2JO0A

The solution structure of the monomeric species of the c terminal domain of the ca protein of hiv-1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
MSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Flexibility in HIV-1 Assembly Subunits: Solution Structure of the Monomeric C-Terminal Domain of the Capsid Protein
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Gag-Pol polyprotein
total genus 19
structure length 87
sequence length 87
ec nomenclature ec 3.4.23.16: HIV-1 retropepsin.
pdb deposition date 2007-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2jo0A00
4U0DA 1AUMA 2LF4A 3DS0A 2M8LA 3NTEA 4U0FA 1QRJA 4M0IA 5HGOA 5I4TG 3P05A 1A8OA 1EOQA 5HGNA 3DS5A 4IPYA 3G28A 1BAJA 2M8NA 4XFXA 4U0CA 4U0EA 4COPA 3DS3A 3H4EA 3DS2A 1A43A 4XFYA 4PH0A 2JO0A 3G21A 4PH1A 4WYMA 2ONTA 2JYLA 3LRYA 3H47A 2M8PA 1EIAA 4XROA 4XRQA 3MGEA 3G0VA 2L6EA 1D1DA 4COCA 2XV6A 2XT1A 3VRLC 2EIAA 3DTJA 3G1GA 3G29A 5DCKA 4XFZA 2BUOA 2JYGA 4U0BA 4QNBA 3G26A 3DPHA 5HGMA 2KODA 5JPAA 3G1IA 4U0AA 2XXMA 3DS4A 1E6JP 5HGLA 3DS1A
chains in the Genus database with same CATH superfamily
3M1MA 3CD6P 4U0FA 2WPTA 1IMQA 1K30A 1VQLP 1BAJA 2EG5A 2M8NA 2KOQA 3B5IA 3OW2O 2GDXA 3GZMA 1ZMBA 2KOSA 3CCEP 1KD1Q 1D1DA 4COCA 2EFJA 2EIAA 1Q82Q 2KGEA 1AF8A 1Q86Q 2VSQA 3CCMP 2XXMA 1F80D 3DS2A 2MY5A 4F37A 2MF4A 3LRYA 3H47A 1VQ4P 4MRTC 2QA4P 2VLQA 3E2DA 2JU2A 2ROQA 2LMLA 2LL8A 2AFEA 2DGYA 2AFDA 3DS3A 4PH1A 1YHQP 3MGEA 2FQ2A 1OR5A 2KORA 2XV6A 2Z44A 3G1GA 5KP7B 2K5XA 2KW2A 3DS4A 1E6JP 4U0DA 5KP8B 4H2XC 4DG9A 2GDYA 3CCSP 2K92A 1RNIA 2JYLA 2ONTA 2XZ1C 2L22A 2K0DX 2PEJA 3CCUP 2GZIA 1T8KA 2L6EA 2LPKA 1VQPP 3CPWO 2JYGA 4QNBA 5HVCA 5JPAA 3NY7B 2GYKA 5KP6B 2FVEA 1GXHA 1QRJA 1VQ9P 2K93A 3I55P 3WBHA 2N6ZA 4IPYA 2JB0A 2JU1A 3CMEP 1YITP 2VLNA 2FVFA 4XRQA 1DNYA 1M90Q 3RG2A 4IZ6A 2GZGA 2LOLA 3DTJA 2OTLP 5DCKA 2E1MA 1L0HA 2KGAA 2FQ1A 3CC4P 2KWLA 1Q7YQ 3EJEA 5HGOA 2CWOA 2PY8A 2FQ0A 1UNKA 3EJDA 5HGNA 2FHSC 3DS5A 2N50A 2L4BA 4U0EA 4COPA 4BPFA 2PEMA 2M8PA 2PEQA 2JQ4A 1W2BO 2JBGA 2QNWA 3VRLC 2KODA 4GR6A 1BXIA 1QVFO 2MR8A 3P05A 