  3CEY A;  1QVG A;  4V2S A;  4RCC A;  3EGX B;  3CC7 A;  1VQ6 T;  4CRI A;  4OP0 A;  2KEA A;  4F16 A;  2K2V A;  2GTJ A;  4HXJ A;  2P0P A;  3MJX A;  4M77 C;  4M7D A;  2RNA A;  1PM3 A;  1LCK A;  1VQ4 Q;  4YTL A;  4BI8 B;  1JBM A;  2DL7 A;  3UA7 A;  3CMA Q;  4E7Z A;  2VYT A;  3EFO B;  2QA4 A;  3VJP A;  2FPF A;  1UGP B;  1KD1 U;  2DL8 A;  1Z9Q A;  3CME A;  2RHX A;  1NYF A;  2XHC A;  4J5Y A;  5GAO q;  3CCL A;  3CC2 A;  3TSW A;  2H3E B;  4E7L A;  1VQN T;  3PT9 A;  4M7D E;  1JB0 E;  2AZS A;  1TXQ A;  1V1C A;  1TOV A;  3RR6 A;  1VQ9 A;  1FX7 A;  3RBB B;  4BD3 A;  4OMQ A;  2DK3 A;  3O5Z A;  4XTY A;  4NL2 A;  1VQM T;  1OX8 A;  3RES A;  5KYU A;  3R6N A;  4BE0 A;  2IPO B;  3TCJ A;  2XK0 A;  4J9H A;  4BDZ A;  2YXY A;  2MOX A;  2DAQ A;  4WCI A;  4JRQ A;  1RAG B;  4C5I A;  4LDX A;  3GNG A;  3OSS C;  3NTK A;  4C92 B;  3M58 A;  3VRY A;  4E47 A;  2HMA A;  4A4G A;  2RH2 A;  5IHI A;  5HCK A;  1K9A A;  2KI7 A;  2DER A;  4LDV A;  2X4J A;  3OBW A;  2LQ8 A;  4M78 C;  2M16 A;  5LJ5 j;  4KGX B;  2FO0 A;  1X6G A;  3G71 Q;  2OTL Q;  5FRM A;  4M78 F;  1MGQ A;  1C0M A;  3H0F A;  3EFS A;  4DQ2 A;  4BDY A;  1UTI A;  1M90 R;  1N6A A;  2RQT A;  3LGL A;  2FZG B;  5CQX A;  1IXD A;  2DPP B;  2QQS A;  3I5S A;  1WHG A;  3SB2 A;  1WQW A;  1PCX A;  2V8J A;  2M0Y A;  1H8K A;  2JS2 A;  5GAO p;  1VQM A;  5GAN j;  1AT1 B;  2JTE A;  3OS5 A;  1QQJ A;  1C1A A;  1RUW A;  4DBH A;  2ROT A;  1FXX A;  2MK5 A;  2B8A A;  3VYH B;  3CCS Q;  3RKX A;  3FB9 A;  4F7U F;  5CKH A;  4LN2 A;  4M75 E;  1TH7 A;  2MIO A;  2XD0 A;  2QA4 Q;  5FU6 C;  2DTO A;  1EZZ B;  5CVI A;  2RF0 A;  2P0K A;  1Q81 U;  5FRN A;  2F2W A;  5HY6 A;  1UEC A;  4PJO E;  5CKF A;  3L2V A;  3AHU A;  4PJO D;  4ATO A;  2XG8 D;  2FPD A;  1AWJ A;  3RKW A;  3QKJ A;  2F5K A;  2E64 A;  2AT1 B;  2CP6 A;  4XU1 A;  1YJ9 Q;  1I81 A;  4PL6 A;  2ZPI B;  3NHN A;  4II1 A;  2PQW A;  5GAN 6;  5IH2 A;  2AIR B;  1WIE A;  4E7S A;  4C92 D;  5FU7 C;  1Y96 A;  1PD1 A;  5KH6 A;  4PJJ A;  5EC7 A;  1UJ0 A;  2DXC A;  1UGQ B;  4QVZ A;  3CMA A;  4M77 D;  2EGC A;  2LQW A;  4JRI A;  4J9I A;  2LMJ A;  2OAU A;  1VQP Q;  2E12 A;  3HSB A;  5CCA A;  4GY5 A;  4JS4 A;  4OMF