2JO0A

The solution structure of the monomeric species of the c terminal domain of the ca protein of hiv-1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
MSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Flexibility in HIV-1 Assembly Subunits: Solution Structure of the Monomeric C-Terminal Domain of the Capsid Protein
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Gag-Pol polyprotein
total genus 19
structure length 87
sequence length 87
ec nomenclature ec 3.4.23.16: HIV-1 retropepsin.
pdb deposition date 2007-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2jo0A00
2KODA 2M8LA 3G1GA 1A8OA 3H47A 4XFXA 2XXMA 3DS4A 1EIAA 3DS5A 4XRQA 4COPA 4IPYA 3G28A 2ONTA 3G0VA 4U0EA 1EOQA 2JYGA 3G21A 5HGNA 3H4EA 1AUMA 3DS3A 5JPAA 3DTJA 2BUOA 3NTEA 4XROA 2XV6A 4QNBA 3P05A 5HGMA 5DCKA 4XFYA 4PH0A 3DS2A 4U0CA 3G26A 3LRYA 4M0IA 3G1IA 2LF4A 3DPHA 4PH1A 2XT1A 3DS1A 2L6EA 3MGEA 4U0AA 1QRJA 2M8NA 4U0DA 4XFZA 5HGLA 4U0BA 4COCA 2EIAA 1E6JP 3VRLC 2JO0A 4U0FA 5I4TG 5HGOA 2JYLA 1A43A 1D1DA 3DS0A 2M8PA 4WYMA 1BAJA 3G29A
chains in the Genus database with same CATH superfamily
4IZ6A 2PEIA 3DS3A 1UNKA 2PEQA 2BUOA 1L0IA 2GZGA 2L9FA 2XV6A 4GR2A 2L0QA 1IMQA 4F37A 4UHPB 1Q86Q 2CG5B 4PH1A 5BS1A 2JU2A 1OR5A 4XFZA 4BPGA 4H2YC 1KLPA 2ERHA 2KGEA 2GZEA 2PNGA 3G29A 2PEOA 2KODA 3G1GA 3H47A 3DS4A 1F80D 2GDXA 2MR8A 2K2QA 3H4EA 2GDWA 2N6ZA 1YJ9P 2FACA 1ZMBA 1CEIA 3CCUP 1VQPP 2JAZA 3LMOA 1HQBA 2JU1A 1EMVA 3I55P 2GYKA 5HGLA 5CZDB 2LIUA 2CWOA 1Q7YQ 4MRTC 5I4TG 5KP8B 1VQNP 1GXHA 2JYLA 2KOQA 1VQ6P 2M8LA 1YHQP 3G4SP 5KP6B 1YIJP 1VQ4P 3DTJA 3E2DA 1VQ5P 2KGAA 3LRYA 2MVVA 2KORA 3MGEA 1NJIQ 4DG9A 2MD9A 1D1DA 1A43A 2N6YA 1A8OA 2FADA 2JQ4A 1YJWP 1M6EX 1Z6MA 3CCVP 4U0CA 1T8KA 2EFJA 1W2BO 1N8RQ 2EG5A 1DNYA 3CXCO 4XFXA 3NY7B 1EIAA 2XZ1C 4IPYA 1RO0A 2KG8A 1ZNVA 3CC2P 3CE7A 2KOOA 2EIAA 1VQ8P 2Z45A 1AUMA 1VQKP 3I56P 2AVAA 1VQMP 2MR7A 1M74A 3DS2A 1VQLP 2LF4A 3CMEP 2KW2A 1K73Q 1K8AQ 1ACPA 3VRLC 3EJEA 5HGOA 5F2KA 3B4QA 3DS0A 4BPHA 2QA4P 1UJZA 2K0DX 2VLNA 2JYGA 2MVUA 2K0XA 5KP7B 4PH0A 2CQ8A 3HYBA 2CNRA 4U0AA 2FQ0A 