2K94A 1K9MQ 2JGPA 1UJZA 2KR5A 2L9FA 2K0YA 2L0QA 4BPHA 1RO2A 1VQOP 1K8AQ 1VQNP 5EJDA 3EJBA 2LKIA 3HYBA 4U0BA 2PENA 3G26A 1E0HA 2KG9A 2N5HA 2M8LA 1RO0A 1KLPA 2VLPA 2OARA 3H4EA 3CE7A 2JO0A 4PXHB 1VQ8P 5F2KA 2Z45A 1DV5A 3G29A 3RG6C 2LIUA 1VQ6P 5HGLA 1VKUA 1A8OA 3LMOA 2KG6A 1A43A 2MVVA 1NJIQ 1M6EX 1HY8A 3GZLA 1AYIA 2KOOA 1YJWP 1AUMA 3DS0A 5I4TG 4NEOA 1Z6MA 1EOQA 2CGQA 4XFYA 4H2WC 2FVAA 2LTEA 2N6YA 1GPJA 3Q20A 2XT1A 2CQ8A 2CG5B 5BS2A 1JJ2O 7CEIA 3NTEA 3CMAP 3B4QA 5CZDB 3G4SP 2BHVA 3I56P 3G71P 1HQBA 2X2BA 4PWVB 2BUOA 1ACPA 1X3OA 5HGMA 2MVUA 2LIWA 2LF4A 5HV8A 1YJNP 2GZFA 2KG8A 2N5IA 2XZ0D 3CC7P 1YI2P 3G28A 1YIJP 2PEKA 4QKOA 4PH0A 3G21A 4GR2A 2MD9A 4UHPB 2FAEA 3GKLC 2GZJA 1Q81Q 3DS1A 2AVAA 1L0IA 4R0MA 3CXCO 1ZNVA 1IMPA 2EHSA 4U0CA 2KGDA 3G6EP 2P9XA 3CCRP 3CC2P 2VLOA 1N8RQ 4XROA 5BS1A 1M6NA 3CCJP 3HZQA 2KOPA 1S72P 1GXGA 4U0AA 2MR7A 2PEOA 3CCVP 1MZ8A 2PNGA 4XFXA 4BPGA 2ERHA 2K2QA 2QEXP 1K73Q 1FR2A 2NO8A 2KGCA 2CNRA 3GJNA 4CA3A 3U43A 4M0IA 2GDWA 2AF8A 4HKGA 1VHNA 4WYMA 1EMVA 1M74A 1EIAA 2PEIA 1VQMP 1YJ9P 2EHTA 1NQ4A 3H0DA 1VQ7P 4XFZA 1KQSO 1VQ5P 2Z46A 2FADA 2DNWA 1VQKP 1CEIA 4H2YC 3CCQP 2GZEA 5F2OA 2FACA 5EW5E 1KC8Q 2N98A 3G0VA 2K0XA 2M5RA 2OTJP 3G1IA 1M1KQ 3CCLP 1QVGO 2JAZA 3DPHA 1IUQA 5F2NA
chains in the Genus database with same CATH topology
3M1MA 3CD6P 4U0FA 1QRJA 1VQ9P 1A8OA 3I55P 3CXCO 1K30A 3WBHA 1VQLP 4IPYA 1BAJA 2EG5A 2M8NA 3B5IA 4U0CA 1A43A 3OW2O 3G6EP 2P9XA 3CMEP 1ZMBA 1YITP 3CCRP 3CC2P 3CCEP 1N8RQ 4XROA 4XRQA 5BS1A 1M6NA 3CCJP 1KD1Q 1M90Q 1D1DA 4COCA 1M6EX 2EFJA 5F2NA 1NJIQ 2EIAA 3DTJA 5DCKA 3HZQA 1Q82Q 2OTLP 2E1MA 1Q86Q 3CCMP 1S72P 3CC4P 4U0AA 2XXMA 1Q7YQ 1YJWP 3DS2A 1AUMA 3DS0A 2PEOA 3CCVP 5HGOA 5I4TG 2CWOA 2PY8A 1EOQA 5HGNA 3DS5A 4XFXA 4U0EA 4COPA 4XFYA 3LRYA 3H47A 2PEMA 1VQ4P 2M8PA 2QEXP 1K73Q 2PEQA 2QA4P 1W2BO 3Q20A 2XT1A 3VRLC 5BS2A 2KODA 3E2DA 4GR6A 1JJ2O 1QVFO 3NTEA 3CMAP 4M0IA 3P05A 1K9MQ 3G4SP 2BHVA 2DGYA 3I56P 3G71P 3DS3A 4PH1A 4WYMA 1YHQP 1M74A 1EIAA 2PEIA 3MGEA 1VQOP 1RO2A 1VQMP 1K8AQ 2XV6A 1VQNP 3H0DA 2Z44A 3G1GA 1YJ9P 1VQ7P 3HYBA 4XFZA 2BUOA 1KQSO 4U0BA 