2JNKA

Solution structure of a dockerin-containing modular pair from a family 84 glycoside hydrolase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
140
structure length
140
Chain Sequence
MDKTNLGELINQGKSLLDESVEGFNVGEYHKGAKDGLTVEINKAEEVFNKEDATEEEINLAKESLEGAIARFNSLLIEESTGDFNGNGKIDIGDLAMVSKNIGSTTNTSLDLNKDGSIDEYEISFINHRILNLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hyalurononglucosaminidase
publication title The solution structure of the C-terminal modular pair from Clostridium perfringens mu-toxin reveals a noncellulosomal dockerin module
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
total genus 25
structure length 140
sequence length 140
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2007-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00404 Dockerin_1 Dockerin type I domain
A PF07554 FIVAR FIVAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1330.10 Mainly Alpha Orthogonal Bundle Type 1 dockerin domain Dockerin domain 2jnkA02
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2jnkA01
4AZ5A 2B59B 5LXVB 2OZNB 2CCLB 2VN5B 4IU3B 1DAVA 4AZGA 4AZIA 2MTEA 2JNKA 2YLAA 3KCPA 4AZBA 4FZOA 1DAQA 5K39B 3UL4B 2VN6B 4DH2B 4IU2B 2OO2A 4WI0B 4UYPB 2PMRA 2YL5A 2Y3NB 4AZ6A 4FZPA 4AZ7A 4AZCA 2YL9A 5G5DB 3RPMA 2YL6A 4WKZA 2YLLA 4AZHA 4AZCB 4U3SB 4FL4A 2YL8A 4FL4C 1OHZB 4UYQB
chains in the Genus database with same CATH superfamily
2B59B 3SYVA 2Z0NA 1U00A 3L3OM 4FZOA 3DPPA 2Z0OA 1X03A 3L3PA 4EZXA 4IM3A 4EZSA 4WI0B 3QNJA 3CZNA 1QX1A 3SOGA 4R5GA 2MI7A 3RPMA 4DCNC 3BLBA 1SU6A 3QNIA 4IWPA 5LXVB 2C08A 3EJQA 1LQ7A 4H8SA 1DAQA 3C7NA 3KDRA 3DPQA 3HAIA 4UDYX 3LMFA 2LM0A 1ZWWA 3I39X 3BUQA 3LVTA 2F1BA 4FL4C 1OAOA 4IM2A 3ZEDA 1SU7A 2Z8YA 2JNKA 4JWCA 2GA9D 2NCZA 3QA8A 4DH2B 1MJGA 4I1QA 1WDZA 3D52A 1DKXA 4AZ6A 2RT6A 4AZ7A 2EX3B 1R33A 3DDFA 3OWGA 2GAFD 3BVWA 1GN9A 3BUPA 3DPOA 4EZVA 5K39B 3D2FA 3KAWA 2ELBA 2X3VA 4AZCA 2LXYA 2YIBA 5FIGA 3QE6A 4R5IA 4ATMA 3Q0KA 1QWUA 4WPEA 1HXKA 3T48A 1TQWA 4AZIA 2YIAA 1QWNA 1X04A 4IU2B 2ALWA 4AKVA 4NQIA 2V0OA 3BVTA 3BVUA 4AZHA 3QWEA 2FYVA 3HAJA 4WPCA 4AZ5A 2EFLA 4JWEA 4HR1A 3DX3A 1TQSA 3UL4B 3A98A 2PY6A 3VEBA 3DX2A 3DX4A 3ERCC 4F00A 4JL9A 2Z0VA 4IWQA 3CVRA 3O3OB 2QFFA 2F7RA 4H6HA 3HAHA 3VEAA 2F18A 3OK8A 3D4YA 3BVXA 2F1AA 4EZNA 5TKYA 2ZXQA 1W9MA 2F7QA 3D51A 2EWFA 2GF4A 4EZOA 1I49A 2D1LA 2VN5B 4JLCA 4KIKA 3KCPA 3D4ZA 2D4CA 4EZQA 5KBPA 4EZWA 2OO2A 4E81A 2Q12A 2YL5A 3BUDA 4U3SB 2YL8A 4JNFA 2ND0A 5C5BA 4IU3B 3B52X 3BUBA 4E3CA 4B9QA 3CAZA 1E1DA 3CKDA 3T4AG 3EJSA 3GI7A 1DKZA 3CV5A 3F7WA 3DYTA 5G5DB 2WYIA 2X3XA 2OW6A 1E2UA 4UYQB 2OBLA 1I4TA 3T47A 2KHOA 2QKWA 4AZBA 4JN4A 1E9VA 3CZSA 4IM0A 3B53X 4JWDA 4IW0A 4AZCB 3ER8C 