2JOIA

Nmr solution structure of hypothetical protein ta0095 from thermoplasma acidophilum
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
MREYPVKKGFPTDYDSIKRKISELGFDVKSEGDLIIASIPGISRIEIKPDKRKILVNTGDYDSDADKLAVVRTYNDFIEKLTGYSAKERKKMMTKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Ta0095
publication title Solution structure of the hypothetical protein TA0095 from Thermoplasma acidophilum: A novel superfamily with a two-layer sandwich architecture
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Structural genomics, unknown function
total genus 20
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18446 DUF5611 Domain of unknown function (DUF5611)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.190 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2joiA00
2JOIA
chains in the Genus database with same CATH superfamily
4TPSA 1RM1A 5KL0A 2H4LX 3KTUA 1C47A 1KO9A 2JHJA 1B9KA 1KYDA 1TUOA 3OLPA 3PMGA 4BJUA 2FKMX 5F9CA 1YQRA 3KRMA 1DIZA 2H5AX 1P5DX 3OH6A 4RODB 3N89A 1EUVA 1JDYA 1UT7A 2G30A 2JHNA 3DPTA 4EAIA 1EBMA 2NOLA 2DKCA 1VOLB 1QNAA 3PDKA 3OSEA 3ULXA 3IH7A 1VTLE 1N3AA 1YTBA 4HJHA 1MPGA 2V9JA 1KFQA 2LAEA 4EALA 2NWVA 1YQLA 2QRDA 1PCZA 1FN7A 2NLVA 4MRQA 2QR1A 3H1ZA 1KY7A 1Q9UA 3ENOC 1QN7A 1M5Q1 2NOEA 5BMPA 2R5XA 1QN8A 1W80A 3DPUA 3NA5A 5JMVD 1JFIC 2DKAA 2HL9A 1XSZA 2NOBA 1VOKA 1YQKA 1TGHA 3CWUA 3RSMA 3HS9A 3F0ZA 3VN5A 1QNCA 3CW7A 1E42A 1D3UA 1QTSA 3I0XA 4CFFA 1M3HA 1QN3A 2PWWA 1R4XA 1LWWA 1QN4A 2DKDA 1N39A 4ROCB 1NGMA 1LWYA 4EAJA 2F7LA 2O3OA 1J3MA 1PZDA 2IV9A 1UT4A 2QRCA 1KYFA 5HSHA 1V5SA 3I0WA 3C04A 4ROEB 5IYCP 4IL8A 1KFIA 2D0BA 2NOFA 4EJYA 2QREA 4I8OA 2OOYA 3T4NA 1LXTA 3HS8A 2V92A 4B0AA 2FKFA 2OOXA 3CWAA 2VJ0A 4D7RA 4PY5A 1KY6A 5JN5A 3CVSA 5EPCA 3CWTA 4EJZA 1PCMX 3OSMA 3OGDA 1LWVA 2HZMA 3UW2A 3OH9A 1C9BB 5IYBP 3ASMA 5AN4A 3F10A 1M3QA 1QN6A 1QNEA 2I5WA 2NOIA 3TDHA 2XHIA 1QN5A 1K2YX 2HZSA 1N3CA 2D0AA 1WJWA 2FUVA 1TBPA 4WXAA 4EAKA 3BKQX 1PCJX 1VTOA 4WX8A 5BMNA 2JPIA 5IYDP 1PVSA 2D0CA 4QG5A 2IV8A 3TE5A 3OC3C 4Q11A 1TBAB 3EAYA 2MZ8A 3OCIA 1CDWA 1YTFA 2EHBD 1QTPA 1AISA 2JOIA 1YQMA 3SNSA 2V8QA 2QLVA 2FGTA 1VKLA 2YH5A 1K35A 4WZSD 2HKPA 1QN9A 2Y8QA 1HU0A 1MP9A 3D7QA 3RPJA 3EIKA 3ENCA 4C7PA 1WQAA 2YA3A 2Z8UA 1NH2A 2HL8A 2Y8LA 4D7QA 1T6AA 1NVPA 2ZFDB 3CVTA 3OSTA 3CWSA 1UL7A 3I3WA 2Z0FA 1P5GX 2NOZA 1KYUA 4DULA 2NVMA 2NOHA 3D4VA 4EAGA 1QNBA 1C4GA 2MJ7A