B;  3UF4 A;  4ELY C;  1N27 A;  4A4E A;  5FWB A;  2VKN A;  3OYE A;  2BKD N;  3I5R A;  5KYN A;  2JJ9 A;  2CUD A;  5GAN 2;  1GFD A;  2DZ9 A;  2GBQ A;  2KT8 A;  5LJ3 f;  1Q7Y U;  4EMH A;  1M4Z A;  2B86 A;  2Z0W A;  3G1J A;  3PIO A;  2IVW A;  2KRM A;  3L2Z A;  4J9D A;  4M7A F;  1AZE A;  1OX9 A;  1WNL A;  4LD9 K;  2MWP A;  2E70 A;  3OQ5 A;  2BUD A;  2YDL A;  3E2U A;  4FL6 A;  2ZGW A;  1ZX6 A;  4KUL A;  3EH2 A;  1K0S A;  1T3L A;  4R55 A;  4DBQ A;  1KFZ A;  1QCN A;  1BI2 A;  4GLK A;  2ZCF B;  1PKT A;  2CZ7 B;  3NFC A;  4M7A C;  3ZL7 C;  4JS5 A;  3ASK A;  4AG1 C;  1YIT T;  3VS0 A;  4Y91 A;  1U1T A;  4C5G A;  1GRI A;  2HBW A;  3CPW A;  5J26 A;  1YJW Q;  2KR3 A;  4XTZ A;  1BI1 A;  3GF5 A;  4MZT A;  1M1K U;  4L5G A;  3V8K A;  3DLM A;  3N5B B;  3QDF A;  2H3J A;  4RKU E;  5I21 A;  1SSH A;  3CCM T;  3QXE B;  3JCM b;  4HVU A;  4ESR A;  2P4R A;  4HA8 A;  4IUR A;  3OYF A;  1V76 A;  2ZPB B;  3ULR B;  4PJO B;  2L3P A;  3I56 T;  5D7U A;  3JB9 G;  2EQI A;  3A8G B;  3I9Q A;  3VRZ A;  2QQA A;  4A53 A;  4N0A A;  1VIE A;  2YLC A;  2D9T A;  5D6X A;  1AWX A;  2KXC A;  5HK3 A;  3RKY A;  2DVJ A;  4Z88 A;  3G4S T;  2FB7 A;  3RER A;  4C8Q A;  4E7I A;  3SDZ A;  2J05 A;  5KYX B;  1P92 A;  2DRM A;  3TRE A;  4DBF A;  1Z9Z A;  2COY A;  1GBR A;  1M2V A;  4D8K A;  2M51 A;  2VC8 A;  1K1Z A;  4HCK A;  3X26 B;  1ZUY A;  3EG9 A;  1CSK A;  1GCQ C;  2E6N A;  4JZ3 A;  2VXF A;  3CCQ A;  4HCB A;  2K3B A;  1NJI R;  4JLG A;  2K57 A;  5EG2 A;  2EBP A;  1TWB A;  3QJY A;  4M75 C;  4DBR A;  2KQW A;  4N4I A;  3I55 T;  1NBE B;  3C0C A;  4FYW B;  1YJN A;  4ZTJ A;  1OZ2 A;  2E5K A;  2KE9 A;  4HT8 A;  3OY9 A;  3I56 Q;  3FDR A;  3RMQ A;  3ER0 A;  4Y28 E;  5FW9 A;  2R57 A;  1IRE B;  5KCO A;  2FZC B;  5I22 A;  4OMO A;  4J6W A;  4WTO B;  1KSW A;  5GMK i;  3CCU T;  2FG0 A;  4PFP A;  2FRY A;  4JLI A;  1VA7 A;  2FPE A;  4BUG A;  2E6Z A;  3M4G A;  3F70 A;  3M59 A;  4EDU A;  2ZAE A;  3CC7 T;  4MMK A;  3L2R A;  5GAN 8;  1KJW A;  3H0H A;  2E65 A;  1ZBJ A;  3C4S A;  2K6D A;  1VQ5 T;  3PMI A;  3A98 A;  1N8R U;  4M7D G;  5LL6 S;  1YJN Q;  4NL3 A;  2LX7 A;  3M57 A;  2L89 A;  1MV0 B;  4LDW A;  1VQ5 A;  1SF9 A;  2MWO