2XZ0D 4U0DA 2FAEA 1E6JP 4U0FA 2LOLA 3GZLA 2M8PA 2K0YA 2EHTA 2L22A 2BHVA 4PWVB 3G21A 5EW5E 1JJ2O 5HGMA 2M5RA 5F2OA 2OARA 2NO8A 2CGQA 3H0DA 2DGYA 3CCLP 1HY8A 1FR2A 1GXGA 1BAJA 3CMAP 4XRQA 1M6NA 5HVCA 3G28A 1AYIA 4R0MA 3CC4P 2WPTA 1AF8A 4CA3A 3P05A 3M1MA 5EJDA 2N50A 2N5IA 2P9XA 2LL8A 3CCEP 3U43A 4H2WC 2FVAA 2K93A 2LMLA 3WBHA 3DS5A 2KOPA 1IMPA 1MZ8A 4QNBA 2OTJP 5HV8A 4XFYA 3DPHA 2FQ2A 1YI2P 4HKGA 1QRJA 3CC7P 2GZFA 2JBGA 2PEJA 1YJNP 1GPJA 1VHNA 4COPA 2XXMA 2KGCA 2FHSC 1EOQA 2DNWA 5BS2A 2GZIA 1KQSO 2QEXP 5DCKA 4M0IA 1YITP 5F2NA 2K92A 2Z44A 1M1KQ 1E0HA 2KG6A 4GR6A 4NEOA 2LKIA 3CCJP 2VLQA 5HGNA 3RG2A 3G6EP 2VLOA 3G26A 1BXIA 1M90Q 2XT1A 3DS1A 2Z46A 3EJBA 2AF8A 2PY8A 3OW2O 1QVGO 2K5XA 2ROQA 2L4BA 2N5HA 2PEKA 2LIWA 5JPAA 2AFDA 3EJDA 2GDYA 4PXHB 2FQ1A 2KWLA 2KOSA 2JB0A 2VLPA 1DV5A 2L6EA 1RNIA 2GZJA 2N98A 3Q20A 2MF4A 2KGDA 1K30A 3GZMA 4WYMA 1L0HA 2FVEA 3CPWO 4U0EA 2JGPA 3RG6C 1KD1Q 4XROA 4QKOA 2KG9A 7CEIA 3CD6P 2PEMA 1X3OA 2M8NA 2KR5A 2MY5A 2AFEA 1VQ9P 2LTEA 1NQ4A 3CCMP 1K9MQ 4H2XC 1VQOP 2ONTA 3G0VA 2VSQA 2K94A 4BPFA 2FVFA 1KC8Q 3CCRP 1IUQA 2PENA 3CCSP 3G71P 2QNWA 3B5IA 2E1MA 3CCQP 4COCA 4U0BA 1Q81Q 1VKUA 2JO0A 1RO2A 3GKLC 1VQ7P 1QVFO 1Q82Q 3NTEA 3HZQA 1S72P 3GJNA 3G1IA 2EHSA 2X2BA 2OTLP 2LPKA
chains in the Genus database with same CATH topology
3CMAP 4XRQA 4XFXA 1EIAA 1M6NA 4IPYA 3G28A 2PEKA 2PEIA 3CC4P 3DS3A 2PEQA 5JPAA 2BUOA 1RO0A 2XV6A 4GR2A 3P05A 3M1MA 3CC2P 1Q86Q 2P9XA 4PH1A 5BS1A 3CCEP 2L6EA 1RNIA 4XFZA 2EIAA 3Q20A 1K30A 4WYMA 1VQ8P 3G29A 2PEOA 2KODA 3G1GA 3H47A 3DS4A 3WBHA 3DS5A 3CPWO 4U0EA 3RG6C 2Z45A 3H4EA 1KD1Q 1AUMA 1VQKP 1YJ9P 3I56P 1ZMBA 4XROA 4QNBA 2OTJP 1VQMP 1M74A 4XFYA 3CCUP 1VQPP 3DS2A 1VQLP 3CD6P 2LF4A 2PEMA 3DPHA 3CMEP 3I55P 1K73Q 1YI2P 1K8AQ 1QRJA 2M8NA 5HGLA 3CC7P 3VRLC 2CWOA 5I4TG 1Q7YQ 5HGOA 5F2KA 1VQNP 2JYLA 1VQ9P 3DS0A 2PEJA 1YJNP 2QA4P 1VQ6P 3CCMP 2M8LA 1K9MQ 4COPA 1YHQP 2XXMA 3OW2O 1VQOP 3G4SP 2ONTA 3G0VA 1EOQA 2JYGA 1YIJP 1VQ4P 5BS2A 3DTJA 3E2DA 1KQSO 1KC8Q 3CCRP 1IUQA 2QEXP 1VQ5P 5DCKA 4PH0A 2PENA 3CCSP 3G71P 3B5IA 3LRYA 4M0IA 3HYBA 1YITP 2E1MA 5F2NA 