2JOYA

Nmr structure of 50s ribosomal protein l14e from sulfolobus solfataricus: northeast structural genomics consortium target ssr105
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
96
structure length
96
Chain Sequence
MPAIEVGRICVKVKGREAGSKCVIVDIIDDNFVLVTGPKDITGVKRRRVNILHLEPTDKKIDIQKGASDEEVKKKLEESNLTEYMKEKIKIRMPTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of 50S Ribosomal Protein L14e; Northeast Structural Genomics Consortium Target SSR105
rcsb
source organism Sulfolobus solfataricus
molecule tags Structural genomics, unknown function
molecule keywords 50S ribosomal protein L14e
total genus 18
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2joyA01
2QEXA 1VQPA 4ZN3A 4YTLA 1VQ9A 1YJ9T 2OTLT 1YI2A 1M1KU 3OW2A 1KQSA 2OTLA 1NPPA 2G3RA 3CCEA 3CCLT 1Q81U 2QEXT 5DM7R 1VQOA 2QA4A 3G4ST 2OTJT 5LL6S 1YJ9A 1YHQT 1QVGS 3CCRT 3G71T 1QVFA 2DO3A 1SSFA 3G4SA 5DLQE 5IT9E 2OTJA 2CKKA 1NZ9A 3LH0A 3CCVA 1QVFS 1VQ4T 3CC4A 1Q82C 1Q86C 1VQNT 1YIJA 2MI6A 1M1KC 1VQ8A 1X6OA 2EIFA 3CMAT 1KD1U 3CPWS 1KC8U 4X34A 2KVQG 1W2BS 1M90U 1M90C 1YJWT 5IAYA 3KBGA 3LGFA 3JAME 1VQMA 3G71A 1K73C 1YBYA 1Q7YC 3A5ZB 3HKSA 2JOYA 1VQLT 4ZN1A 1VQ7T 1VQ8T 3CCLA 3CCMA 3LGLA 1YJWA 1YIJT 3CC2T 3CPFA 1W2BA 2E6ZA 3CD6T 3I55T 2JVVA 1K8AC 1VQNA 3CMEA 3TREA 1YJNT 1VQPT 1KD1C 3I56T 1YJNA 4QQDA 1XTDA 3CMET 3DLLA 2KDSA 3CPWA 3J80E 2QA4T 1VQ6T 3CD6A 1QVGA 3G6ET 5A2QE 1VQ6A 1YI2T 1K9MU 1K9MC 3DB4A 2E70A 3DB3A 1K73U 4CRIA 3I56A 1KC8C 1VQ5T 1M1GA 2JUFA 1JJ2A 4RG2A 1KHIA 1BKBA 3CCRA 3P8BB 1NJIC 1Q86U 1N8RC 3PIPA 3CCJT 1NPRA 2LQ8A 5FLXE 3CC2A 3ER0A 1KQSS 1RL2A 1IZ6A 3OW2S 1NJIU 3I55A 5J26A 3G6EA 3OYYA 2MWOA 2LCLA 1Q82U 3CCUT 1VQKT 3CC7A 1YITT 1Q7YU 1VQ7A 1VQMT 3CCVT 3J7AF 3J81E 5J3BA 1YITA 3CC7T 1XNIA 1UEBA 3CCST 1N8RU 1VQOT 3PIOA 1VQ5A 2JNGA 3CMAA 3CCQA 1S72A 1JJ2S 5HY6A 3CCET 3CCUA 1VQKA 1Q81C 1K8AU 3CCMT 2L3RA 3CC4T 2IG0A 3CCQT 2XHCA 1VQ4A 1S72T 3CCJA 1VQLA 4TVRA 2LVMA 1EIFA 3CCSA 1YHQA 1VQ9T 2MWPA 3CXCA 3CXCS
chains in the Genus database with same CATH superfamily