A;  5GMK e;  3CPF A;  1IGU A;  3I55 Q;  1MV3 A;  1SG5 A;  1G5V A;  4C92 E;  1E6G A;  1W2B P;  1SHG A;  2RM4 A;  4J9F A;  1XTD A;  2K3X A;  4JJC A;  2HAX A;  3JAM E;  2HSE B;  2YUP A;  1X01 A;  3G6E T;  1KIK A;  3L2U A;  2L2P A;  2DL5 A;  2EW3 A;  5LJ5 d;  2LJ0 A;  2HCK A;  3S6W A;  4OB1 B;  1SEM A;  1BI0 A;  4M7D D;  3UDC A;  4L59 A;  2O88 A;  1M3A A;  3RUX A;  1OYX A;  4M75 A;  2RQW A;  3NGP A;  3P8H A; 
#chains in the Genus database with same CATH homology
 4M77 C;  4F7U B;  2ZPE B;  4M7D A;  1M1G A;  4IUP A;  3ZBD A;  5GAN d;  4C8Q F;  4YTL A;  1IZ6 A;  4BI8 B;  1YBY A;  1JBM A;  2HD0 A;  2C06 A;  5D6W A;  4J7I A;  5KCH A;  1HK9 A;  2VXE A;  5CIU A;  3X24 B;  1UGS B;  1ZHI A;  3OYY A;  4C92 C;  4F7U A;  2VYT A;  1H3Z A;  2K5I A;  1VIF A;  3A8M B;  1WGS A;  1I5L A;  2CKK A;  4NOY A;  2XDP A;  4M75 G;  5I2M A;  2QA4 A;  1KQ1 A;  2P4T A;  3E19 A;  3O8V A;  3VJP A;  1K9M C;  1UGP B;  1KD1 U;  4KUD K;  2OTL A;  3OBY A;  3CME A;  2RHX A;  2XHC A;  3OSV A;  4J5Y A;  5GAN 4;  3G71 A;  5GAO q;  3SWN A;  3INZ A;  4M7D F;  1QVG S;  3M54 A;  2QQ9 A;  3OA6 A;  1VQO T;  2O4X B;  2LC4 A;  3CC2 A;  3OYA A;  3CCJ T;  3CCL A;  2DEQ A;  2D6F A;  1KG1 A;  3MEA A;  4E7L A;  1VQN T;  2GF7 A;  3PT9 A;  5A0D A;  1B34 A;  2YRV A;  4J7F A;  4M7D E;  1JB0 E;  3CBP A;  2L5Q A;  3A5Z B;  3JCM c;  3G4S A;  5DY9 A;  4IKF A;  3MEW A;  3H6Z A;  4B9W A;  1R8O B;  5LJ5 g;  2JUF A;  4EMK B;  1VQ9 A;  1FX7 A;  2E41 A;  3FJP A;  1VQP T;  1VQK A;  4XTW A;  1WPY A;  4BD3 A;  4BY6 B;  2DK3 A;  2KSS A;  2RK1 A;  4FT4 A;  3KBG A;  4XTY A;  4FSX A;  1QP2 A;  4NL2 A;  5CR2 A;  1VQM T;  2A7Y A;  1VQO A;  2YHT A;  2CYZ B;  3M55 A;  5GAM d;  1YIJ T;  3OYD A;  3OYK A;  1I4K 1;  3RES A;  2K3Y A;  3M5A A;  4BE0 A;  4PJO A;  4QQ6 A;  3LH0 A;  2XK0 A;  3TCJ A;  5FU6 B;  1K8A C;  2RI5 A;  4OGE A;  1X6O A;  2CZ1 B;  4C8Q C;  2LDM A;  4M78 E;  2R5A A;  1Q86 U;  2RD1 A;  3OYI A;  2X35 A;  4BDZ A;  1YJW T;  2DIQ A;  2DAQ A;  4JRQ A;  2EYQ A;  1EIF A;  2ZPH B;  2GFA A;  4C5I A;  2I2L A;  4B9X A;  3J80 E;  3M4Y A;  1YIT A;  1LOJ A;  4LDX A;  3GNG A;  3OSS C;  5DLO A;  2D0Q B;  4VUB A;  3CCM A;  