3MGEA 4U0AA 3CCQP 4COCA 4U0DA 1NJIQ 4U0BA 1Q81Q 1E6JP 2JO0A 4U0FA 2Z44A 1M1KQ 1D1DA 1A43A 2M8PA 1RO2A 1A8OA 2BHVA 4GR6A 1YJWP 1VQ7P 3CCJP 1QVFO 3G21A 5HGNA 1M6EX 1JJ2O 1Q82Q 3CCVP 3NTEA 5HGMA 3G6EP 3HZQA 1S72P 5F2OA 2OARA 4U0CA 3G26A 3G1IA 1M90Q 2XT1A 3DS1A 3H0DA 2DGYA 2OTLP 3CCLP 2EFJA 2Z46A 1W2BO 1N8RQ 2EG5A 2PY8A 3CXCO 1BAJA 1QVGO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOD A;  2M8L A;  3G1G A;  1A8O A;  3H47 A;  4XFX A;  2XXM A;  3DS4 A;  1EIA A;  3DS5 A;  4XRQ A;  4COP A;  4IPY A;  3G28 A;  2ONT A;  3G0V A;  4U0E A;  1EOQ A;  2JYG A;  3G21 A;  5HGN A;  3H4E A;  1AUM A;  3DS3 A;  5JPA A;  3DTJ A;  2BUO A;  3NTE A;  4XRO A;  2XV6 A;  4QNB A;  3P05 A;  5HGM A;  5DCK A;  4XFY A;  4PH0 A;  3DS2 A;  4U0C A;  3G26 A;  3LRY A;  4M0I A;  3G1I A;  2LF4 A;  3DPH A;  4PH1 A;  2XT1 A;  3DS1 A;  2L6E A;  3MGE A;  4U0A A;  1QRJ A;  2M8N A;  4U0D A;  4XFZ A;  5HGL A;  4U0B A;  4COC A;  2EIA A;  1E6J P;  3VRL C;  2JO0 A;  4U0F A;  5I4T G;  5HGO A;  2JYL A;  1A43 A;  1D1D A;  3DS0 A;  2M8P A;  4WYM A;  1BAJ A;  3G29 A; 
#chains in the Genus database with same CATH topology
 4IZ6 A;  2PEI A;  3DS3 A;  1UNK A;  2PEQ A;  2BUO A;  1L0I A;  2GZG A;  2L9F A;  2XV6 A;  4GR2 A;  2L0Q A;  1IMQ A;  4F37 A;  4UHP B;  1Q86 Q;  2CG5 B;  4PH1 A;  5BS1 A;  2JU2 A;  1OR5 A;  4XFZ A;  4BPG A;  4H2Y C;  1KLP A;  2ERH A;  2KGE A;  2GZE A;  2PNG A;  3G29 A;  2PEO A;  2KOD A;  3G1G A;  3H47 A;  3DS4 A;  1F80 D;  2GDX A;  2MR8 A;  2K2Q A;  3H4E A;  2GDW A;  2N6Z A;  1YJ9 P;  2FAC A;  1ZMB A;  1CEI A;  3CCU P;  1VQP P;  2JAZ A;  3LMO A;  1HQB A;  2JU1 A;  1EMV A;  3I55 P;  2GYK A;  5HGL A;  5CZD B;  2LIU A;  2CWO A;  1Q7Y Q;  4MRT C;  5I4T G;  5KP8 B;  1VQN P;  1GXH A;  2JYL A;  2KOQ A;  1VQ6 P;  2M8L A;  1YHQ P;  3G4S P;  5KP6 B;  1YIJ P;  1VQ4 P;  3DTJ A;  3E2D A;  1VQ5 P;  2KGA A;  3LRY A;  2MVV A;  2KOR A;  3MGE A;  1NJI Q;  4DG9 A;  2MD9 A;  1D1D A;  1A43 A;  2N6Y A;  1A8O A;  2FAD A;  2JQ4 A;  1YJW P;  1M6E X;  1Z6M A;  3CCV P;  4U0C A;  1T8K A;  2EFJ A;  1W2B O;  1N8R Q;  2EG5 A;  1DNY