2JM9A 2OX7A 2YUOA 3ZFJA 4RCCA 3ZL7C 1PSFA 1AHJB 3OW2A 4M75C 2LQKA 2JTFA 2FZKB 1Q81U 2F2VA 4KH1B 1D0ZA 5LJ3e 4F14A 3H0IA 3LH0A 3SWNC 4BE0A 4O5VA 2VGMA 1AWJA 4KUDK 1M1KC 4J7IA 1PCXA 5L8RE 4LE9A 1Q86R 2LTOA 4LUDA 5DY9A 4A4GA 2F5KA 3QZ9B 2KROA 2QQ9A 2RHZA 4KBMB 3MJXA 3M58A 3CBMA 2LZ6B 1QVFP 1M2VA 1YIJT 2RPNA 1FMWA 2NUPA 1JXOA 1WXTA 3JCMP 5GMKj 4M78D 2K57A 3A1PA 4M7AC 2RJEA 3RIRA 4F16A 4FL6A 2KDSA 3CPWA 5LJ5e 2X3WD 4FW1A 3TCJA 7AT1B 2ZZDA 1K9AA 2K2MA 3GF5A 3DB3A 4FYYB 4JLIA 1TUGB 1VQ5T 5GAMj 3HRTA 1UGPB 3MCAB 2Y90A 4F7UE 3VU3C 2EYZA 1IHVA 3PVQA 5KE2A 1NJIU 2EW3A 3RMQA 4BD3A 2BE7D 4Z88A 1LVKA 4IUUA 2DKGA 4LD6A 3J7AF 1BB9A 4E47A 1Q82R 1UHCA 1TWBA 1JRIA 5HY6A 1EX4A 3C0CA 3SB2A 3CCET 3V8KA 3JB9D 2DYIA 2L0AA 4CC4B 2NWMA 2RQWA 4C8QF 2M51A 2DVJA 2XG8D 4B6MA 4M77B 3OS0A 4DOVA 1K1ZA 1M8VA 1LJOA 5KYXA 2WACA 4MDWA 4C8QC 3SD4A 3CCRQ 1JO8A 1FWZA 2JT4A 1U3OA 2V1RA 4B9WA 3QHSA 5GAMg 3CCSQ 4A53A 1BCMA 1MMGA 4FCYA 2DTOA 3V8JA 1ZBJA 5CKHA 1S72Q 3OYEA 3EG9A 3L42A 2ZPFB 2ABLA 4NS5A 1YJ9Q 4LUEA 3GPLA 1Q95G 3CCLA 2YWWA 1JU5C 1BI1A 2XDBA 1W2BA 3M0QA 3OMCA 4PL6A 1KD1C 4M78B 4XTVA 2DEUA 2HL3A 2OTJQ 5D6YA 4E7JA 1RLQC 2HQHA 3VS0A 4E7LA 2BZYA 3OY9A 4OGEA 3ULRB 3DKMA 2K9GA 2L3SA 1D1BA 3PTAA 3VS3A 1TH7A 3CCVT 3J81E 3O8VA 4QVCA 4RCBA 4CC2A 4OB2B 4Y91A 5I11A 1RAIB 3VS5A 1TSFA 4AG1C 3CCSA 3SFMA 2HAXA 1YHQA 3CC4Q 1VQPA 4C0FA 4ELYC 1G3SA 3JCMd 2CZ6B 1D0XA 3D7SB 4FIBA 4AFUC 1WNLA 1M27C 1QMCA 4BDZA 2DK3A 1PHTA 2OTJT 4O6JA 1UJYA 1YJ9A 4DBHA 3G71T 5I2SA 2GNCA 1TG0A 3M53A 2PNIA 4M7AA 2CP7A 3M0SA 2EIFA 1YHQQ 4M77A 1BI2A 3KFVA 2RQUA 1K73C 1YBYA 1AZEA 2HDAA 5FU6C 5CCAA 1WLPB 4GLKA 1H3HA 2LNHB 2JOYA 3G7ZA 4OMPA 3X20B 4JRIA 5A0GA 1E6GA 2HSEB 4EMHA 1WHJA 3CPFA 2YDLA 3G6EQ 2KEAA 2JVVA 3VS1A 1AWXA 2KYBA 1WGSA 5KYUA 4BE1A 3QDRB 3DLMA 4PNOA 2RHXA 3BY7A 4OF1A 1FXXA 3OSSC 2XK0A 2JUFA 1AVZC 3M57A 1QVPA 4J5YA 1G3TA 1G3WA 2ENMA 2GTJA 2D9TA 3A98A 3CCRA 4OMMA 5A0DA 1PC0A 3JCMQ 1RL2A 3BFMA 2E5QA 1VYUA 3G6EA 5I21A 1OX8A 2L5QA 3C95A 4Z02A 3BW1A 1NEBA 2A37A 2XKOC 2FYKA 2GF7A 2MPXC 1VQMT 2QK0A 4IIOA 3LH5A 3ZEHA 1W4SA 2FVUA 1M2VB 2FZCB 9ATCB 3HSBA 2DBMA 4E7ZA 1VQ4A 1T0JA 3QUIA 1WI7A 2ZPBB 2KBTA 4C8QB 3MEWA 5LJ3g 2C0OA 2FO0A 