chains in the Genus database with same CATH topology
4TPSA 1RM1A 3KTUA 1KO9A 1YQRA 1B9KA 1KYDA 3KRMA 4RODB 3N89A 1UT7A 2G30A 3DPTA 1EBMA 2NOLA 1VOLB 1QNAA 3ULXA 3IH7A 1VTLE 1N3AA 1YTBA 2LAEA 1YQLA 1PCZA 1FN7A 3H1ZA 1KY7A 1QN7A 2NOEA 1QN8A 1W80A 3DPUA 1JFIC 2NOBA 1VOKA 1YQKA 1TGHA 1QNCA 3HS9A 3F0ZA 3VN5A 1E42A 1D3UA 1QTSA 3I0XA 1M3HA 1QN3A 1LWWA 1R4XA 1QN4A 1N39A 4ROCB 1NGMA 1LWYA 2O3OA 1PZDA 2IV9A 1UT4A 1KYFA 3I0WA 4ROEB 5IYCP 2D0BA 2NOFA 4EJYA 4I8OA 3HS8A 4B0AA 2VJ0A 4PY5A 1KY6A 4EJZA 3OSMA 1LWVA 2HZMA 1C9BB 5IYBP 3ASMA 5AN4A 3F10A 1M3QA 1QN6A 1QNEA 2I5WA 2NOIA 2XHIA 1QN5A 2HZSA 1N3CA 2D0AA 1TBPA 1VTOA 5IYDP 2D0CA 2IV8A 3OC3C 4Q11A 1TBAB 2MZ8A 3OCIA 1CDWA 1YTFA 1QTPA 1AISA 2JOIA 1YQMA 3SNSA 2FGTA 2YH5A 4WZSD 1QN9A 1HU0A 1MP9A 3RPJA 3EIKA 2Z8UA 1NH2A 1NVPA 3OSTA 2NOZA 1KYUA 4DULA 2NOHA 1QNBA 2MJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JOI A; 
#chains in the Genus database with same CATH topology
 4TPS A;  1RM1 A;  5KL0 A;  2H4L X;  3KTU A;  1C47 A;  1KO9 A;  2JHJ A;  1B9K A;  1KYD A;  1TUO A;  3OLP A;  3PMG A;  4BJU A;  2FKM X;  5F9C A;  1YQR A;  3KRM A;  1DIZ A;  2H5A X;  1P5D X;  3OH6 A;  4ROD B;  3N89 A;  1EUV A;  1JDY A;  1UT7 A;  2G30 A;  2JHN A;  3DPT A;  4EAI A;  1EBM A;  2NOL A;  2DKC A;  1VOL B;  1QNA A;  3PDK A;  3OSE A;  3ULX A;  3IH7 A;  1VTL E;  1N3A A;  1YTB A;  4HJH A;  1MPG A;  2V9J A;  1KFQ A;  2LAE A;  4EAL A;  2NWV A;  1YQL A;  2QRD A;  1PCZ A;  1FN7 A;  2NLV A;  4MRQ A;  2QR1 A;  3H1Z A;  1KY7 A;  1Q9U A;  3ENO C;  1QN7 A;  1M5Q 1;  2NOE A;  5BMP A;  2R5X A;  1QN8 A;  1W80 A;  3DPU A;  3NA5 A;  5JMV D;  1JFI C;  2DKA A;  2HL9 A;  1XSZ A;  2NOB A;  1VOK A;  1YQK A;  1TGH A;  3CWU A;  3RSM A;  3HS9 A;  3F0Z A;  3VN5 A;  1QNC A;  3CW7 A;  1E42 A;  1D3U A;  1QTS A;  3I0X A;  4CFF A;  1M3H A;  1QN3 A;  2PWW A;  1R4X A;  1LWW A;  1QN4 A;  2DKD A;  1N39 A;  4ROC B;  1NGM A;  1LWY A;  4EAJ A;  2F7L A;  2O3O A;  1J3M A;  1PZD A;  2IV9 A;  1UT4 A;  2QRC A;  1KYF A;  5HSH A;  1V5S A;  3I0W A;  3C04 A;  4ROE B;  5IYC P;  4IL8 A;  1KFI A;  2D0B A;  2NOF A;  4EJY A;  2QRE A;  4I8O A;  2OOY A;  3T4N A;  1LXT A;  3HS8 A;  2V92 A;  4B0A A;  2FKF A;  2OOX A;  3CWA A;  