2JO0A

The solution structure of the monomeric species of the c terminal domain of the ca protein of hiv-1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
MSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title Flexibility in HIV-1 Assembly Subunits: Solution Structure of the Monomeric C-Terminal Domain of the Capsid Protein
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 19
structure length 87
sequence length 87
ec nomenclature ec 3.4.23.16: HIV-1 retropepsin.
pdb deposition date 2007-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2jo0A00
3DS3A 3G28A 3G26A 4M0IA 3DTJA 1BAJA 4XRQA 1AUMA 3DPHA 2JYGA 4U0EA 5HGNA 4PH0A 1QRJA 3NTEA 2XT1A 2LF4A 3G21A 4XFXA 2ONTA 3G1IA 4COCA 4PH1A 3DS1A 3G1GA 3H4EA 1A8OA 4U0FA 4U0CA 2JO0A 3DS0A 4WYMA 5DCKA 3P05A 5HGLA 5HGOA 2BUOA 5JPAA 3MGEA 3DS5A 4U0DA 2EIAA 4XROA 1EOQA 4U0BA 3VRLC 3LRYA 2M8NA 3G29A 2M8LA 2L6EA 2XV6A 3DS4A 1A43A 3H47A 4IPYA 2XXMA 2KODA 4XFZA 1D1DA 2JYLA 4COPA 2M8PA 4XFYA 3G0VA 5I4TG 1EIAA 3DS2A 4QNBA 5HGMA 4U0AA 1E6JP
chains in the Genus database with same CATH superfamily
3GKLC 3WBHA 2LKIA 2NO8A 1MZ8A 1IUQA 1VQ5P 3G4SP 1VQLP 5BS2A 3G1IA 4COCA 2CQ8A 4U0CA 3GZLA 5HGOA 3HYBA 2EIAA 2PEMA 2L6EA 4IPYA 2JU1A 2JYLA 3LMOA 5HGMA 5EJDA 4U0EA 1VKUA 2FVEA 4PH0A 4PH1A 4QKOA 1UJZA 4WYMA 2Z44A 1KC8Q 2GZJA 3B5IA 2VLNA 1L0HA 3G0VA 2QA4P 3G28A 2XZ1C 1VQ7P 3H0DA 2GZEA 2JU2A 1K30A 4GR2A 3CCMP 1VQOP 1VQ8P 2N6YA 2L22A 3CMAP 2M5RA 3DS5A 2AFEA 2LTEA 1X3OA 1D1DA 2FQ2A 1YITP 4XFYA 3CD6P 5F2NA 2KG8A 4M0IA 3CCRP 1GPJA 2WPTA 1GXGA 1QRJA 1EMVA 3DS1A 2KG6A 1RNIA 3CCSP 1RO2A 2KODA 5I4TG 2EG5A 2EHTA 2GDXA 1Q7YQ 1VQ9P 1VQNP 1AUMA 5HV8A 2XT1A 3G1GA 3U43A 2VLQA 1IMPA 2DNWA 2OTLP 3M1MA 2CG5B 4XROA 3DS4A 1VQPP 4R0MA 1HQBA 3RG2A 1E6JP 2PENA 3CCUP 1UNKA 2CGQA 2K92A 5CZDB 1JJ2O 1YJWP 2JO0A 4IZ6A 5DCKA 2LOLA 2KGDA 5JPAA 1KLPA 2KR5A 2FAEA 3G26A 3DTJA 4XRQA 7CEIA 2JGPA 2JYGA 1Q82Q 3NTEA 2LF4A 2KOPA 4CA3A 1A8OA 1W2BO 1ZNVA 5HGLA 3VRLC 2FACA 2PEQA 3H47A 2N50A 4XFZA 3CCEP 4PXHB 1VHNA 2KGCA 1NQ4A 2L4BA 4HKGA 2K94A 2ERHA 2MVVA 2KOOA 1HY8A 2K0YA 