2JNKA

Solution structure of a dockerin-containing modular pair from a family 84 glycoside hydrolase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
140
structure length
140
Chain Sequence
MDKTNLGELINQGKSLLDESVEGFNVGEYHKGAKDGLTVEINKAEEVFNKEDATEEEINLAKESLEGAIARFNSLLIEESTGDFNGNGKIDIGDLAMVSKNIGSTTNTSLDLNKDGSIDEYEISFINHRILNLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hyalurononglucosaminidase
publication title The solution structure of the C-terminal modular pair from Clostridium perfringens mu-toxin reveals a noncellulosomal dockerin module
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
total genus 25
structure length 140
sequence length 140
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2007-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00404 Dockerin_1 Dockerin type I domain
A PF07554 FIVAR FIVAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1330.10 Mainly Alpha Orthogonal Bundle Type 1 dockerin domain Dockerin domain 2jnkA02
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2jnkA01
2VN5B 2OO2A 3KCPA 4AZCB 2JNKA 4FZPA 5LXVB 2YL6A 2MTEA 4IU2B 1DAVA 4AZ6A 4UYQB 4U3SB 5K39B 1DAQA 2YL5A 4AZCA 4AZGA 1OHZB 4AZIA 2Y3NB 4AZ7A 4FL4C 2CCLB 2YL8A 2VN6B 4WI0B 4UYPB 3RPMA 4AZHA 3UL4B 2OZNB 2PMRA 4FZOA 2B59B 2YL9A 5G5DB 2YLLA 4FL4A 4AZ5A 2YLAA 4IU3B 4WKZA 4AZBA 4DH2B
chains in the Genus database with same CATH superfamily
1SU7A 3FD9A 3EJTA 3DPPA 2ND0A 3KDRA 1OA0A 1URUA 1Y2OA 4U3SB 1DAQA 3Q84A 4HYBA 3T49A 3BUDA 2YIAA 1I4TA 5G5DB 3L3OM 3BVWA 1TQUA 2F7RA 4IU3B 3VEBA 3EJPA 2VN5B 3T48A 2YI8A 1O7DB 3BVVA 1SU6A 1DKYA 2FYVA 3CV5A 4M0MA 4HR1A 3O3OB 3B52X 4WI0B 3D52A 3LMFA 3DDGA 3CKDA 4E81A 5KBPA 5LXVB 3G9GA 1E9VA 2ALWA 4WPCA 5E84A 2O0I1 2OBMA 5FLEX 4UYPB 2OW7A 2NCZA 3ER9B 1YWMA 3OHXM 4ATMA 1OAOA 4AZBA 4JNFA 2F18A 3T47A 3EJQA 4HR1B 2Z0VA 1W9MA 2D1LA 2EX3B 2X3WA 4EZUA 1DKXA 3BLBA 2QKWA 1SUFA 1TQWA 1I4DA 1X04A 3DX4A 3DPOA 2OO2A 4JNEA 4FM3A 1O7DC 3QWEA 1UPXA 3DX1A 1R34A 3EJUA 3D2FA 3PLTA 3ABHA 4IM0A 3SYVA 4FZOA 3B53X 1TQTA 2Q13A 2WINM 2PY6A 3KAWA 1PS3A 4NQIA 4FZPA 1ZWWA 2MTEA 2GAFD 2EFKA 4R5JA 4AZCA 4R5LA 4AZ7A 2CCLB 1R33A 2ND1A 4AZHA 2MI7A 2OBLA 4H6IA 3T46A 2JNSA 4FL4A 2QFFA 3VEAA 3DX2A 4D8JA 3DX0A 4IU2B 1U00A 2RAKA 1R5EA 3VKHA 3QNJA 3HAJA 2LM0A 2RT6A 2RAJA 2LXYA 4WPEA 2GF4A 2FICA 3BUPA 3CZNA 1HWWA 4B9QA 4AZCB 1WDZA 3T4AG 2V0OA 2EWFA 3DDFA 4HY9A 4PO2A 1E2UA 4EZYA 3DX3A 1GNLA 2OZNB 4JN4A 3B51X 3OWGA 4EZXA 4F00A 4DH2B 4F01A 5FIGA 3BUIA 3CZSA 3BVXA 1GNTA 2F1BA 2ZXQA 3DYTA 4AZGA 4EZOA 5TKYA 1TQSA 3I01A 4JL9A 2YLLA 2D4CA 3ERCC 3BVUA 3GI7A 3D51A 2Q12A 3KAVA 3L3PA 1OA1A 3M3WA 5K39B 1QWUA 4AKVA 3HAHA 3C7NA 5C5BA 2YIVX 3CVRA 4IWQA 4BNEA 