A;  3CXC O;  4XFX A;  3NY7 B;  1EIA A;  2XZ1 C;  4IPY A;  1RO0 A;  2KG8 A;  1ZNV A;  3CC2 P;  3CE7 A;  2KOO A;  2EIA A;  1VQ8 P;  2Z45 A;  1AUM A;  1VQK P;  3I56 P;  2AVA A;  1VQM P;  2MR7 A;  1M74 A;  3DS2 A;  1VQL P;  2LF4 A;  3CME P;  2KW2 A;  1K73 Q;  1K8A Q;  1ACP A;  3VRL C;  3EJE A;  5HGO A;  5F2K A;  3B4Q A;  3DS0 A;  4BPH A;  2QA4 P;  1UJZ A;  2K0D X;  2VLN A;  2JYG A;  2MVU A;  2K0X A;  5KP7 B;  4PH0 A;  2CQ8 A;  3HYB A;  2CNR A;  4U0A A;  2FQ0 A;  2XZ0 D;  4U0D A;  2FAE A;  1E6J P;  4U0F A;  2LOL A;  3GZL A;  2M8P A;  2K0Y A;  2EHT A;  2L22 A;  2BHV A;  4PWV B;  3G21 A;  5EW5 E;  1JJ2 O;  5HGM A;  2M5R A;  5F2O A;  2OAR A;  2NO8 A;  2CGQ A;  3H0D A;  2DGY A;  3CCL P;  1HY8 A;  1FR2 A;  1GXG A;  1BAJ A;  3CMA P;  4XRQ A;  1M6N A;  5HVC A;  3G28 A;  1AYI A;  4R0M A;  3CC4 P;  2WPT A;  1AF8 A;  4CA3 A;  3P05 A;  3M1M A;  5EJD A;  2N50 A;  2N5I A;  2P9X A;  2LL8 A;  3CCE P;  3U43 A;  4H2W C;  2FVA A;  2K93 A;  2LML A;  3WBH A;  3DS5 A;  2KOP A;  1IMP A;  1MZ8 A;  4QNB A;  2OTJ P;  5HV8 A;  4XFY A;  3DPH A;  2FQ2 A;  1YI2 P;  4HKG A;  1QRJ A;  3CC7 P;  2GZF A;  2JBG A;  2PEJ A;  1YJN P;  1GPJ A;  1VHN A;  4COP A;  2XXM A;  2KGC A;  2FHS C;  1EOQ A;  2DNW A;  5BS2 A;  2GZI A;  1KQS O;  2QEX P;  5DCK A;  4M0I A;  1YIT P;  5F2N A;  2K92 A;  2Z44 A;  1M1K Q;  1E0H A;  2KG6 A;  4GR6 A;  4NEO A;  2LKI A;  3CCJ P;  2VLQ A;  5HGN A;  3RG2 A;  3G6E P;  2VLO A;  3G26 A;  1BXI A;  1M90 Q;  2XT1 A;  3DS1 A;  2Z46 A;  3EJB A;  2AF8 A;  2PY8 A;  3OW2 O;  1QVG O;  2K5X A;  2ROQ A;  2L4B A;  2N5H A;  2PEK A;  2LIW A;  5JPA A;  2AFD A;  3EJD A;  2GDY A;  4PXH B;  2FQ1 A;  2KWL A;  2KOS A;  2JB0 A;  2VLP A;  1DV5 A;  2L6E A;  1RNI A;  2GZJ A;  2N98 A;  3Q20 A;  2MF4 A;  2KGD A;  1K30 A;  3GZM A;  4WYM A;  1L0H A;  2FVE A;  3CPW O;  4U0E A;  2JGP A;  3RG6 C;  1KD1 Q;  4XRO A;  4QKO A;  2KG9 A;  7CEI A;  3CD6 P;  2PEM A;  1X3O A;  2M8N A;  2KR5 A;  2MY5 A;  2AFE A;  1VQ9 P;  2LTE A;  1NQ4 A;  3CCM P;  1K9M Q;  4H2X C;  1VQO P;  2ONT A;  3G0V A;  2VSQ A;  2K94 A;  4BPF A;  2FVF A;  1KC8 Q;  3CCR P;  1IUQ A;  2PEN A;  3CCS P;  3G71 P;  2QNW A;  3B5I A;  2E1M A;  3CCQ P;  4COC A;  4U0B A;  1Q81 Q;  1VKU A;  2JO0 A;  1RO2 A;  3GKL C;  1VQ7 P;  1QVF O;  1Q82 Q;  3NTE A;  3HZQ A;  1S72 P;  3GJN A;  3G1I A;  2EHS A;  2X2B A;  2OTL P;  2LPK A; 
