2JOIA

Nmr solution structure of hypothetical protein ta0095 from thermoplasma acidophilum
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
MREYPVKKGFPTDYDSIKRKISELGFDVKSEGDLIIASIPGISRIEIKPDKRKILVNTGDYDSDADKLAVVRTYNDFIEKLTGYSAKERKKMMTKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Ta0095
publication title Solution structure of the hypothetical protein TA0095 from Thermoplasma acidophilum: A novel superfamily with a two-layer sandwich architecture
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Structural genomics, unknown function
total genus 20
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18446 DUF5611 Domain of unknown function (DUF5611)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.190 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2joiA00
2JOIA
chains in the Genus database with same CATH superfamily
2MJ7A 2NLVA 3SNSA 1KO9A 5EPCA 1KY7A 1KYFA 2JPIA 2R5XA 1NVPA 1MPGA 3HS9A 3I3WA 4BJUA 2QRCA 1QNBA 1N39A 4WX8A 5JMVD 2Y8QA 1KYDA 1KFIA 4EAKA 2VJ0A 2FKMX 3F10A 1RM1A 4IL8A 4WXAA 3D7QA 3ENOC 2I5WA 1PVSA 1C4GA 1P5DX 2FUVA 1DIZA 1T6AA 2YH5A 1PCJX 1EUVA 3PDKA 2Z8UA 2PWWA 1P5GX 2NWVA 1VKLA 1AISA 3IH7A 2EHBD 5IYBP 3OSTA 1QN9A 2D0AA 3OH9A 1W80A 4QG5A 3CWSA 4EJZA 3C04A 3CWUA 2QRDA 4ROCB 3CVSA 3RSMA 1PZDA 3DPUA 1NH2A 2V92A 2NOIA 2FKFA 4C7PA 2HZMA 2JOIA 1VTLE 1LWVA 2NVMA 2D0CA 3PMGA 2NOLA 2JHJA 5IYCP 1V5SA 4EJYA 2YA3A 1KY6A 3VN5A 4Q11A 1LWWA 3I0WA 1QN7A 1C9BB 5AN4A 1WJWA 2Z0FA 2QR1A 1EBMA 5HSHA 3CWTA 1B9KA 1M3HA 4PY5A 3CWAA 3D4VA 1HU0A 1WQAA 2JHNA 1KFQA 2Y8LA 2HL8A 4DULA 3DPTA 5BMNA 1QNCA 1YQRA 3I0XA 2ZFDB 1VOLB 4B0AA 2XHIA 3OGDA 3EIKA 4HJHA 3UW2A 1JFIC 1M3QA 2DKDA 4D7RA 2IV8A 3OSEA 1CDWA 1YQLA 1YTBA 5BMPA 2OOYA 3OC3C 5IYDP 2F7LA 3OH6A 3T4NA 2NOZA 4CFFA 1MP9A 1R4XA 1K2YX 1LXTA 1QNEA 5KL0A 3OLPA 4EAIA 2D0BA 1YQKA 3EAYA 1FN7A 1QNAA 4RODB 1D3UA 1LWYA 3CW7A 4EALA 1UT4A 1QN3A 3OCIA 2HZSA 4EAJA 2QLVA 5F9CA 2QREA 4WZSD 2NOHA 1XSZA 3F0ZA 3H1ZA 1UT7A 1N3CA 2DKAA 2H4LX 1TBAB 2NOBA 3CVTA 3TE5A 2DKCA 1QTSA 1K35A 1TUOA 2V8QA 3ENCA 3HS8A 1VTOA 4I8OA 2LAEA 1QTPA 1VOKA 3TDHA 2OOXA 2NOEA 3ASMA 4MRQA 1QN5A 1JDYA 1YTFA 3KTUA 1KYUA 4D7QA 1Q9UA 2G30A 1QN4A 2NOFA 2FGTA 2V9JA 4TPSA 1N3AA 2HL9A 1PCZA 1PCMX 3RPJA 1J3MA 1M5Q1 2H5AX 2IV9A 2O3OA 3BKQX 1TBPA 3ULXA 4EAGA 4ROEB 3KRMA 3N89A 1E42A 1QN8A 1TGHA 1C47A 3NA5A 2HKPA 1UL7A 5JN5A 1YQMA 2MZ8A 1NGMA 1QN6A 3OSMA