2PENA 2Z46A 3G26A 5HGMA 1VQ5P 3DS4A 1E6JP 4U0DA 2LF4A 2M8LA 1YJNP 1VQKP 3CC7P 1YI2P 1RO0A 3CCSP 3CCQP 3G28A 1YIJP 5F2OA 2OARA 2PEKA 3H4EA 4PH0A 2JO0A 3G21A 1RNIA 2JYLA 2ONTA 1VQ8P 2PEJA 4GR2A 3CCUP 5F2KA 1KC8Q 2Z45A 3G0VA 2L6EA 2OTJP 1M1KQ 1VQPP 3G29A 3CPWO 3CCLP 3RG6C 2JYGA 1Q81Q 1VQ6P 1QVGO 4QNBA 3DPHA 1IUQA 5JPAA 3G1IA 5HGLA 3DS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0D A;  1AUM A;  2LF4 A;  3DS0 A;  2M8L A;  3NTE A;  4U0F A;  1QRJ A;  4M0I A;  5HGO A;  5I4T G;  3P05 A;  1A8O A;  1EOQ A;  5HGN A;  3DS5 A;  4IPY A;  3G28 A;  1BAJ A;  2M8N A;  4XFX A;  4U0C A;  4U0E A;  4COP A;  3DS3 A;  3H4E A;  3DS2 A;  1A43 A;  4XFY A;  4PH0 A;  2JO0 A;  3G21 A;  4PH1 A;  4WYM A;  2ONT A;  2JYL A;  3LRY A;  3H47 A;  2M8P A;  1EIA A;  4XRO A;  4XRQ A;  3MGE A;  3G0V A;  2L6E A;  1D1D A;  4COC A;  2XV6 A;  2XT1 A;  3VRL C;  2EIA A;  3DTJ A;  3G1G A;  3G29 A;  5DCK A;  4XFZ A;  2BUO A;  2JYG A;  4U0B A;  4QNB A;  3G26 A;  3DPH A;  5HGM A;  2KOD A;  5JPA A;  3G1I A;  4U0A A;  2XXM A;  3DS4 A;  1E6J P;  5HGL A;  3DS1 A; 
#chains in the Genus database with same CATH topology
 3M1M A;  3CD6 P;  4U0F A;  2WPT A;  1IMQ A;  1K30 A;  1VQL P;  1BAJ A;  2EG5 A;  2M8N A;  2KOQ A;  3B5I A;  3OW2 O;  2GDX A;  3GZM A;  1ZMB A;  2KOS A;  3CCE P;  1KD1 Q;  1D1D A;  4COC A;  2EFJ A;  2EIA A;  1Q82 Q;  2KGE A;  1AF8 A;  1Q86 Q;  2VSQ A;  3CCM P;  2XXM A;  1F80 D;  3DS2 A;  2MY5 A;  4F37 A;  2MF4 A;  3LRY A;  3H47 A;  1VQ4 P;  4MRT C;  2QA4 P;  2VLQ A;  3E2D A;  2JU2 A;  2ROQ A;  2LML A;  2LL8 A;  2AFE A;  2DGY A;  2AFD A;  3DS3 A;  4PH1 A;  1YHQ P;  3MGE A;  2FQ2 A;  1OR5 A;  2KOR A;  2XV6 A;  2Z44 A;  3G1G A;  5KP7 B;  2K5X A;  2KW2 A;  3DS4 A;  1E6J P;  4U0D A;  5KP8 B;  4H2X C;  4DG9 A;  2GDY A;  3CCS P;  2K92 A;  1RNI A;  2JYL A;  2ONT A;  2XZ1 C;  2L22 A;  2K0D X;  2PEJ A;  3CCU P;  2GZI A;  1T8K A;  2L6E A;  2LPK A;  1VQP P;  3CPW O;  2JYG A;  4QNB A;  5HVC A;  5JPA A;  3NY7 B;  2GYK A;  5KP6 B;  2FVE A;  1GXH A;  1QRJ A;  1VQ9 P;  2K93 A;  3I55 P;  3WBH A;  2N6Z A;  4IPY A;  