#chains in the Genus database with same CATH homology
 3CMA P;  4XRQ A;  4XFX A;  1EIA A;  1M6N A;  4IPY A;  3G28 A;  2PEK A;  2PEI A;  3CC4 P;  3DS3 A;  2PEQ A;  5JPA A;  2BUO A;  1RO0 A;  2XV6 A;  4GR2 A;  3P05 A;  3M1M A;  3CC2 P;  1Q86 Q;  2P9X A;  4PH1 A;  5BS1 A;  3CCE P;  2L6E A;  1RNI A;  4XFZ A;  2EIA A;  3Q20 A;  1K30 A;  4WYM A;  1VQ8 P;  3G29 A;  2PEO A;  2KOD A;  3G1G A;  3H47 A;  3DS4 A;  3WBH A;  3DS5 A;  3CPW O;  4U0E A;  3RG6 C;  2Z45 A;  3H4E A;  1KD1 Q;  1AUM A;  1VQK P;  1YJ9 P;  3I56 P;  1ZMB A;  4XRO A;  4QNB A;  2OTJ P;  1VQM P;  1M74 A;  4XFY A;  3CCU P;  1VQP P;  3DS2 A;  1VQL P;  3CD6 P;  2LF4 A;  2PEM A;  3DPH A;  3CME P;  3I55 P;  1K73 Q;  1YI2 P;  1K8A Q;  1QRJ A;  2M8N A;  5HGL A;  3CC7 P;  3VRL C;  2CWO A;  5I4T G;  1Q7Y Q;  5HGO A;  5F2K A;  1VQN P;  2JYL A;  1VQ9 P;  3DS0 A;  2PEJ A;  1YJN P;  2QA4 P;  1VQ6 P;  3CCM P;  2M8L A;  1K9M Q;  4COP A;  1YHQ P;  2XXM A;  3OW2 O;  1VQO P;  3G4S P;  2ONT A;  3G0V A;  1EOQ A;  2JYG A;  1YIJ P;  1VQ4 P;  5BS2 A;  3DTJ A;  3E2D A;  1KQS O;  1KC8 Q;  3CCR P;  1IUQ A;  2QEX P;  1VQ5 P;  5DCK A;  4PH0 A;  2PEN A;  3CCS P;  3G71 P;  3B5I A;  3LRY A;  4M0I A;  3HYB A;  1YIT P;  2E1M A;  5F2N A;  3MGE A;  4U0A A;  3CCQ P;  4COC A;  4U0D A;  1NJI Q;  4U0B A;  1Q81 Q;  1E6J P;  2JO0 A;  4U0F A;  2Z44 A;  1M1K Q;  1D1D A;  1A43 A;  2M8P A;  1RO2 A;  1A8O A;  2BHV A;  4GR6 A;  1YJW P;  1VQ7 P;  3CCJ P;  1QVF O;  3G21 A;  5HGN A;  1M6E X;  1JJ2 O;  1Q82 Q;  3CCV P;  3NTE A;  5HGM A;  3G6E P;  3HZQ A;  1S72 P;  5F2O A;  2OAR A;  4U0C A;  3G26 A;  3G1I A;  1M90 Q;  2XT1 A;  3DS1 A;  3H0D A;  2DGY A;  2OTL P;  3CCL P;  2EFJ A;  2Z46 A;  1W2B O;  1N8R Q;  2EG5 A;  2PY8 A;  3CXC O;  1BAJ A;  1QVG O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...