3CC2P 2K0XA 2N6ZA 3I55P 2KGEA 4U0DA 1ACPA 2N5HA 1M74A 1Z6MA 2GZFA 2M8PA 2GDYA 1Q86Q 2MF4A 2EHSA 1F80D 5BS1A 3CCQP 2VLOA 5HVCA 2KOQA 2N98A 2MY5A 2FADA 2K2QA 3MGEA 1E0HA 3G6EP 2Z45A 2VSQA 2K5XA 1OR5A 2XXMA 2GDWA 2KWLA 2KORA 2JBGA 1BAJA 3CC7P 2PEJA 2K93A 2PEIA 1M90Q 1VQKP 4DG9A 2PEOA 4UHPB 1A43A 3EJEA 3GJNA 2VLPA 5F2KA 2BHVA 5KP7B 3OW2O 1RO0A 4BPFA 1ZMBA 2PNGA 2EFJA 1FR2A 2QNWA 3DS3A 1IMQA 3CE7A 2LIUA 2FVAA 1K8AQ 3EJBA 2FQ0A 4U0FA 1DV5A 2MD9A 4GR6A 1EOQA 4U0BA 1DNYA 1N8RQ 2LIWA 4COPA 2FHSC 3I56P 1YI2P 2KG9A 3CMEP 3B4QA 4QNBA 4U0AA 4BPHA 1K73Q 2XZ0D 2N5IA 2JQ4A 2GZGA 2FQ1A 5KP6B 2MVUA 4PWVB 3CCLP 1NJIQ 4H2YC 2BUOA 1AYIA 3LRYA 2M8NA 2P9XA 2M8LA 1VQ6P 2GZIA 1GXHA 1KD1Q 2OARA 1YJ9P 2MR8A 3NY7B 3CCVP 2KW2A 4H2XC 2KOSA 3EJDA 3RG6C 1T8KA 2KGAA 3CXCO 2L0QA 3HZQA 2MR7A 1M6EX 4MRTC 2L9FA 4H2WC 5HGNA 2OTJP 2Z46A 2AFDA 4XFXA 2PEKA 3G21A 1M6NA 3DS0A 4F37A 1YJNP 2FVFA 2PY8A 1S72P 2ROQA 1M1KQ 1QVFO 1EIAA 1YHQP 2QEXP 1BXIA 4BPGA 2GYKA 3H4EA 1QVGO 1L0IA 5KP8B 3G71P 2LL8A 3P05A 1YIJP 1AF8A 2AVAA 3CCJP 2JB0A 3G29A 2LPKA 2LMLA 2K0DX 3DS2A 3CC4P 2E1MA 2AF8A 1CEIA 3DPHA 1VQMP 3E2DA 2ONTA 1VQ4P 3CPWO 1K9MQ 2CWOA 2X2BA 2CNRA 3GZMA 5EW5E 2XV6A 5F2OA 4NEOA 1KQSO 1Q81Q 3Q20A 2JAZA 2DGYA
chains in the Genus database with same CATH topology
1YJ9P 1Q7YQ 3WBHA 5BS1A 1VQ9P 3CCVP 1VQNP 3CCQP 1AUMA 1VQ5P 1IUQA 2XT1A 3G4SP 1VQLP 5BS2A 3G1IA 4COCA 3G1GA 4U0CA 5HGOA 2OTLP 3M1MA 3RG6C 3HYBA 3MGEA 2EIAA 2PEMA 4XROA 3G6EP 3CXCO 2Z45A 2L6EA 3DS4A 4IPYA 1VQPP 2XXMA 2JYLA 3HZQA 5HGMA 1E6JP 2PENA 3CCUP 1M6EX 1BAJA 4U0EA 5HGNA 2OTJP 2Z46A 4PH0A 4XFXA 2PEKA 2PEJA 3G21A 3CC7P 1M6NA 4PH1A 1JJ2O 2PEIA 1YJWP 1M90Q 2JO0A 3DS0A 4WYMA 5DCKA 2Z44A 1YJNP 2PY8A 5JPAA 1KC8Q 1VQKP 1S72P 2PEOA 1M1KQ 1A43A 3B5IA 5F2KA 1QVFO 2BHVA 3OW2O 3G0VA 1RO0A 1EIAA 1ZMBA 1YHQP 2EFJA 2QEXP 2QA4P 3DS3A 3G28A 3G26A 3H0DA 1VQ7P 3DTJA 4XRQA 1K30A 4GR2A 3CCMP 2JYGA 1Q82Q 3NTEA 1VQOP 2LF4A 1VQ8P 1K8AQ 3H4EA 1A8OA 4U0FA 1QVGO 1W2BO 3G71P 5HGLA 3P05A 3CMAP 1YIJP 3DS5A 4GR6A 3VRLC 3CCJP 1EOQA 4U0BA 2PEQA 3G29A 3H47A 1N8RQ 4XFZA 1D1DA 4COPA 