4Z89A 3S3MA 4YTLA 3CEYA 4J6WA 2J6FA 4AT1B 3CMEQ 4DEXA 3BE3A 3I5RA 1VIEA 4ME7A 3RESA 3QO3A 1GCQC 4RTTA 3JV3A 4OB1B 1N5ZA 2P0PA 4J9IA 1Y07A 2YRCA 4HVWA 1WFWA 2K5LA 2RJFA 2BIVA 2GQIA 2JS2A 4JLGA 4R55A 3X26B 1U5SA 3RDVA 3G71Q 1G2BA 1RACB 3CPWS 3OMGA 3JCMf 2MYSA 1YJWT 3ASKA 3WVDB 5GAN6 2YUQA 4KH0B 2GCXA 2NYSA 2EKOA 3NMZC 3CD6T 1HSQA 2DF6A 2LJ0A 2M1HA 1VQNA 3THKA 4FSXA 1SG5A 4QQDA 1K4US 4II1A 5EC7A 3A8GB 4CI0C 4M78F 2FPDA 2O9SA 3M5AA 4N0AC 3FB9A 5GJVB 2R58A 2OAWA 1GCQA 1O9SA 3HFOA 1KC8C 2D0QB 3OBYA 1M1GA 2HKQB 2LDMA 1JJ2A 3VUBA 4NL3A 2QASA 2DX1A 4PFPA 4M7DG 5FLXE 1YI2Q 2HQXA 2QTVA 1PKSA 4IUPA 1MHNA 1ZUKA 2JJ9A 4BI3A 3CC7A 2A3LA 4F04B 1LNXA 3E9GA 2C0TA 3E1SA 3VKIA 1NM7A 1N8RU 4PJOB 2GFAA 1MMAA 3OYHA 4A4EA 1ABQA 3CCMT 3CC4T 2ZPGB 1HJDA 3VRYA 3CD6Q 5FROA 1UGVA 2JMAA 1VQ9T 2RO0A 1NG2A 5KYNA 4XTZA 2X4XA 4RTUA 4C8QD 3JRZA 4PJOE 2DZ9A 2DTIA 1H3ZA 3CCLT 2QG9B 5DM7R 2QEXT 5LJ5g 1QVGS 3NFCA 1TU0B 1JEGA 4XQ3A 2DL5A 1KD1R 1V76A 2LCCA 4FT2A 1VQNT 1I5OB 1C6VX 2EQKA 2MI6A 3NGPA 3LWIA 3EFRA 3RBBB 4IURA 1X2KA 4ANJA 2KVQG 3SWNB 1M90U 5FU6B 4BI8B 1SF9A 4KGVB 2FZGB 1AWWA 2J05A 2KYMA 5D6WA 4E6RA 4M7AE 2CSQA 3EFSA 2K3BA 3VV0A 4HCKA 1N9SA 5GAOl 4QT7A 2QTXA 3R6NA 3C94A 2O2OA 2JM8A 2XU8A 5KYYB 3GNFB 1BI3A 3FEOA 2DZCA 1ZLMA 3FIFA 3VS4A 2HNIA 2V8KA 2RJCA 3JCMh 2J7IA 5CKFA 3OYDA 2CZ1B 1NPRA 2IPOB 1G8XA 4HVVA 2KE9A 1OULA 2NLUA 3L2QA 1R8OB 1WA7A 2CDTA 3X28B 4BI4A 4DQ2A 1VUBA 3OYNA 3OYIA 2Y4YA 1X75C 4J9DA 3AT1B 1UGRB 5J3BA 2P0KA 3E2UA 4C92D 3UF4A 1LPLA 1VYTA 5GJWB 3CCUA 4MDXA 2AZVA 1K8AU 4ESRA 4PJOD 4C8QE 2X51A 1UGQB 2GGRA 2QQSA 5CKBA 3CXCA 2QEXA 2E1HA 3RMSA 2PUKB 1Y71A 2E4HA 4F7UB 2FPEA 1WHLA 2KT8A 2JTMA 3LWHA 1M4ZA 1D0YA 4M7AF 5CQXA 1QVGP 2HKNA 3G4ST 4J9FA 2EPDA 1NE8A 3VYHB 2OTJA 2H3EB 3I56Q 2R57A 1C0MA 1X6OA 3CMAT 3OBWA 2EJ9A 3HL8A 4HXJA 4C0DC 2RHUA 2BZXA 5GANh 1K9MR 1Q7YC 4L59A 1H8KA 3BDUA 1KQ1A 1D09B 1P92A 3JB9J 3OSVA 1KQ2A 1FYNA 4HCZA 5AT1B 2RB6A 1K8AR 3SHWA 1XTDA 3DLLA 1N8RR 1VQ6T 1QVGA 2DM1A 3H41A 5EG2A 1QCOA 4EMKB 3REAB 3EG0A 2BUDA 2PQWA 1ABOA 4J8OA 4DBRA 2ROLA 2COZA 3P8BB 4BY6B 4J9BA 4PLLA 2CH4A 1ZSZC 3OYKA 1TUCA 3OW2S 