chains in the Genus database with same CATH topology
2MJ7A 3SNSA 1KO9A 1KY7A 1KYFA 1NVPA 3HS9A 1QNBA 1N39A 1KYDA 2VJ0A 3F10A 1RM1A 2I5WA 2YH5A 2Z8UA 1AISA 3IH7A 5IYBP 3OSTA 1QN9A 2D0AA 1W80A 4EJZA 4ROCB 1PZDA 3DPUA 1NH2A 2NOIA 2HZMA 2JOIA 1VTLE 1LWVA 2D0CA 2NOLA 5IYCP 4EJYA 1KY6A 3VN5A 4Q11A 1LWWA 3I0WA 1QN7A 1C9BB 5AN4A 1EBMA 1B9KA 1M3HA 4PY5A 1HU0A 4DULA 1QNCA 1VOLB 3DPTA 1YQRA 3I0XA 4B0AA 2XHIA 3EIKA 1JFIC 1M3QA 1CDWA 2IV8A 1YQLA 1YTBA 3OC3C 5IYDP 2NOZA 1MP9A 1R4XA 1QNEA 1FN7A 1YQKA 2D0BA 1QNAA 4RODB 1D3UA 1LWYA 1UT4A 1QN3A 3OCIA 2HZSA 4WZSD 2NOHA 3F0ZA 3H1ZA 1UT7A 1N3CA 2NOBA 1TBAB 1QTSA 1VTOA 3HS8A 4I8OA 2LAEA 1QTPA 1VOKA 2NOEA 3ASMA 1QN5A 1YTFA 3KTUA 1KYUA 1QN4A 2G30A 2NOFA 2FGTA 4TPSA 1N3AA 1PCZA 3RPJA 2IV9A 4ROEB 2O3OA 1TBPA 3ULXA 3KRMA 3N89A 1E42A 1QN8A 1TGHA 1YQMA 1NGMA 2MZ8A 1QN6A 3OSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JOI A; 
#chains in the Genus database with same CATH topology
 2MJ7 A;  2NLV A;  3SNS A;  1KO9 A;  5EPC A;  1KY7 A;  1KYF A;  2JPI A;  2R5X A;  1NVP A;  1MPG A;  3HS9 A;  3I3W A;  4BJU A;  2QRC A;  1QNB A;  1N39 A;  4WX8 A;  5JMV D;  2Y8Q A;  1KYD A;  1KFI A;  4EAK A;  2VJ0 A;  2FKM X;  3F10 A;  1RM1 A;  4IL8 A;  4WXA A;  3D7Q A;  3ENO C;  2I5W A;  1PVS A;  1C4G A;  1P5D X;  2FUV A;  1DIZ A;  1T6A A;  2YH5 A;  1PCJ X;  1EUV A;  3PDK A;  2Z8U A;  2PWW A;  1P5G X;  2NWV A;  1VKL A;  1AIS A;  3IH7 A;  2EHB D;  5IYB P;  3OST A;  1QN9 A;  2D0A A;  3OH9 A;  1W80 A;  4QG5 A;  3CWS A;  4EJZ A;  3C04 A;  3CWU A;  2QRD A;  4ROC B;  3CVS A;  3RSM A;  1PZD A;  3DPU A;  1NH2 A;  2V92 A;  2NOI A;  2FKF A;  4C7P A;  2HZM A;  2JOI A;  1VTL E;  1LWV A;  2NVM A;  2D0C A;  3PMG A;  2NOL A;  2JHJ A;  5IYC P;  1V5S A;  4EJY A;  2YA3 A;  1KY6 A;  3VN5 A;  4Q11 A;  1LWW A;  3I0W A;  1QN7 A;  1C9B B;  5AN4 A;  1WJW A;  2Z0F A;  2QR1 A;  1EBM A;  5HSH A;  3CWT A;  1B9K A;  1M3H A;  4PY5 A;  3CWA A;  3D4V A;  1HU0 A;  1WQA A;  2JHN A;  1KFQ A;  2Y8L A;  2HL8 A;  4DUL A;  3DPT A;  5BMN A;  1QNC A;  1YQR A;  3I0X A;  2ZFD B;  1VOL B;  4B0A A;  2XHI A;  3OGD A;  3EIK A;  4HJH A;  3UW2 A;  1JFI C;  1M3Q A;  2DKD A;  4D7R A;  2IV8 A;  3OSE A;  1CDW A;  1YQL A;  1YTB A;  