3I56P 1YI2P 1YITP 3CCEP 4XFYA 3CMEP 5F2NA 3CD6P 3DS2A 4QNBA 3CC4P 2E1MA 4U0AA 1K73Q 4M0IA 3CCRP 3DPHA 3CCLP 1QRJA 3CC2P 1VQMP 3E2DA 2ONTA 3DS1A 1VQ4P 3CPWO 1K9MQ 1NJIQ 3I55P 2CWOA 1RNIA 2BUOA 4U0DA 3CCSP 3LRYA 1RO2A 2M8NA 2P9XA 2M8LA 2XV6A 5F2OA 1M74A 2KODA 1KQSO 2M8PA 3Q20A 1Q81Q 5I4TG 2EG5A 1VQ6P 1Q86Q 1KD1Q 2DGYA 2OARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DS3 A;  3G28 A;  3G26 A;  4M0I A;  3DTJ A;  1BAJ A;  4XRQ A;  1AUM A;  3DPH A;  2JYG A;  4U0E A;  5HGN A;  4PH0 A;  1QRJ A;  3NTE A;  2XT1 A;  2LF4 A;  3G21 A;  4XFX A;  2ONT A;  3G1I A;  4COC A;  4PH1 A;  3DS1 A;  3G1G A;  3H4E A;  1A8O A;  4U0F A;  4U0C A;  2JO0 A;  3DS0 A;  4WYM A;  5DCK A;  3P05 A;  5HGL A;  5HGO A;  2BUO A;  5JPA A;  3MGE A;  3DS5 A;  4U0D A;  2EIA A;  4XRO A;  1EOQ A;  4U0B A;  3VRL C;  3LRY A;  2M8N A;  3G29 A;  2M8L A;  2L6E A;  2XV6 A;  3DS4 A;  1A43 A;  3H47 A;  4IPY A;  2XXM A;  2KOD A;  4XFZ A;  1D1D A;  2JYL A;  4COP A;  2M8P A;  4XFY A;  3G0V A;  5I4T G;  1EIA A;  3DS2 A;  4QNB A;  5HGM A;  4U0A A;  1E6J P; 
#chains in the Genus database with same CATH topology
 3GKL C;  3WBH A;  2LKI A;  2NO8 A;  1MZ8 A;  1IUQ A;  1VQ5 P;  3G4S P;  1VQL P;  5BS2 A;  3G1I A;  4COC A;  2CQ8 A;  4U0C A;  3GZL A;  5HGO A;  3HYB A;  2EIA A;  2PEM A;  2L6E A;  4IPY A;  2JU1 A;  2JYL A;  3LMO A;  5HGM A;  5EJD A;  4U0E A;  1VKU A;  2FVE A;  4PH0 A;  4PH1 A;  4QKO A;  1UJZ A;  4WYM A;  2Z44 A;  1KC8 Q;  2GZJ A;  3B5I A;  2VLN A;  1L0H A;  3G0V A;  2QA4 P;  3G28 A;  2XZ1 C;  1VQ7 P;  3H0D A;  2GZE A;  2JU2 A;  1K30 A;  4GR2 A;  3CCM P;  1VQO P;  1VQ8 P;  2N6Y A;  2L22 A;  3CMA P;  2M5R A;  3DS5 A;  2AFE A;  2LTE A;  1X3O A;  1D1D A;  2FQ2 A;  1YIT P;  4XFY A;  3CD6 P;  5F2N A;  2KG8 A;  4M0I A;  3CCR P;  1GPJ A;  2WPT A;  1GXG A;  1QRJ A;  1EMV A;  3DS1 A;  2KG6 A;  1RNI A;  3CCS P;  1RO2 A;  2KOD A;  5I4T G;  2EG5 A;  2EHT A;  2GDX A;  1Q7Y Q;  1VQ9 P;  1VQN P;  1AUM A;  5HV8 A;  2XT1 A;  3G1G A;  3U43 A;  2VLQ A;  1IMP A;  2DNW A;  2OTL P;  3M1M A;  2CG5 B;  4XRO A;  3DS4 A;  1VQP P;  