2K6DA 4AFZC 2YLBA 4PFZA 2DRMA 3RKWA 5GAN2 4LNPA 3UATA 1OYXA 1YITT 5CKDA 1Y96B 2I0NA 2RHIA 1GBQA 4ZNXA 2RQTA 2RHYA 2K3YA 4OMFB 3PIOA 4EMGA 1S72A 1YCYA 1JJ2S 3HHTB 4PJOA 2IG0A 2LT4A 2L3PA 1UGSB 2EFIA 1NLOC 4C92E 2JW4A 3BDLA 3A8MB 1R0BG 4CC3A 3RNJA 3MP1A 3JB9G 2JS0A 2VUBA 1FMKA 1KQSA 2C0IA 4EMKC 2YT6A 4LDVA 3I9QA 4HA8A 3GP8A 4HCBA 1E6HA 3IQLA 3EGXB 1QVFA 4BB7A 2JTEA 2ATCB 3M0PA 2K7AA 1VQ4T 2ESWA 2LRQA 2LJ1A 4KGZB 4N0AA 3JB9I 1KD1U 1VQ7Q 2DRKA 4FW2A 4X34A 3CCUQ 5IAYA 4L5GA 1PRLC 1VQMA 2AZSA 4JRPA 2O31A 3N5BB 4QW2A 2DL3A 1RI0A 4XU0A 1PD0A 2EGEA 2CGHA 2KT1A 3QXEB 3AHUA 1K8AC 3L2UA 3CC2Q 2EJFA 3HRSA 2QDLA 2Y4XA 1BBZA 3TU4K 4WCIA 1IGQA 1NYGA 3OYLA 5GANf 2P84A 3JCMb 4PFOA 2MAMA 1QW1A 1BCOA 3JCMg 2KK4A 4JDSA 1VQPQ 1PM3A 1BKBA 1BIBA 1UFFA 2DVEA 4DEYA 1WQ7A 3PIPA 3RERA 4GLMA 1SSHA 1WX6A 2GBQA 5CKEA 2LNVA 2MWOA 4D8KA 1QP2A 2SEMA 3CCUT 2CP3A 4C8QA 2F2XA 1OU9A 3L2RA 2CUBA 3F70A 4XK8E 2MIOA 2XIDA 2MCNA 1XOVA 3QJ6A 3CCJA 4J9GA 2RJDA 4QQ6A 3UWNA 3V7RA 3HRUA 1WXBA 1W2BP 1ZUUA 1UUEA 1YI2A 1TXQA 4OGCA 4HVUA 4AFQC 3INZA 1AOJA 3CCEA 3TSWA 3M9QA 2QA4A 1YHQT 2DO3A 1Y7XA 2CKKA 1NZ9A 2VASA 2QQRA 3WXMB 3CC4A 1MV3A 4D6WA 1YWOA 1E7OA 5IXFA 1I8FA 5FRNA 1K76A 4M4ZA 4B9XA 1WQWA 1BU1A 1H641 4OB0B 2F1LA 4J9CA 4AMCA 1OZ2A 2KQWA 3I55Q 2CT4A 3G71A 1ZSGA 1VQLT 2XI9A 3PNWC 4EIKA 2B8AA 4RTXA 2A28A 3CCEQ 2L3QA 4OMQA 5GAMd 2W0ZA 4M7DA 4RG8A 4M77C 4M75B 2LP5A 4JS5A 3M0TA 4J6XA 2E70A 1K73U 2L89A 3FLGA 2WSEE 2V8IA 3HTRA 1WDXA 1PG5B 2JXBA 1ZA1B 2RNAA 2DL8A 2QEXQ 4JZ4A 4OMLA 1NJIC 1Q86U 2F69A 4N4IA 3L2WA 3UA7A 2HQEA 2LQ8A 1WIEA 1AD5A 1JQQA 2ED1A 3OYMA 1I4K1 3M4GA 4LD9K 1D3BA 3QBYA 3OYYA 2MF2A 2LCLA 4C0ZA 2RK1A 5KH6A 1SKUB 5GMKm 2CH4W 1NEGA 4P5NA 3CC7T 4EMKA 2OAUA 3M4YA 4XTXA 3A8LB 1CKAA 1WJSA 1VQOQ 1VQLA 2VXEA 4C92F 2J06A 3TEEA 1QCFA 4OMOA 2V1QA 1VQ9A 1SRMA 2A36A 2E65A 5L23A 1M1KU 1EFNA 4J6YA 2BZ8A 1CSKA 2RI3A 4XTYA 2MMPA 2KNBB 1UG1A 3G4SA 3CBOA 1HD3A 2FPFA 4JS4A 3VS7A 2QI2A 3QG1A 4M7AD 2RH2A 2VVKA 3VS6A 5C6SA 2EKHA 2H3JA 1RADB 2RD1A 2X9HA 4BY6C 4RUGA 3TSZA 1GFDA 4M7DB 1NBEB 3LGLA 2O4XA 4C92A 2CP2A 2GQVA 3OYAA 5GAOm 3EG1A 3TREA 3WVEB 3NHNA 