4R5GA 4NPHA 4G6QA 2WYHA 4FZSA 4UDXX 2YL6A 3SOGA 2F7OA 3LLLA 4AVMA 3OK8A 3BVTA 4FL4C 2C08A 4R5IA 4IW0A 2N3KA 2Z0NA 2X3XA 4NSWA 1JQKA 1HTYA 4H8SA 4JWIA 5C5BB 3O3MB 2F7QA 3D4ZA 3I04A 2YL5A 3CAZA 1SU8A 3O3NB 1QWNA 4EZTA 1E1DA 3ACOA 2PMRA 4UDYX 3I39X 1HXKA 1TQVA 4DCNC 3BUBA 3I2WA 3BUQA 3EJSA 4DYLA 4E3CA 4EZWA 1X03A 1MJGA 2QXLA 2WYIA 2YKTA 4JWEA 2VN6B 1I4LA 4IWPA 1LQ7A 2B59B 3D50A 2YL9A 4EZNA 3ER8C 4AZ5A 2YLAA 3DPQA 4EZRA 3Q0KA 3KCPA 4JLCA 2JNKA 4AZ6A 2YI9A 2ELBA 2KHOA 3QNIA 4AZIA 2Y3NB 2OW6A 1DKZA 3RV1A 4EZVA 4KIKA 2EFLA 3ZEDA 4IM3A 4IM2A 1DAVA 3F7WA 1I49A 4I1QA 3LVTA 3RV0A 4IWOA 1OHZB 2GA9D 2RAIA 4EZZA 2X5CA 3A98A 2F7PA 2Z8YA 3RPMA 4JWDA 1GN9A 4JWCA 3HAIA 2YIBA 2Z0OA 4EZPA 3QE6A 1ZYLA 4H6HA 2F1AA 3EJRA 3QA8A 4UYQB 3D4YA 4EZQA 4KIKB 3D2EA 1QX1A 4EZSA 2YL8A 3UL4B 3UITA 4R5KA 2X3VA 4WKZA
chains in the Genus database with same CATH topology
2VN5B 2OO2A 3KCPA 4AZCB 2JNKA 4FZPA 5LXVB 2YL6A 2MTEA 4IU2B 1DAVA 4AZ6A 4UYQB 4U3SB 5K39B 1DAQA 2YL5A 4AZCA 4AZGA 1OHZB 4AZIA 2Y3NB 4AZ7A 4FL4C 2CCLB 2YL8A 2VN6B 4WI0B 4UYPB 3RPMA 4AZHA 3UL4B 2OZNB 2PMRA 4FZOA 2B59B 2YL9A 5G5DB 2YLLA 4FL4A 4AZ5A 2YLAA 4IU3B 4WKZA 4AZBA 4DH2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VN5 B;  2OO2 A;  3KCP A;  4AZC B;  2JNK A;  4FZP A;  5LXV B;  2YL6 A;  2MTE A;  4IU2 B;  1DAV A;  4AZ6 A;  4UYQ B;  4U3S B;  5K39 B;  1DAQ A;  2YL5 A;  4AZC A;  4AZG A;  1OHZ B;  4AZI A;  2Y3N B;  4AZ7 A;  4FL4 C;  2CCL B;  2YL8 A;  2VN6 B;  4WI0 B;  4UYP B;  3RPM A;  4AZH A;  3UL4 B;  2OZN B;  2PMR A;  4FZO A;  2B59 B;  2YL9 A;  5G5D B;  2YLL A;  4FL4 A;  4AZ5 A;  2YLA A;  4IU3 B;  4WKZ A;  4AZB A;  4DH2 B; 
#chains in the Genus database with same CATH topology
 1SU7 A;  3FD9 A;  3EJT A;  3DPP A;  2ND0 A;  3KDR A;  1OA0 A;  1URU A;  1Y2O A;  4U3S B;  1DAQ A;  3Q84 A;  4HYB A;  3T49 A;  3BUD A;  2YIA A;  1I4T A;  5G5D B;  3L3O M;  3BVW A;  1TQU A;  2F7R A;  4IU3 B;  3VEB A;  3EJP A;  2VN5 B;  3T48 A;  2YI8 A;  1O7D B;  3BVV A;  1SU6 A;  1DKY A;  2FYV A;  3CV5 A;  4M0M A;  4HR1 A;  3O3O B;  3B52 X;  4WI0 B;  3D52 A;  3LMF A;  3DDG A;  3CKD A;  4E81 A;  5KBP A;  5LXV B;  3G9G A;  1E9V A;  2ALW A;  4WPC A;  5E84 A;  2O0I 1;  2OBM A;  5FLE X;  4UYP B;  2OW7 A;  2NCZ A;  3ER9 B;  1YWM A;  3OHX M;  4ATM A;  1OAO A;  4AZB A;  4JNF A;  2F18 A;  3T47 A;  3EJQ A;  4HR1 B;  2Z0V A;  1W9M A;  2D1L A;  2EX3 B;  2X3W A;  4EZU A;  1DKX A;  3BLB A;  2QKW A;  1SUF A;  1TQW A;  1I4D A;  1X04 A;  3DX4 A;  3DPO A;  2OO2 A;  4JNE A;  4FM3 A;  1O7D C;  3QWE A;  1UPX A;  3DX1 A;  1R34 A;  3EJU A;  3D2F A;  3PLT A;  3ABH A;  4IM0 A;  3SYV A;  4FZO A;  3B53 X;  1TQT A;  2Q13 A;  2WIN M;  2PY6 A;  3KAW A;  1PS3 A;  