5BMP A;  2OOY A;  3OC3 C;  5IYD P;  2F7L A;  3OH6 A;  3T4N A;  2NOZ A;  4CFF A;  1MP9 A;  1R4X A;  1K2Y X;  1LXT A;  1QNE A;  5KL0 A;  3OLP A;  4EAI A;  2D0B A;  1YQK A;  3EAY A;  1FN7 A;  1QNA A;  4ROD B;  1D3U A;  1LWY A;  3CW7 A;  4EAL A;  1UT4 A;  1QN3 A;  3OCI A;  2HZS A;  4EAJ A;  2QLV A;  5F9C A;  2QRE A;  4WZS D;  2NOH A;  1XSZ A;  3F0Z A;  3H1Z A;  1UT7 A;  1N3C A;  2DKA A;  2H4L X;  1TBA B;  2NOB A;  3CVT A;  3TE5 A;  2DKC A;  1QTS A;  1K35 A;  1TUO A;  2V8Q A;  3ENC A;  3HS8 A;  1VTO A;  4I8O A;  2LAE A;  1QTP A;  1VOK A;  3TDH A;  2OOX A;  2NOE A;  3ASM A;  4MRQ A;  1QN5 A;  1JDY A;  1YTF A;  3KTU A;  1KYU A;  4D7Q A;  1Q9U A;  2G30 A;  1QN4 A;  2NOF A;  2FGT A;  2V9J A;  4TPS A;  1N3A A;  2HL9 A;  1PCZ A;  1PCM X;  3RPJ A;  1J3M A;  1M5Q 1;  2H5A X;  2IV9 A;  2O3O A;  3BKQ X;  1TBP A;  3ULX A;  4EAG A;  4ROE B;  3KRM A;  3N89 A;  1E42 A;  1QN8 A;  1TGH A;  1C47 A;  3NA5 A;  2HKP A;  1UL7 A;  5JN5 A;  1YQM A;  2MZ8 A;  1NGM A;  1QN6 A;  3OSM A; 
#chains in the Genus database with same CATH homology
 2MJ7 A;  3SNS A;  1KO9 A;  1KY7 A;  1KYF A;  1NVP A;  3HS9 A;  1QNB A;  1N39 A;  1KYD A;  2VJ0 A;  3F10 A;  1RM1 A;  2I5W A;  2YH5 A;  2Z8U A;  1AIS A;  3IH7 A;  5IYB P;  3OST A;  1QN9 A;  2D0A A;  1W80 A;  4EJZ A;  4ROC B;  1PZD A;  3DPU A;  1NH2 A;  2NOI A;  2HZM A;  2JOI A;  1VTL E;  1LWV A;  2D0C A;  2NOL A;  5IYC P;  4EJY A;  1KY6 A;  3VN5 A;  4Q11 A;  1LWW A;  3I0W A;  1QN7 A;  1C9B B;  5AN4 A;  1EBM A;  1B9K A;  1M3H A;  4PY5 A;  1HU0 A;  4DUL A;  1QNC A;  1VOL B;  3DPT A;  1YQR A;  3I0X A;  4B0A A;  2XHI A;  3EIK A;  1JFI C;  1M3Q A;  1CDW A;  2IV8 A;  1YQL A;  1YTB A;  3OC3 C;  5IYD P;  2NOZ A;  1MP9 A;  1R4X A;  1QNE A;  1FN7 A;  1YQK A;  2D0B A;  1QNA A;  4ROD B;  1D3U A;  1LWY A;  1UT4 A;  1QN3 A;  3OCI A;  2HZS A;  4WZS D;  2NOH A;  3F0Z A;  3H1Z A;  1UT7 A;  1N3C A;  2NOB A;  1TBA B;  1QTS A;  1VTO A;  3HS8 A;  4I8O A;  2LAE A;  1QTP A;  1VOK A;  2NOE A;  3ASM A;  1QN5 A;  1YTF A;  3KTU A;  1KYU A;  1QN4 A;  2G30 A;  2NOF A;  2FGT A;  4TPS A;  1N3A A;  1PCZ A;  3RPJ A;  2IV9 A;  4ROE B;  2O3O A;  1TBP A;  3ULX A;  3KRM A;  3N89 A;  1E42 A;  1QN8 A;  1TGH A;  1YQM A;  1NGM A;  2MZ8 A;  1QN6 A;  3OSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...