4IUQA 5LJ5d 1JXMA 1I0CA 3J80E 2QA4T 4JJCA 2IVWA 4N4GA 1TUDA 1K9MU 4ELZC 4HKEA 1M2OA 1Z9ZA 4CRIA 1G83A 2O9VA 4QVDA 1IHWA 1HXDA 3S3NA 2M0OA 3I35A 1RAHB 3RUXA 4OMNA 4WTOB 4XU1A 1V29B 3QJYA 1VQ5Q 1AWOA 2KXCA 2EJGA 3EAEA 4CC7A 1YN8A 2EBPA 1UHFA 2RMOA 4OB3B 4M77D 1XNIA 4LDUA 3FRNA 3GBQA 2YSQA 2OI3A 3C4SA 3ME9A 3CCQA 1Z9QA 1I5LA 8ATCB 2DD4A 1TTHB 1M3BA 4M75E 2A7YA 1Q82C 4FM4B 3L2ZA 5KYUB 2O88A 1MNEA 1W1FA 3P8HA 1UJ0A 3GOXA 3JSCA 4DBFA 2DXBA 1NPPA 2LMJA 1X69A 2R5MA 4RTWA 3RKYA 1GXIE 1H92A 2VKNA 1Y57A 4KUIA 4RMOA 1VQNQ 1WJQA 1VOMA 5DLQE 5FRMA 1QVFS 4PJOC 3LW5E 2D8HA 5KYWB 2PTKA 4A4FA 3META 2EWNA 2DLPA 1M5Q1 1G3YA 1Y0MA 1YNZA 4E7KA 1BYMA 1VQLQ 1BIAA 5I2MA 3SDZA 3A5ZB 2QQBA 4BUGA 1U06A 2NUPB 2BTTA 4JUVA 1D1AA 2AIRB 3CCMA 5IH2A 3OYJA 3EHQA 1ZQ1A 2E6ZA 3JCMW 2VYTA 3I55T 3JCMe 1AEYA 3E19A 5CR2A 4M75G 2IIMA 5GAMh 2KR3A 2WSFE 2E3IA 3PT9A 1VA7A 2JN0A 2DJZA 1OX9A 3E9FA 1PKTA 3L2VA 4M75F 4KRTA 1GCPA 4BACA 5LJ3d 4M77E 5CVIA 4MZMA 2F5TX 2DETA 2FHDA 2K5FA 3X24B 4ZGDB 4M78C 3EGDA 4QVZA 3OB9A 3QSUA 3PVLA 3CBPA 3OS5A 2KRSA 8AT1B 1Q7YU 1YP5A 1YITA 4XTWA 4X9CA 4C92C 3CCST 2ROTA 5KE3A 2DPPB 3L1AA 2X4YA 1KC8R 3HPWA 2DBKA 2ZPEB 1VQ8Q 2G6FX 4PJNA 4N4HA 1S72T 1T0HA 1EIFA 2RA2A 3EG3A 2K5IA 3A8OB 3CPWP 1WHHA 3MKDA 4M78A 2RN8A 1IXDA 1YJ9T 2OTLT 2LX9A 1WXUA 4PJLA 2XDDA 2Z0WA 4RKUE 2EQIA 4HCCA 2RF0A 2QAZA 4J9HA 1MNDA 2V26A 4PJOG 3CCVA 2E3HA 2CYZB 1T3LA 3OYCA 2L2PA 3CCQQ 1FMVA 2E64A 4PKCC 1W2BS 2DL7A 4JJDA 2COWA 4J83A 5GAMe 1WHMA 4XAXB 1UECA 1ZUYA 3QYHB 5GANj 4FT4A 3HKSA 4FYVB 5HCKA 2A0FB 5DLOA 3MP8A 3EGUA 2FRWA 2XDPA 1EZZB 4QKUA 1M90R 1B34A 1IO6A 1PRMC 2W10A 4LDYA 1PSEA 2D0NA 2QA4Q 3CCVQ 2BKDN 3M0UA 4R56A 2FRYA 5HKCA 3G6ET 1K9MC 3DB4A 4RTZA 1U8RA 2XD0A 2ZGWA 3REBB 1V1CA 2EQUA 2RI2A 4XTUA 1SHFA 2GTOA 4KGXB 3CCJT 3FJPA 4J9EA 1M8MA 1IZ6A 5J26A 1OEBA 5I22A 4MMLA 4WF2A 1X2QA 2QQAA 5KCOA 4ZTFA 1X6GA 2I2LA 4AFSC 2KRNA 2X35A 2V8JA 2DXUA 1U1SA 4Y92A 4F17A 2EAYA 1OI1A 2FL7A 1WPYA 3VUZA 2CUDA 4GBQA 3Q1JA 4OP0A 1X01A 1VQMQ 3OS2A 4TVRA 2LVMA 3OYGA 1B7TA 1F1BB 3NTIA 1SEMA 2RM4A 5M9OA 2CP0A 2ZPHB 4PK4A 3PGGA 4MZPA 4M7DC 1WZOA 2OTLA 3VS2A 1OV3A 