3JB9 J;  2FYK A;  5CK9 A;  3JRZ A;  1YJ9 T;  3NTK A;  4C92 B;  3M53 A;  3M58 A;  2LNV A;  4MML A;  2LT4 A;  3QYH B;  5CQY A;  2RI3 A;  4C5E A;  4E47 A;  3WVE B;  1JJ2 A;  4A4G A;  5FLX E;  4M78 B;  2RH2 A;  4C92 A;  4M77 B;  4LDV A;  2PUK B;  4IUV A;  2X4J A;  3OBW A;  4D6W A;  3BDL A;  1WJS A;  2LQ8 A;  4XU2 A;  4M78 C;  4BE2 A;  3CMA T;  4C8Q E;  1VQ6 A;  1PSE A;  2M16 A;  5LJ5 j;  2A3L A;  3M9Q A;  1FWZ A;  3OYH A;  2HBP A;  3VKI A;  4QW2 A;  4M75 D;  2X4W A;  5L8R E;  3UT1 A;  5FRM A;  4M78 F;  1K9M U;  3J81 E;  1MGQ A;  2R5M A;  3VU3 C;  3L1A A;  5LJ3 g;  3RMS A;  1KD1 C;  3EFS A;  4M75 F;  4DQ2 A;  4BDY A;  2VGN A;  2AHJ B;  1N6A A;  4OB0 B;  4PLI A;  3MEV A;  5LJ5 e;  2DVE A;  3LGL A;  5CQX A;  4BY6 C;  4J6X A;  3S3M A;  2DPP B;  2QQS A;  3H8Z A;  4DA4 A;  3SB2 A;  1WQW A;  3LX7 A;  1MHN A;  1XNI A;  4NS5 A;  2V8J A;  2PVO B;  5GAO p;  1VQM A;  2QA4 T;  5GAN j;  2JTM A;  4FM4 B;  3PIP A;  2LCL A;  3OS5 A;  3RIR A;  3HRU A;  1Y07 A;  5M9O A;  5A2Q E;  4P5N A;  3HFO A;  5A0L A;  2RB6 A;  4C0Z A;  1BIB A;  3M56 A;  1FXX A;  2L8D A;  3CCL T;  2QQB A;  1QVF S;  2B8A A;  3VYH B;  3CCJ A;  4ZGD B;  4C8Q D;  5GAN e;  1VQ8 T;  3CD6 A;  3RKX A;  5HKC A;  2CZ6 B;  5GMK l;  3CCV T;  3J7A F;  3FB9 A;  4EPC A;  4F7U F;  1JJ2 S;  2XKO C;  5CKH A;  3A8L B;  5GAO m;  4M75 E;  1TH7 A;  2XD0 A;  5FU6 C;  1KQS S;  2DTO A;  3PTA A;  3CXC S;  2ZPF B;  1VQP A;  1WJR A;  3LGF A;  5CVI A;  4C92 G;  2P0K A;  1Q81 U;  4KUI A;  3OS0 A;  1KC8 U;  5FRN A;  1O9S A;  2PVG B;  4JJN K;  5HY6 A;  4PJO E;  3OMC A;  4M77 G;  5CKF A;  3UWN A;  5LJ3 e;  2RHU A;  3L2V A;  1U8R A;  3AHU A;  3BY7 A;  3DB4 A;  4PJO D;  4ATO A;  4M7D B;  2XG8 D;  4XTX A;  5GAM h;  3OYC A;  1VQ4 T;  3RKW A;  3TEE A;  3QKJ A;  2F5K A;  1K8A U;  3KUF A;  2EJ9 A;  3FIF A;  5GAM j;  2E64 A;  3E9F A;  1M1F A;  4XU1 A;  3HHT B;  1I81 A;  1YHQ T;  1NPR A;  3HRT A;  4PL6 A;  3V7C A;  3C12 A;  3S3N A;  2ZPI B;  2IG0 A;  1YJ9 A;  2XDB A;  3QPH A;  3GNF B;  2K5L A;  2PQW A;  4II1 A;  3VUB A;  5GAN 6;  2QEX T;  4ZTF A;  3ZEH A;  1QVF A;  1SSF A;  3A8O B;  5GAM e;  1VUB A;  5GAN h;  1BYM A;  4C92 D;  5FU7 C;  