1O7DB 1TQVA 4EZRA 1R5EA 3O3NB 4HYBA 3VKHA 1I4LA 4UDXX 4AVMA 4FZPA 2WINM 4D8JA 3T46A 4FM3A 4WKZA 2YLLA 1O7DC 1YWMA 4G6QA 4FL4A 2CCLB 3D2EA 4AZGA 1OA0A 2YLAA 2VN6B 1JQKA 3PLTA 4HR1B 2JNSA 3BVVA 1GNLA 3OHXM 1TQTA 2YIVX 3UITA 2YL6A 4NPHA 2OBMA 4JNEA 2F7OA 2YKTA 1OA1A 1I4DA 2OZNB 3FD9A 2WYHA 4R5LA 3BUIA 4PO2A 3RV0A 4R5JA 1TQUA 5E84A 1PS3A 2X5CA 3B51X 3KAVA 3LLLA 4EZZA 2PMRA 4R5KA 3Q84A 3DDGA 3EJRA 2RAIA 2YI8A 2X3WA 1OHZB 2OW7A 3ACOA 2RAKA 1SUFA 2QXLA 3M3WA 3DX0A 4KIKB 4EZPA 4DYLA 5FLEX 2EFKA 1ZYLA 3I04A 1R34A 2RAJA 4M0MA 4JWIA 4H6IA 2F7PA 4EZYA 3EJTA 1HTYA 4FZSA 4BNEA 5C5BB 1UPXA 1DKYA 2Y3NB 3EJPA 4EZUA 1URUA 3ER9B 3EJUA 3O3MB 2O0I1 3DX1A 2Q13A 2N3KA 1Y2OA 1DAVA 3I2WA 1SU8A 2MTEA 4F01A 1GNTA 2ND1A 3D50A 3I01A 4HY9A 4UYPB 3T49A 4EZTA 2YI9A 2YL9A 1HWWA 4NSWA 4IWOA 2FICA 3ABHA 3RV1A 3G9GA
chains in the Genus database with same CATH topology
4AZ5A 2B59B 5LXVB 2OZNB 2CCLB 2VN5B 4IU3B 1DAVA 4AZGA 4AZIA 2MTEA 2JNKA 2YLAA 3KCPA 4AZBA 4FZOA 1DAQA 5K39B 3UL4B 2VN6B 4DH2B 4IU2B 2OO2A 4WI0B 4UYPB 2PMRA 2YL5A 2Y3NB 4AZ6A 4FZPA 4AZ7A 4AZCA 2YL9A 5G5DB 3RPMA 2YL6A 4WKZA 2YLLA 4AZHA 4AZCB 4U3SB 4FL4A 2YL8A 4FL4C 1OHZB 4UYQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AZ5 A;  2B59 B;  5LXV B;  2OZN B;  2CCL B;  2VN5 B;  4IU3 B;  1DAV A;  4AZG A;  4AZI A;  2MTE A;  2JNK A;  2YLA A;  3KCP A;  4AZB A;  4FZO A;  1DAQ A;  5K39 B;  3UL4 B;  2VN6 B;  4DH2 B;  4IU2 B;  2OO2 A;  4WI0 B;  4UYP B;  2PMR A;  2YL5 A;  2Y3N B;  4AZ6 A;  4FZP A;  4AZ7 A;  4AZC A;  2YL9 A;  5G5D B;  3RPM A;  2YL6 A;  4WKZ A;  2YLL A;  4AZH A;  4AZC B;  4U3S B;  4FL4 A;  2YL8 A;  4FL4 C;  1OHZ B;  4UYQ B; 
#chains in the Genus database with same CATH topology
 2B59 B;  3SYV A;  2Z0N A;  1U00 A;  3L3O M;  4FZO A;  3DPP A;  2Z0O A;  1X03 A;  3L3P A;  4EZX A;  4IM3 A;  4EZS A;  4WI0 B;  3QNJ A;  3CZN A;  1QX1 A;  3SOG A;  4R5G A;  2MI7 A;  3RPM A;  4DCN C;  3BLB A;  1SU6 A;  3QNI A;  4IWP A;  5LXV B;  2C08 A;  3EJQ A;  1LQ7 A;  4H8S A;  1DAQ A;  3C7N A;  3KDR A;  3DPQ A;  3HAI A;  4UDY X;  3LMF A;  2LM0 A;  1ZWW A;  3I39 X;  3BUQ A;  3LVT A;  2F1B A;  4FL4 C;  1OAO A;  4IM2 A;  3ZED A;  1SU7 A;  2Z8Y A;  2JNK A;  4JWC A;  2GA9 D;  2NCZ A;  3QA8 A;  4DH2 B;  1MJG A;  4I1Q A;  1WDZ A;  3D52 A;  1DKX A;  4AZ6 A;  2RT6 A;  4AZ7 A;  2EX3 B;  1R33 A;  3DDF A;  3OWG A;  2GAF D;  3BVW A;  1GN9 A;  3BUP A;  3DPO A;  4EZV A;  5K39 B;  3D2F A;  3KAW A;  2ELB A;  2X3V A;  4AZC A;  2LXY A;  2YIB A;  5FIG A;  3QE6 A;  4R5I A;  4ATM A;  3Q0K A;  1QWU A;  4WPE A;  1HXK A;  3T48 A;  1TQW A;  4AZI A;  2YIA A;  1QWN A;  1X04 A;  4IU2 B;  2ALW A;  4AKV A;  4NQI A;  2V0O A;  3BVT A;  3BVU A;  4AZH A;  3QWE A;  