5D6XA 1GL5A 4FU6A 3V7CA 2KXDA 2KI7A 2K79A 5LL6S 1WHGA 1OOTA 1YJNQ 1I81A 4M7AB 4M78G 5IHIA 1YIJA 4ATOA 3QKJA 5IXBA 1QWFA 2EQMA 4IUVA 4C5EA 2H8HA 2E41A 3KBGA 2YHTA 2LQWA 5IN1A 4M7DD 5GAOn 3PMIA 3CC7Q 2DD5A 3I5SA 5GAOp 4GY5A 4J7FA 3M59A 2F2WA 3CC2T 3UPUA 2DXCA 1B07A 2DJQA 3M54A 4FYWB 1YCSB 5CQYA 3CMEA 3M0RA 1YJNT 3MO8A 1VQPT 4R0KA 2CP6A 1YIJQ 2RQVA 5GAOr 1MGQA 2QDYB 5ECAA 1VQ6A 3GIBA 3O5ZA 1NLPC 1I1JA 2HCKA 3SWNA 1C1AA 3V8LA 5FWBA 5HK0A 1JJ2P 3H6ZA 2AT1B 4Q5WA 3CC2A 1AZGB 1K0SA 1ZBXA 1RUWA 4M75A 3HFNA 2KAFA 5GMKe 3CMAQ 2DILA 3MEVA 4JRQA 1Q82U 2DAQA 1IB8A 4FYXB 1X6BA 2HEQA 2CSIA 4M77G 4M78E 3EGXA 3JCMV 4ZGJB 4IUTA 4PJJA 1SHGA 4AG2C 2XHCA 5GMKh 3LYIA 2J6KA 4M77F 1Y96A 2OJ2A 2VWFA 2AKLA 3G1JA 4ZN3A 4ZTJA 1R0CB 4F7UF 1O75A 3VYGA 2NUTA 2LQNA 2X3XD 2DL4A 5A0LA 2G3RA 3FC3A 2HSPA 4DA4A 3ZBDA 4HT8A 1HK9A 3OYBA 2HMAA 1JBMA 1G5VA 3UT1A 2EYWA 2P4TA 2ZPIB 2KGTA 1ARKA 2QYZA 2M16A 2GFUA 4D8DA 5KYWA 3EHRA 1QKXA 2E6NA 4PLIA 4EDUA 4HT9A 1KG1A 1M90C 1YFNA 1GFCA 1K0XA 4PJMA 4MZTA 3JCMc 2DEQA 3EH2A 4ZN1A 1VQ8T 2O01E 1SPKA 2VB6A 1TS9A 2QXFA 3QYGB 3S6WA 1B34B 1KFZA 5HK3A 1PD1A 2DYBA 4KULA 5FWCA 3CMET 4IKFA 1PWTA 2X4JA 1RI9A 3S3OA 2ED0A 5GANe 1WJRA 1LCKA 5IHKA 4RG2A 3MEUA 1VQ9Q 1UE9A 1A0NB 2E12A 3ER0A 3H0FA 2C06A 5IHNA 1XJWB 2DA9A 3I55A 2JZ2A 1M3AA 2CZ7B 1UDLA 4UC4A 3MHXA 3CCLQ 2PVDB 3OW2P 2MOXA 4C0DB 1DJ7B 3OA6A 3CCJQ 1W70A 4A54A 1ZA2B 2LC4A 1UEBA 2LX7A 4E7SA 1VQOT 1VQ5A 2BE9B 3A8HB 3V7SA 1S1NA 1VQKA 1J3TA 1Q81C 2L3RA 3CCQT 1KK7A 3URGA 2L8DA 4F7UA 5CIUA 4E7HA 4KT0E 3CXCS 1M30A 4X9DA 5AYFA 1M1FA 2E10A 5GANg 4C92B 4BE2A 1QCNA 1KHCA 4JJBA 5J39A 1RAFB 3MEAA 3SEMA 2XMFA 2YRVA 3X25B 2M02A 1B3QA 5FU7C 1VQOA 1OPLA 2K2VA 1BK2A 4C5GA 1NYFA 5GAN4 1Q86C 4V2SA 3VRZA 2CREA 4IIMA 1VQ8A 1N27A 4K11A 3FDRA 1GBRA 1K73R 2ZCFB 1W6XA 2D1XA 1ZSZA 4EPCA 3OYFA 2HL5C 1Q7YR 4JPBW 3OS1A 1YWPA 2LJ3A 1RAEB 3FJ5A 1HYOA 2WSCE 2EYQA 1GRIA 1M9SA 3PFSA 4C0GA 3H0HA 2CZ0B 3CXCP 2ECZA 2P4RA 1QLYA 5LJ5h 4FSSA 5D7UA 1ACMB 5LJ3j 2YRDA 3CQTA 2VC8A 3UA6A 1YJWQ 3NPFA 3I56A 2EQJA 4RTYA 2YUNA 2JMCA 1SRLA 2PU9B 5LJ5j 1D3BB 2E5KA 3QPHA 1KIKA 1KQSS 3MP6A 4X1VA 