4R0M A;  1HQB A;  3RG2 A;  1E6J P;  2PEN A;  3CCU P;  1UNK A;  2CGQ A;  2K92 A;  5CZD B;  1JJ2 O;  1YJW P;  2JO0 A;  4IZ6 A;  5DCK A;  2LOL A;  2KGD A;  5JPA A;  1KLP A;  2KR5 A;  2FAE A;  3G26 A;  3DTJ A;  4XRQ A;  7CEI A;  2JGP A;  2JYG A;  1Q82 Q;  3NTE A;  2LF4 A;  2KOP A;  4CA3 A;  1A8O A;  1W2B O;  1ZNV A;  5HGL A;  3VRL C;  2FAC A;  2PEQ A;  3H47 A;  2N50 A;  4XFZ A;  3CCE P;  4PXH B;  1VHN A;  2KGC A;  1NQ4 A;  2L4B A;  4HKG A;  2K94 A;  2ERH A;  2MVV A;  2KOO A;  1HY8 A;  2K0Y A;  3CC2 P;  2K0X A;  2N6Z A;  3I55 P;  2KGE A;  4U0D A;  1ACP A;  2N5H A;  1M74 A;  1Z6M A;  2GZF A;  2M8P A;  2GDY A;  1Q86 Q;  2MF4 A;  2EHS A;  1F80 D;  5BS1 A;  3CCQ P;  2VLO A;  5HVC A;  2KOQ A;  2N98 A;  2MY5 A;  2FAD A;  2K2Q A;  3MGE A;  1E0H A;  3G6E P;  2Z45 A;  2VSQ A;  2K5X A;  1OR5 A;  2XXM A;  2GDW A;  2KWL A;  2KOR A;  2JBG A;  1BAJ A;  3CC7 P;  2PEJ A;  2K93 A;  2PEI A;  1M90 Q;  1VQK P;  4DG9 A;  2PEO A;  4UHP B;  1A43 A;  3EJE A;  3GJN A;  2VLP A;  5F2K A;  2BHV A;  5KP7 B;  3OW2 O;  1RO0 A;  4BPF A;  1ZMB A;  2PNG A;  2EFJ A;  1FR2 A;  2QNW A;  3DS3 A;  1IMQ A;  3CE7 A;  2LIU A;  2FVA A;  1K8A Q;  3EJB A;  2FQ0 A;  4U0F A;  1DV5 A;  2MD9 A;  4GR6 A;  1EOQ A;  4U0B A;  1DNY A;  1N8R Q;  2LIW A;  4COP A;  2FHS C;  3I56 P;  1YI2 P;  2KG9 A;  3CME P;  3B4Q A;  4QNB A;  4U0A A;  4BPH A;  1K73 Q;  2XZ0 D;  2N5I A;  2JQ4 A;  2GZG A;  2FQ1 A;  5KP6 B;  2MVU A;  4PWV B;  3CCL P;  1NJI Q;  4H2Y C;  2BUO A;  1AYI A;  3LRY A;  2M8N A;  2P9X A;  2M8L A;  1VQ6 P;  2GZI A;  1GXH A;  1KD1 Q;  2OAR A;  1YJ9 P;  2MR8 A;  3NY7 B;  3CCV P;  2KW2 A;  4H2X C;  2KOS A;  3EJD A;  3RG6 C;  1T8K A;  2KGA A;  3CXC O;  2L0Q A;  3HZQ A;  2MR7 A;  1M6E X;  4MRT C;  2L9F A;  4H2W C;  5HGN A;  2OTJ P;  2Z46 A;  2AFD A;  4XFX A;  2PEK A;  3G21 A;  1M6N A;  3DS0 A;  4F37 A;  1YJN P;  2FVF A;  2PY8 A;  1S72 P;  2ROQ A;  1M1K Q;  1QVF O;  1EIA A;  1YHQ P;  2QEX P;  1BXI A;  4BPG A;  2GYK A;  3H4E A;  1QVG O;  1L0I A;  5KP8 B;  3G71 P;  2LL8 A;  3P05 A;  1YIJ P;  1AF8 A;  2AVA A;  3CCJ P;  2JB0 A;  3G29 A;  2LPK A;  2LML A;  2K0D X;  3DS2 A;  3CC4 P;  2E1M A;  2AF8 A;  1CEI A;  3DPH A;  1VQM P;  3E2D A;  2ONT A;  1VQ4 P;  3CPW O;  1K9M Q;  2CWO A;  2X2B A;  2CNR A;  3GZM A;  5EW5 E;  2XV6 A;  5F2O A;  4NEO A;  1KQS O;  1Q81 Q;  3Q20 A;  2JAZ A;  2DGY A; 