2JB0 A;  2JU1 A;  3CME P;  1YIT P;  2VLN A;  2FVF A;  4XRQ A;  1DNY A;  1M90 Q;  3RG2 A;  4IZ6 A;  2GZG A;  2LOL A;  3DTJ A;  2OTL P;  5DCK A;  2E1M A;  1L0H A;  2KGA A;  2FQ1 A;  3CC4 P;  2KWL A;  1Q7Y Q;  3EJE A;  5HGO A;  2CWO A;  2PY8 A;  2FQ0 A;  1UNK A;  3EJD A;  5HGN A;  2FHS C;  3DS5 A;  2N50 A;  2L4B A;  4U0E A;  4COP A;  4BPF A;  2PEM A;  2M8P A;  2PEQ A;  2JQ4 A;  1W2B O;  2JBG A;  2QNW A;  3VRL C;  2KOD A;  4GR6 A;  1BXI A;  1QVF O;  2MR8 A;  3P05 A;  2K94 A;  1K9M Q;  2JGP A;  1UJZ A;  2KR5 A;  2L9F A;  2K0Y A;  2L0Q A;  4BPH A;  1RO2 A;  1VQO P;  1K8A Q;  1VQN P;  5EJD A;  3EJB A;  2LKI A;  3HYB A;  4U0B A;  2PEN A;  3G26 A;  1E0H A;  2KG9 A;  2N5H A;  2M8L A;  1RO0 A;  1KLP A;  2VLP A;  2OAR A;  3H4E A;  3CE7 A;  2JO0 A;  4PXH B;  1VQ8 P;  5F2K A;  2Z45 A;  1DV5 A;  3G29 A;  3RG6 C;  2LIU A;  1VQ6 P;  5HGL A;  1VKU A;  1A8O A;  3LMO A;  2KG6 A;  1A43 A;  2MVV A;  1NJI Q;  1M6E X;  1HY8 A;  3GZL A;  1AYI A;  2KOO A;  1YJW P;  1AUM A;  3DS0 A;  5I4T G;  4NEO A;  1Z6M A;  1EOQ A;  2CGQ A;  4XFY A;  4H2W C;  2FVA A;  2LTE A;  2N6Y A;  1GPJ A;  3Q20 A;  2XT1 A;  2CQ8 A;  2CG5 B;  5BS2 A;  1JJ2 O;  7CEI A;  3NTE A;  3CMA P;  3B4Q A;  5CZD B;  3G4S P;  2BHV A;  3I56 P;  3G71 P;  1HQB A;  2X2B A;  4PWV B;  2BUO A;  1ACP A;  1X3O A;  5HGM A;  2MVU A;  2LIW A;  2LF4 A;  5HV8 A;  1YJN P;  2GZF A;  2KG8 A;  2N5I A;  2XZ0 D;  3CC7 P;  1YI2 P;  3G28 A;  1YIJ P;  2PEK A;  4QKO A;  4PH0 A;  3G21 A;  4GR2 A;  2MD9 A;  4UHP B;  2FAE A;  3GKL C;  2GZJ A;  1Q81 Q;  3DS1 A;  2AVA A;  1L0I A;  4R0M A;  3CXC O;  1ZNV A;  1IMP A;  2EHS A;  4U0C A;  2KGD A;  3G6E P;  2P9X A;  3CCR P;  3CC2 P;  2VLO A;  1N8R Q;  4XRO A;  5BS1 A;  1M6N A;  3CCJ P;  3HZQ A;  2KOP A;  1S72 P;  1GXG A;  4U0A A;  2MR7 A;  2PEO A;  3CCV P;  1MZ8 A;  2PNG A;  4XFX A;  4BPG A;  2ERH A;  2K2Q A;  2QEX P;  1K73 Q;  1FR2 A;  2NO8 A;  2KGC A;  2CNR A;  3GJN A;  4CA3 A;  3U43 A;  4M0I A;  2GDW A;  2AF8 A;  4HKG A;  1VHN A;  4WYM A;  1EMV A;  1M74 A;  1EIA A;  2PEI A;  1VQM P;  1YJ9 P;  2EHT A;  1NQ4 A;  3H0D A;  1VQ7 P;  4XFZ A;  1KQS O;  1VQ5 P;  2Z46 A;  2FAD A;  2DNW A;  1VQK P;  1CEI A;  4H2Y C;  3CCQ P;  2GZE A;  5F2O A;  2FAC A;  5EW5 E;  1KC8 Q;  2N98 A;  3G0V A;  2K0X A;  2M5R A;  2OTJ P;  3G1I A;  1M1K Q;  3CCL P;  1QVG O;  2JAZ A;  3DPH A;  1IUQ A;  5F2N A; 