2KSSA 2LT1A 2ZAEA 4E7IA 4E2FB 2DTHA 5GAN5 3JB9F 1FX7A 1N6AA 2DIGA 1VQ7A 4DOWA 4XU2A 1OQKA 2QGGA 2PVOB 2QGFB 4QQGA 2JNGA 1WYXA 3RR6A 5KYXB 3VJPA 3GLXA 1RAGB 1AT1B 2NUZA 1MV0B 3M56A 1ZSZB 5GAN3 4C5HA 1UB4A 1RLPC 5CO7A 1WHKA 2O4XB 5CK9A 2M9UA 1QWEA 4ORZA 3QZ5B 3P8DA 2DERA 3R6OA 3JCMJ 2R5AA 3EG2A 1MMDA 3EGDB 1MMNA 5IT9E 2DE0X 2COYA 1ZX6A 4JJNK 4VUBA 5GMKi 2KY9A 1VQ6Q 5CAIA 3LX7A 1QQJA 1KC8U 2HZYA 1VQKQ 5GAOq 2K4YA 4BDYA 3JAME 4LDWA 2CT3A 2LCSA 4OVAA 1VQ4Q 2D6FA 1X43A 3HP9A 5LJ5f 2YUPA 1M1KR 1VQ7T 5GAMf 1YJWA 1ZHIA 3UDCA 5KCHA 4LXCA 5LJ3f 4M7DF 4C5IA 4LDXA 2DIQA 2EGCA 3QDFA 4Z8AA 1YITQ 2DXTA 1KJWA 2CP5A 1XQHA 2RK2A 1BI0A 2DFUA 1VYVA 1YJNA 2PZ1A 3CD6A 4XU3A 1YI2T 1Q81R 1JB0E 3EG9B 3G4SQ 2SRCA 1KHIA 2EGAA 1X27A 2M0YA 2RQRA 3MPUB 2HBPA 2RI5A 3RKXA 3EFOA 2HD0A 1VQKT 4PJOF 1QP3A 1VIFA 2FB7A 1MUZA 1IGUA 2VGNA 2EYXA 4NL2A 2MK5A 2EYYA 3QWYA 3LLRA 5LJ3h 2MWPA 5KYYA 5FW9A 2XICA 1OU8A 4ZGEB 2HBWA 2YLCA 2K3XA 3PMTA 2J6OA 1OZ3A 4A4HA 3CCRT 2FEIA 3KUFA 4L6V5 4F7UG 1SSFA 4A4KA 4M7DE 1T3SA 3GNGA 3T9NA 2DNUA 2EVRA 1I07A 2NUTB 2AHJB 3NTHA 4RTVA 3TVTA 2YXYA 4JZ3A 1D1CA 2P0QA 2PVGB 3LGFA 4C8QG 5C0MA 2FG0A 4Y28E 4MMKA 1M3CA 3JB9H 3NTKA 1R77A 2PUOB 3U23A 1N9RA 1CKBA 3C12A 3JCMX 1RABB 1UTIA 5GMKl 4JRKA 3I56T 1RAAB 3H8ZA 3OQ5A 1TOVA 2CS7A 2B86A 1KQSP 1OPKA 2D8JA 5A2QE 1QKWA 3TQ7P 3EFOB 2AKKA 5GANd 2KRMA 1N8RC 4NOYA 1NJIR 4C92G 2OTLQ 2KMTA 1IREB 4M75D 3KXTA 2DMOA 2X4WA 3PE0A 1IRXA 5GAN8 2VXFA 6AT1B 1LOJA 3M55A 4A63B 5FU7B 1U1TA 2AK5A 3CCMQ 3H9NA 4LN2A 4M7AG 3CMAA 2VV5A 3QIIA 4DBQA 1PNJA 1KSWA 2A08A 5GAN7 3QWXX 3EH1A
chains in the Genus database with same CATH topology
2RO0A 3TEEA 4ZN3A 4ZTJA 1VQ9A 4XTZA 3ZFJA 1O75A 2X4XA 1PSFA 4RCCA 2E65A 3VYGA 4F7UF 1M1KU 4C8QD 1AHJB 3JRZA 3OW2A 4PJOE 2DZ9A 4M75C 5A0LA 4J6YA 2LQKA 2DTIA 2G3RA 2JTFA 2RI3A 1H3ZA 3CCLT 1Q81U 3FC3A 4XTYA 5DM7R 3ZBDA 2QEXT 4DA4A 4HT8A 5LJ5g 1HK9A 2MMPA 5LJ3e 3OYBA 3NFCA 1QVGS 4XQ3A 1JBMA 3G4SA 3CBOA 3LH0A 3SWNC 1G5VA 2LCCA 3UT1A 4BE0A 4O5VA 2P4TA 2VGMA 2ZPIB 4KUDK 4JS4A 2M16A 4FT2A 1VQNT 2GFUA 2QI2A 2EQKA 3QG1A 2MI6A 3LWIA 1M1KC 2E6NA 3EFRA 4J7IA 4M7AD 2RH2A 