2VJ0 A;  4D7R A;  4PY5 A;  1KY6 A;  5JN5 A;  3CVS A;  5EPC A;  3CWT A;  4EJZ A;  1PCM X;  3OSM A;  3OGD A;  1LWV A;  2HZM A;  3UW2 A;  3OH9 A;  1C9B B;  5IYB P;  3ASM A;  5AN4 A;  3F10 A;  1M3Q A;  1QN6 A;  1QNE A;  2I5W A;  2NOI A;  3TDH A;  2XHI A;  1QN5 A;  1K2Y X;  2HZS A;  1N3C A;  2D0A A;  1WJW A;  2FUV A;  1TBP A;  4WXA A;  4EAK A;  3BKQ X;  1PCJ X;  1VTO A;  4WX8 A;  5BMN A;  2JPI A;  5IYD P;  1PVS A;  2D0C A;  4QG5 A;  2IV8 A;  3TE5 A;  3OC3 C;  4Q11 A;  1TBA B;  3EAY A;  2MZ8 A;  3OCI A;  1CDW A;  1YTF A;  2EHB D;  1QTP A;  1AIS A;  2JOI A;  1YQM A;  3SNS A;  2V8Q A;  2QLV A;  2FGT A;  1VKL A;  2YH5 A;  1K35 A;  4WZS D;  2HKP A;  1QN9 A;  2Y8Q A;  1HU0 A;  1MP9 A;  3D7Q A;  3RPJ A;  3EIK A;  3ENC A;  4C7P A;  1WQA A;  2YA3 A;  2Z8U A;  1NH2 A;  2HL8 A;  2Y8L A;  4D7Q A;  1T6A A;  1NVP A;  2ZFD B;  3CVT A;  3OST A;  3CWS A;  1UL7 A;  3I3W A;  2Z0F A;  1P5G X;  2NOZ A;  1KYU A;  4DUL A;  2NVM A;  2NOH A;  3D4V A;  4EAG A;  1QNB A;  1C4G A;  2MJ7 A; 
#chains in the Genus database with same CATH homology
 4TPS A;  1RM1 A;  3KTU A;  1KO9 A;  1YQR A;  1B9K A;  1KYD A;  3KRM A;  4ROD B;  3N89 A;  1UT7 A;  2G30 A;  3DPT A;  1EBM A;  2NOL A;  1VOL B;  1QNA A;  3ULX A;  3IH7 A;  1VTL E;  1N3A A;  1YTB A;  2LAE A;  1YQL A;  1PCZ A;  1FN7 A;  3H1Z A;  1KY7 A;  1QN7 A;  2NOE A;  1QN8 A;  1W80 A;  3DPU A;  1JFI C;  2NOB A;  1VOK A;  1YQK A;  1TGH A;  1QNC A;  3HS9 A;  3F0Z A;  3VN5 A;  1E42 A;  1D3U A;  1QTS A;  3I0X A;  1M3H A;  1QN3 A;  1LWW A;  1R4X A;  1QN4 A;  1N39 A;  4ROC B;  1NGM A;  1LWY A;  2O3O A;  1PZD A;  2IV9 A;  1UT4 A;  1KYF A;  3I0W A;  4ROE B;  5IYC P;  2D0B A;  2NOF A;  4EJY A;  4I8O A;  3HS8 A;  4B0A A;  2VJ0 A;  4PY5 A;  1KY6 A;  4EJZ A;  3OSM A;  1LWV A;  2HZM A;  1C9B B;  5IYB P;  3ASM A;  5AN4 A;  3F10 A;  1M3Q A;  1QN6 A;  1QNE A;  2I5W A;  2NOI A;  2XHI A;  1QN5 A;  2HZS A;  1N3C A;  2D0A A;  1TBP A;  1VTO A;  5IYD P;  2D0C A;  2IV8 A;  3OC3 C;  4Q11 A;  1TBA B;  2MZ8 A;  3OCI A;  1CDW A;  1YTF A;  1QTP A;  1AIS A;  2JOI A;  1YQM A;  3SNS A;  2FGT A;  2YH5 A;  4WZS D;  1QN9 A;  1HU0 A;  1MP9 A;  3RPJ A;  3EIK A;  2Z8U A;  1NH2 A;  1NVP A;  3OST A;  2NOZ A;  1KYU A;  4DUL A;  2NOH A;  1QNB A;  2MJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...