#chains in the Genus database with same CATH homology
 1YJ9 P;  1Q7Y Q;  3WBH A;  5BS1 A;  1VQ9 P;  3CCV P;  1VQN P;  3CCQ P;  1AUM A;  1VQ5 P;  1IUQ A;  2XT1 A;  3G4S P;  1VQL P;  5BS2 A;  3G1I A;  4COC A;  3G1G A;  4U0C A;  5HGO A;  2OTL P;  3M1M A;  3RG6 C;  3HYB A;  3MGE A;  2EIA A;  2PEM A;  4XRO A;  3G6E P;  3CXC O;  2Z45 A;  2L6E A;  3DS4 A;  4IPY A;  1VQP P;  2XXM A;  2JYL A;  3HZQ A;  5HGM A;  1E6J P;  2PEN A;  3CCU P;  1M6E X;  1BAJ A;  4U0E A;  5HGN A;  2OTJ P;  2Z46 A;  4PH0 A;  4XFX A;  2PEK A;  2PEJ A;  3G21 A;  3CC7 P;  1M6N A;  4PH1 A;  1JJ2 O;  2PEI A;  1YJW P;  1M90 Q;  2JO0 A;  3DS0 A;  4WYM A;  5DCK A;  2Z44 A;  1YJN P;  2PY8 A;  5JPA A;  1KC8 Q;  1VQK P;  1S72 P;  2PEO A;  1M1K Q;  1A43 A;  3B5I A;  5F2K A;  1QVF O;  2BHV A;  3OW2 O;  3G0V A;  1RO0 A;  1EIA A;  1ZMB A;  1YHQ P;  2EFJ A;  2QEX P;  2QA4 P;  3DS3 A;  3G28 A;  3G26 A;  3H0D A;  1VQ7 P;  3DTJ A;  4XRQ A;  1K30 A;  4GR2 A;  3CCM P;  2JYG A;  1Q82 Q;  3NTE A;  1VQO P;  2LF4 A;  1VQ8 P;  1K8A Q;  3H4E A;  1A8O A;  4U0F A;  1QVG O;  1W2B O;  3G71 P;  5HGL A;  3P05 A;  3CMA P;  1YIJ P;  3DS5 A;  4GR6 A;  3VRL C;  3CCJ P;  1EOQ A;  4U0B A;  2PEQ A;  3G29 A;  3H47 A;  1N8R Q;  4XFZ A;  1D1D A;  4COP A;  3I56 P;  1YI2 P;  1YIT P;  3CCE P;  4XFY A;  3CME P;  5F2N A;  3CD6 P;  3DS2 A;  4QNB A;  3CC4 P;  2E1M A;  4U0A A;  1K73 Q;  4M0I A;  3CCR P;  3DPH A;  3CCL P;  1QRJ A;  3CC2 P;  1VQM P;  3E2D A;  2ONT A;  3DS1 A;  1VQ4 P;  3CPW O;  1K9M Q;  1NJI Q;  3I55 P;  2CWO A;  1RNI A;  2BUO A;  4U0D A;  3CCS P;  3LRY A;  1RO2 A;  2M8N A;  2P9X A;  2M8L A;  2XV6 A;  5F2O A;  1M74 A;  2KOD A;  1KQS O;  2M8P A;  3Q20 A;  1Q81 Q;  5I4T G;  2EG5 A;  1VQ6 P;  1Q86 Q;  1KD1 Q;  2DGY A;  2OAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...