#chains in the Genus database with same CATH homology
 3M1M A;  3CD6 P;  4U0F A;  1QRJ A;  1VQ9 P;  1A8O A;  3I55 P;  3CXC O;  1K30 A;  3WBH A;  1VQL P;  4IPY A;  1BAJ A;  2EG5 A;  2M8N A;  3B5I A;  4U0C A;  1A43 A;  3OW2 O;  3G6E P;  2P9X A;  3CME P;  1ZMB A;  1YIT P;  3CCR P;  3CC2 P;  3CCE P;  1N8R Q;  4XRO A;  4XRQ A;  5BS1 A;  1M6N A;  3CCJ P;  1KD1 Q;  1M90 Q;  1D1D A;  4COC A;  1M6E X;  2EFJ A;  5F2N A;  1NJI Q;  2EIA A;  3DTJ A;  5DCK A;  3HZQ A;  1Q82 Q;  2OTL P;  2E1M A;  1Q86 Q;  3CCM P;  1S72 P;  3CC4 P;  4U0A A;  2XXM A;  1Q7Y Q;  1YJW P;  3DS2 A;  1AUM A;  3DS0 A;  2PEO A;  3CCV P;  5HGO A;  5I4T G;  2CWO A;  2PY8 A;  1EOQ A;  5HGN A;  3DS5 A;  4XFX A;  4U0E A;  4COP A;  4XFY A;  3LRY A;  3H47 A;  2PEM A;  1VQ4 P;  2M8P A;  2QEX P;  1K73 Q;  2PEQ A;  2QA4 P;  1W2B O;  3Q20 A;  2XT1 A;  3VRL C;  5BS2 A;  2KOD A;  3E2D A;  4GR6 A;  1JJ2 O;  1QVF O;  3NTE A;  3CMA P;  4M0I A;  3P05 A;  1K9M Q;  3G4S P;  2BHV A;  2DGY A;  3I56 P;  3G71 P;  3DS3 A;  4PH1 A;  4WYM A;  1YHQ P;  1M74 A;  1EIA A;  2PEI A;  3MGE A;  1VQO P;  1RO2 A;  1VQM P;  1K8A Q;  2XV6 A;  1VQN P;  3H0D A;  2Z44 A;  3G1G A;  1YJ9 P;  1VQ7 P;  3HYB A;  4XFZ A;  2BUO A;  1KQS O;  4U0B A;  2PEN A;  2Z46 A;  3G26 A;  5HGM A;  1VQ5 P;  3DS4 A;  1E6J P;  4U0D A;  2LF4 A;  2M8L A;  1YJN P;  1VQK P;  3CC7 P;  1YI2 P;  1RO0 A;  3CCS P;  3CCQ P;  3G28 A;  1YIJ P;  5F2O A;  2OAR A;  2PEK A;  3H4E A;  4PH0 A;  2JO0 A;  3G21 A;  1RNI A;  2JYL A;  2ONT A;  1VQ8 P;  2PEJ A;  4GR2 A;  3CCU P;  5F2K A;  1KC8 Q;  2Z45 A;  3G0V A;  2L6E A;  2OTJ P;  1M1K Q;  1VQP P;  3G29 A;  3CPW O;  3CCL P;  3RG6 C;  2JYG A;  1Q81 Q;  1VQ6 P;  1QVG O;  4QNB A;  3DPH A;  1IUQ A;  5JPA A;  3G1I A;  5HGL A;  3DS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...