4NQI A;  4FZP A;  1ZWW A;  2MTE A;  2GAF D;  2EFK A;  4R5J A;  4AZC A;  4R5L A;  4AZ7 A;  2CCL B;  1R33 A;  2ND1 A;  4AZH A;  2MI7 A;  2OBL A;  4H6I A;  3T46 A;  2JNS A;  4FL4 A;  2QFF A;  3VEA A;  3DX2 A;  4D8J A;  3DX0 A;  4IU2 B;  1U00 A;  2RAK A;  1R5E A;  3VKH A;  3QNJ A;  3HAJ A;  2LM0 A;  2RT6 A;  2RAJ A;  2LXY A;  4WPE A;  2GF4 A;  2FIC A;  3BUP A;  3CZN A;  1HWW A;  4B9Q A;  4AZC B;  1WDZ A;  3T4A G;  2V0O A;  2EWF A;  3DDF A;  4HY9 A;  4PO2 A;  1E2U A;  4EZY A;  3DX3 A;  1GNL A;  2OZN B;  4JN4 A;  3B51 X;  3OWG A;  4EZX A;  4F00 A;  4DH2 B;  4F01 A;  5FIG A;  3BUI A;  3CZS A;  3BVX A;  1GNT A;  2F1B A;  2ZXQ A;  3DYT A;  4AZG A;  4EZO A;  5TKY A;  1TQS A;  3I01 A;  4JL9 A;  2YLL A;  2D4C A;  3ERC C;  3BVU A;  3GI7 A;  3D51 A;  2Q12 A;  3KAV A;  3L3P A;  1OA1 A;  3M3W A;  5K39 B;  1QWU A;  4AKV A;  3HAH A;  3C7N A;  5C5B A;  2YIV X;  3CVR A;  4IWQ A;  4BNE A;  4R5G A;  4NPH A;  4G6Q A;  2WYH A;  4FZS A;  4UDX X;  2YL6 A;  3SOG A;  2F7O A;  3LLL A;  4AVM A;  3OK8 A;  3BVT A;  4FL4 C;  2C08 A;  4R5I A;  4IW0 A;  2N3K A;  2Z0N A;  2X3X A;  4NSW A;  1JQK A;  1HTY A;  4H8S A;  4JWI A;  5C5B B;  3O3M B;  2F7Q A;  3D4Z A;  3I04 A;  2YL5 A;  3CAZ A;  1SU8 A;  3O3N B;  1QWN A;  4EZT A;  1E1D A;  3ACO A;  2PMR A;  4UDY X;  3I39 X;  1HXK A;  1TQV A;  4DCN C;  3BUB A;  3I2W A;  3BUQ A;  3EJS A;  4DYL A;  4E3C A;  4EZW A;  1X03 A;  1MJG A;  2QXL A;  2WYI A;  2YKT A;  4JWE A;  2VN6 B;  1I4L A;  4IWP A;  1LQ7 A;  2B59 B;  3D50 A;  2YL9 A;  4EZN A;  3ER8 C;  4AZ5 A;  2YLA A;  3DPQ A;  4EZR A;  3Q0K A;  3KCP A;  4JLC A;  2JNK A;  4AZ6 A;  2YI9 A;  2ELB A;  2KHO A;  3QNI A;  4AZI A;  2Y3N B;  2OW6 A;  1DKZ A;  3RV1 A;  4EZV A;  4KIK A;  2EFL A;  3ZED A;  4IM3 A;  4IM2 A;  1DAV A;  3F7W A;  1I49 A;  4I1Q A;  3LVT A;  3RV0 A;  4IWO A;  1OHZ B;  2GA9 D;  2RAI A;  4EZZ A;  2X5C A;  3A98 A;  2F7P A;  2Z8Y A;  3RPM A;  4JWD A;  1GN9 A;  4JWC A;  3HAI A;  2YIB A;  2Z0O A;  4EZP A;  3QE6 A;  1ZYL A;  4H6H A;  2F1A A;  3EJR A;  3QA8 A;  4UYQ B;  3D4Y A;  4EZQ A;  4KIK B;  3D2E A;  1QX1 A;  4EZS A;  2YL8 A;  3UL4 B;  3UIT A;  4R5K A;  2X3V A;  4WKZ A; 
#chains in the Genus database with same CATH homology
 2VN5 B;  2OO2 A;  3KCP A;  4AZC B;  2JNK A;  4FZP A;  5LXV B;  2YL6 A;  2MTE A;  4IU2 B;  1DAV A;  4AZ6 A;  4UYQ B;  4U3S B;  5K39 B;  1DAQ A;  2YL5 A;  4AZC A;  4AZG A;  1OHZ B;  4AZI A;  2Y3N B;  4AZ7 A;  4FL4 C;  2CCL B;  2YL8 A;  2VN6 B;  4WI0 B;  4UYP B;  3RPM A;  4AZH A;  3UL4 B;  2OZN B;  2PMR A;  4FZO A;  2B59 B;  2YL9 A;  5G5D B;  2YLL A;  4FL4 A;  4AZ5 A;  2YLA A;  4IU3 B;  4WKZ A;  4AZB A;  4DH2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...