2FYV A;  3HAJ A;  4WPC A;  4AZ5 A;  2EFL A;  4JWE A;  4HR1 A;  3DX3 A;  1TQS A;  3UL4 B;  3A98 A;  2PY6 A;  3VEB A;  3DX2 A;  3DX4 A;  3ERC C;  4F00 A;  4JL9 A;  2Z0V A;  4IWQ A;  3CVR A;  3O3O B;  2QFF A;  2F7R A;  4H6H A;  3HAH A;  3VEA A;  2F18 A;  3OK8 A;  3D4Y A;  3BVX A;  2F1A A;  4EZN A;  5TKY A;  2ZXQ A;  1W9M A;  2F7Q A;  3D51 A;  2EWF A;  2GF4 A;  4EZO A;  1I49 A;  2D1L A;  2VN5 B;  4JLC A;  4KIK A;  3KCP A;  3D4Z A;  2D4C A;  4EZQ A;  5KBP A;  4EZW A;  2OO2 A;  4E81 A;  2Q12 A;  2YL5 A;  3BUD A;  4U3S B;  2YL8 A;  4JNF A;  2ND0 A;  5C5B A;  4IU3 B;  3B52 X;  3BUB A;  4E3C A;  4B9Q A;  3CAZ A;  1E1D A;  3CKD A;  3T4A G;  3EJS A;  3GI7 A;  1DKZ A;  3CV5 A;  3F7W A;  3DYT A;  5G5D B;  2WYI A;  2X3X A;  2OW6 A;  1E2U A;  4UYQ B;  2OBL A;  1I4T A;  3T47 A;  2KHO A;  2QKW A;  4AZB A;  4JN4 A;  1E9V A;  3CZS A;  4IM0 A;  3B53 X;  4JWD A;  4IW0 A;  4AZC B;  3ER8 C;  1O7D B;  1TQV A;  4EZR A;  1R5E A;  3O3N B;  4HYB A;  3VKH A;  1I4L A;  4UDX X;  4AVM A;  4FZP A;  2WIN M;  4D8J A;  3T46 A;  4FM3 A;  4WKZ A;  2YLL A;  1O7D C;  1YWM A;  4G6Q A;  4FL4 A;  2CCL B;  3D2E A;  4AZG A;  1OA0 A;  2YLA A;  2VN6 B;  1JQK A;  3PLT A;  4HR1 B;  2JNS A;  3BVV A;  1GNL A;  3OHX M;  1TQT A;  2YIV X;  3UIT A;  2YL6 A;  4NPH A;  2OBM A;  4JNE A;  2F7O A;  2YKT A;  1OA1 A;  1I4D A;  2OZN B;  3FD9 A;  2WYH A;  4R5L A;  3BUI A;  4PO2 A;  3RV0 A;  4R5J A;  1TQU A;  5E84 A;  1PS3 A;  2X5C A;  3B51 X;  3KAV A;  3LLL A;  4EZZ A;  2PMR A;  4R5K A;  3Q84 A;  3DDG A;  3EJR A;  2RAI A;  2YI8 A;  2X3W A;  1OHZ B;  2OW7 A;  3ACO A;  2RAK A;  1SUF A;  2QXL A;  3M3W A;  3DX0 A;  4KIK B;  4EZP A;  4DYL A;  5FLE X;  2EFK A;  1ZYL A;  3I04 A;  1R34 A;  2RAJ A;  4M0M A;  4JWI A;  4H6I A;  2F7P A;  4EZY A;  3EJT A;  1HTY A;  4FZS A;  4BNE A;  5C5B B;  1UPX A;  1DKY A;  2Y3N B;  3EJP A;  4EZU A;  1URU A;  3ER9 B;  3EJU A;  3O3M B;  2O0I 1;  3DX1 A;  2Q13 A;  2N3K A;  1Y2O A;  1DAV A;  3I2W A;  1SU8 A;  2MTE A;  4F01 A;  1GNT A;  2ND1 A;  3D50 A;  3I01 A;  4HY9 A;  4UYP B;  3T49 A;  4EZT A;  2YI9 A;  2YL9 A;  1HWW A;  4NSW A;  4IWO A;  2FIC A;  3ABH A;  3RV1 A;  3G9G A; 
#chains in the Genus database with same CATH homology
 4AZ5 A;  2B59 B;  5LXV B;  2OZN B;  2CCL B;  2VN5 B;  4IU3 B;  1DAV A;  4AZG A;  4AZI A;  2MTE A;  2JNK A;  2YLA A;  3KCP A;  4AZB A;  4FZO A;  1DAQ A;  5K39 B;  3UL4 B;  2VN6 B;  4DH2 B;  4IU2 B;  2OO2 A;  4WI0 B;  4UYP B;  2PMR A;  2YL5 A;  2Y3N B;  4AZ6 A;  4FZP A;  4AZ7 A;  4AZC A;  2YL9 A;  5G5D B;  3RPM A;  2YL6 A;  4WKZ A;  2YLL A;  4AZH A;  4AZC B;  4U3S B;  4FL4 A;  2YL8 A;  4FL4 C;  1OHZ B;  4UYQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...