1Y96 A;  4KT0 E;  4C0F A;  3QHS A;  1YJW A;  2OTJ A;  4XTV A;  5KH6 A;  2L3R A;  1G3Y A;  2DXC A;  4PLL A;  4C0D C;  1HXD A;  1UGQ B;  4QVZ A;  3CMA A;  2F5T X;  4M77 D;  3NTH A;  4E7H A;  4A54 A;  5LJ5 f;  1O75 A;  4OB3 B;  1VQ7 A;  4M7A E;  1QVP A;  1UEB A;  1JRI A;  2M0O A;  4JRI A;  4RG2 A;  4XQ3 A;  2QTX A;  4OB2 B;  3LWH A;  4LD6 A;  4M7A D;  1WQ7 A;  2OAU A;  2LCC A;  1N9S A;  3VYG A;  2E12 A;  5C0M A;  2MAM A;  4QQG A;  1W4S A;  3HSB A;  3JCM e;  3CCU A;  2DXT A;  5CCA A;  1ZQ1 A;  4GY5 A;  4JS4 A;  2GCX A;  4HKE A;  2V8I A;  4OMF B;  3CPW S;  4M7A A;  1AHJ B;  4ELY C;  1N27 A;  3JB9 F;  2Y4X A;  3QYG B;  3MP1 A;  4X34 A;  4A4E A;  3HP9 A;  3P8B B;  4OF1 A;  1WJQ A;  2GFU A;  1G3W A;  2BKD N;  3ZFJ A;  5KE2 A;  3OYE A;  5GAN 2;  5GAN f;  2DO3 A;  2EAY A;  2DZ9 A;  4F7U G;  2EKO A;  5LJ3 f;  1Q7Y U;  4EMH A;  1S72 A;  5HK0 A;  1Q86 C;  1DJ7 B;  1OZ3 A;  3LW5 E;  5DM7 R;  2KVQ G;  2XIC A;  1M4Z A;  4Q5W A;  1Y7X A;  2LQK A;  5LJ3 j;  3PIO A;  2IVW A;  2RI2 A;  3L2Z A;  3S3O A;  4M7A F;  3HL8 A;  2NLU A;  4JRK A;  1WNL A;  3JSC A;  2MWP A;  4LD9 K;  3JCM Q;  2E70 A;  1B34 B;  3BDU A;  1YHQ A;  3OQ5 A;  3C95 A;  2BUD A;  3MET A;  3BFM A;  2EWN A;  1NE8 A;  3VUZ A;  4JDS A;  4FL6 A;  2ZGW A;  5CAI A;  2MI6 A;  2FL7 A;  2KY9 A;  4MDW A;  3FEO A;  4KUL A;  5KE3 A;  4IUU A;  4ME7 A;  3CCS A;  2YLB A;  4C5H A;  3QBY A;  2VUB A;  3URG A;  4R55 A;  5FU7 B;  3CCR A;  3JCM P;  1YI2 A;  3OYL A;  1QP3 A;  3X25 B;  2EQJ A;  1BI2 A;  4GLK A;  3CCV A;  2ZCF B;  3LLR A;  2VV5 A;  2CZ7 B;  3NFC A;  4C0D B;  3V8J A;  1PSF A;  1KC8 C;  3CC4 A;  1NZ9 A;  4M7A C;  2JOY A;  4JS5 A;  3ASK A;  1YI2 T;  3QDR B;  4BE1 A;  1YIT T;  1Q82 U;  4IUT A;  3OS1 A;  4Y91 A;  1U1T A;  2G3R A;  3QII A;  3OYN A;  3CBM A;  4C5G A;  5GAN 7;  3SWN C;  3CPW A;  2EQK A;  2RK2 A;  3MCA B;  4LDU A;  5J26 A;  1LNX A;  4XTZ A;  1BI1 A;  3GF5 A;  4MZT A;  3OYJ A;  3SFM A;  4XAX B;  3V7S A;  5CKD A;  1M90 U;  1M1K U;  4R56 A;  3CCS T;  1GXI E;  4N0A C;  5GMK m;  3P8D A;  4L5G A;  3PFS A;  4XTU A;  3V8K A;  1KHI A;  2O4X A;  2CS7 A;  3DLM A;  4J6Y A;  3N5B B;  4M75 B;  2H3J A;  4RKU E;  3WVD B;  5I21 A;  3GIB A;  3V8L A;  1N8R C;  3CCM T;  3JCM J;  3CC4 T;  3QXE B;  3JCM b;  3GPL A;  5J39 A;  1BKB A;  4M7A G;  4HA8 A;  5IN1 A;  3HKS A;  2DIG A;  4IUR A;  4N4G A;  4FU6 A;  3OYF A;  4PKC C;  2ZPB B;  3JCM W;  1W2B S;  2HNI A;  2RJC A;  4N4H A;  2EQU A;  1NJI U;  2CGH A;  2GQV A;  4MZP A;  4PJO B;  1KQS A;  3I56 T;  2MF2 A;  3LYI A;  4JUV A;  3L2W A;  1I8F A;  3JB9 G;  1M8V A;  5LJ3 h;  3A8G B;  3QZ9 B;  2KMT A;  3G71 T;  1XQH A;  2QQA A;  3HFN A;  3V7R A;  2VGM A;  4A53 A;  4PJO C;  5GAM g;  4N0A A;  1VIE A;  3QSU A;  3CCE T;  3I56 A;  3HPW A;  3EFR A;  1Q7Y C;  2QXF A;  3GLX A;  3SD4 A;  4DOV A;  2YLC A;  2D9T A;  2HQX A;  4QVD A;  3GP8 A;  4CI0 C;  5D6X A;  4PJO F;  4FT2 A;  5HK3 A;  5IAY A;  2ZZD A;  4XK8 E;  4BI4 A;  4C8Q B;  3TU4 K;  1VQ7 T;  3RKY A;  5IT9 E;  2DTI A;  2EJG A;  1VQK T;  2F69 A;  3G4S T;  1K73 U;  2FB7 A;  4BB7 A;  2QQR A;  3RER A;  4BI3 A;  1XOV A;  3A8H B;  3BW1 A;  4XU3 A;  4M7A B;  4C8Q A;  4J8O A;  2PUO B;  2XU8 A;  3SDZ A;  4E7I A;  2MMP A;  1S72 T;  1VQN A;  3CD6 T;  3MO8 A;  1P92 A;  2E1H A;  3TRE A;  1Y71 A;  2QDY B;  4KBM B;  5A0G A;  2XI9 A;  5CKE A;  3JCM f;  2QI2 A;  1VQ8 A;  3JB9 I;  2VC8 A;  4HT9 A;  3QJ6 A;  3KXT A;  3X28 B;  4OVA A;  2V8K A;  3X26 B;  5J3B A;  3G6E A;  2E6N A;  1N9R A;  1BIA A;  2JTF A;  2VXF A;  3CCQ A;  4HCB A;  3G7Z A;  3QUI A;  4WF2 A;  3OMG A;  4JLG A;  4EMK C;  3OYM A;  4E7J A;  2K57 A;  2ZPG B;  2R58 A;  5EG2 A;  3SWN B;  4MZM A;  3T9N A;  2JVV A;  2Y4Y A;  2FVU A;  1M1K C;  3I55 A;  3CCQ T;  1VQL T;  4C0G A;  3FRN A;  4DOW A;  5GAN 5;  2RO0 A;  2DZC A;  1W2B A;  3JCM g;  2P0Q A;  3NTI A;  1RL2 A;  3QJY A;  2JN0 A;  4M75 C;  4RCB A;  4C92 F;  5GMK h;  1NPP A;  2E5Q A;  2KQW A;  4PJO G;  4ZN3 A;  4N4I A;  3I55 T;  1VQL A;  2RJF A;  4M77 F;  3JCM X;  3E1S A;  2K5F A;  3PMT A;  3OS2 A;  2JZ2 A;  4M78 D;  4ZTJ A;  4F7U E;  1YJN A;  1OZ2 A;  1D3B B;  1NJI C;  3MHX A;  2LTO A;  2PU9 B;  2RHZ A;  3OY9 A;  4HT8 A;  1KQ2 A;  2WSE E;  2LX9 A;  3MP8 A;  4QVC A;  1H64 1;  3GOX A;  1D3B A;  2M1H A;  3FLG A;  3FDR A;  2QEX A;  2DD5 A;  3RMQ A;  2XID A;  4O6J A;  3ER0 A;  1UB4 A;  2OTJ T;  3L42 A;  1QW1 A;  3Q1J A;  3C94 A;  4Y28 E;  1UGR B;  1Y96 B;  2R57 A;  5D6Y A;  2OTL T;  2PVD B;  3OYB A;  4C8Q G;  4BAC A;  1IRE B;  5KCO A;  5I2S A;  5DLQ E;  3JCM V;  3DB3 A;  5GAO l;  3FC3 A;  4J6W A;  4J83 A;  3LWI A;  4ELZ C;  2DXB A;  5GMK i;  3CCU T;  2FHD A;  2KK4 A;  1RI0 A;  3DKM A;  4RG8 A;  5GAN 3;  1Q82 C;  2KDS A;  4JLI A;  5LJ3 d;  4A4K A;  2WSC E;  3CCE A;  4BUG A;  3JCM h;  3CME T;  2DD4 A;  2E6Z A;  3M4G A;  1ZBX A;  3F70 A;  3M59 A;  4EDU A;  3UPU A;  3DLL A;  1M90 C;  3CC7 T;  1G3S A;  4MMK A;  4X9C A;  3L2R A;  3CBO A;  2HQE A;  3PNW C;  5FRO A;  4X9D A;  4QQD A;  3WXM B;  4EMK A;  2E65 A;  5GAN 8;  4RMO A;  3CXC A;  3C4S A;  2X4X A;  1M5Q 1;  5GAM f;  1VQ5 T;  3PMI A;  3HRS A;  1N8R U;  4M7D G;  2X4Y A;  5LL6 S;  3OW2 S;  4A4F A;  2DXU A;  2DTH A;  4NL3 A;  5LJ5 h;  1LJO A;  3E9G A;  1K73 C;  3M57 A;  3JB9 D;  2L89 A;  3ME9 A;  2K4Y A;  4L6V 5;  4LDW A;  1VQ5 A;  2MWO A;  3QG1 A;  3OB9 A;  3QO3 A;  4JRP A;  2Y90 A;  4ZGJ B;  2EQM A;  2KAF A;  5GMK e;  3CPF A;  1BI3 A;  4TVR A;  1M9S A;  4A4H A;  2RHY A;  4HCZ A;  2LVM A;  5GAO n;  2LRQ A;  1G3T A;  2EJF A;  3EAE A;  2WSF E;  2DKG A;  4OGC A;  3VV0 A;  2XDD A;  1G5V A;  2BIV A;  4C92 E;  4HCC A;  4E7K A;  4O5V A;  2EFI A;  4XU0 A;  5GMK j;  2RA2 A;  3CC2 T;  2RM4 A;  5GAO r;  5AYF A;  1XTD A;  2K3X A;  3PGG A;  2EIF A;  4M78 A;  4ZGE B;  5C6S A;  1YCY A;  3MEU A;  4M77 E;  2HAX A;  3JCM d;  1VQ4 A;  4M78 G;  3JB9 H;  4MDX A;  3JAM E;  3CCR T;  2DJZ A;  4ZN1 A;  1X01 A;  4IUQ A;  3L2Q A;  4Z02 A;  3G6E T;  3QZ5 B;  2WAC A;  3OW2 A;  2RJE A;  4LDY A;  3L2U A;  2E10 A;  1VQ9 T;  1KHC A;  4EMG A;  2RHI A;  1OI1 A;  1U1S A;  5LJ5 d;  3R6O A;  4M7D C;  2CZ0 B;  5CO7 A;  3X20 B;  5CKB A;  3S6W A;  3CEY A;  4OB1 B;  1YJN T;  5GAN g;  1QVG A;  4V2S A;  1BI0 A;  2LT1 A;  1Q81 C;  4RCC A;  3CC7 A;  1VQ6 T;  1V29 B;  2M9U A;  4CRI A;  4OP0 A;  1X75 C;  1YIJ A;  4M7D D;  3UDC A;  3OYG A;  4L59 A;  4FIB A;  2JNG A;  2O01 E;  3MP6 A;  4UC4 A;  3RUX A;  1OYX A;  4M75 A;  2K2V A;  4PNO A;  2RJD A;  2P0P A;  3P8H A;  4M77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...