5L8RE 4IURA 4PLIA 4EDUA 4HT9A 1KG1A 2LTOA 2KVQG 3SWNB 1M90U 5DY9A 4A4GA 1M90C 5FU6B 2F5KA 4BI8B 3QZ9B 5C6SA 2QQ9A 2RHZA 4KBMB 2H3JA 2RD1A 4MZTA 3JCMc 3M58A 5D6WA 3CBMA 2DEQA 4BY6C 4ZN1A 1VQ8T 4M7AE 4M7DB 2O01E 3LGLA 2O4XA 4C92A 1YIJT 3EFSA 3VV0A 3JCMP 2GQVA 5GMKj 4M78D 1N9SA 3OYAA 5GAOl 2QTXA 5GAOm 2QXFA 2K57A 3QYGB 3S6WA 3C94A 1B34B 3TREA 3WVEB 5HK3A 4M7AC 2RJEA 2XU8A 3GNFB 3RIRA 4IUQA 5LJ5d 1BI3A 3FEOA 4FL6A 4KULA 2DZCA 3CMET 2KDSA 3CPWA 4IKFA 3J80E 5LJ5e 2X4JA 2QA4T 3TCJA 2ZZDA 3S3OA 2IVWA 4N4GA 3FIFA 1K9MU 3GF5A 3DB3A 4ELZC 5GANe 2HNIA 1WJRA 4JLIA 2V8KA 4HKEA 2RJCA 4CRIA 1VQ5T 5GAMj 3JCMh 4RG2A 3MEUA 3HRTA 1UGPB 4QVDA 5CKFA 2E12A 2Y90A 3MCAB 4F7UE 1HXDA 3OYDA 3S3NA 2CZ1B 1NPRA 3VU3C 2M0OA 3ER0A 3RUXA 2C06A 5KE2A 4XU1A 1NJIU 3I55A 2JZ2A 1V29B 2NLUA 3L2QA 1R8OB 3QJYA 2CZ7B 3RMQA 2EJGA 4BD3A 3EAEA 3X28B 4UC4A 4BI4A 3MHXA 4DQ2A 1VUBA 2PVDB 3OYNA 4IUUA 3OYIA 2Y4YA 4C0DB 1X75C 1DJ7B 2DKGA 1UGRB 4LD6A 3OA6A 3J7AF 5J3BA 4A54A 4E47A 4OB3B 2P0KA 4M77D 1XNIA 2LC4A 1UEBA 3FRNA 4LDUA 4C92D 1VQOT 3C4SA 1JRIA 1VQ5A 3ME9A 3A8HB 3V7SA 3CCQA 5HY6A 3SB2A 3CCET 3V8KA 3CCUA 3JB9D 1VQKA 1I5LA 4MDXA 1Q81C 1K8AU 2L3RA 2DD4A 3CCQT 4PJOD 3URGA 4C8QF 4C8QE 2L8DA 4F7UA 5CIUA 1UGQB 4E7HA 4M75E 2A7YA 2XG8D 1Q82C 2QQSA 4KT0E 5CKBA 3CXCA 3CXCS 2QEXA 4X9DA 2E1HA 1M1FA 2E10A 3L2ZA 4FM4B 4M77B 5AYFA 3RMSA 4C92B 3OS0A 4BE2A 3P8HA 4DOVA 1M8VA 1LJOA 1KHCA 2WACA 3GOXA 2PUKB 4MDWA 4C8QC 1Y71A 4F7UB 3JSCA 2DXBA 3SD4A 5J39A 1NPPA 3RKYA 2R5MA 3MEAA 2JTMA 1GXIE 3LWHA 1M4ZA 2YRVA 1FWZA 3X25B 4M7AF 5CQXA 5FU7C 1VQOA 3G4ST 4KUIA 4RMOA 2K2VA 1WJQA 4B9WA 1NE8A 3VYHB 3QHSA 5DLQE 5GAMg 5FRMA 1QVFS 2R57A 4PJOC 3LW5E 4A53A 4C5GA 4A4FA 3META 5GAN4 2EWNA 2DTOA 1Q86C 3V8JA 4V2SA 1M5Q1 1VQ8A 1N27A 1X6OA 5CKHA 3CMAT 3OYEA 1G3YA 4E7KA 3FDRA 1BYMA 3OBWA 2EJ9A 2ZCFB 3HL8A 1BIAA 4C0DC 5I2MA 3L42A 2RHUA 2ZPFB 3SDZA 5GANh 1Q7YC 3A5ZB 4L59A 4NS5A 4EPCA 2QQBA 3OYFA 4BUGA 3GPLA 3BDUA 4JUVA 3CCLA 3CCMA 3OS1A 1KQ1A 2XDBA 1BI1A 1P92A 3OYJA 3JB9J 1W2BA 1ZQ1A 2E6ZA 2WSCE 3JCMW 2EYQA 2VYTA 3OSVA 3I55T 1M9SA 3JCMe 3E19A 5CR2A 1KQ2A 3OMCA 4M75G 4HCZA 4PL6A 2RB6A 3PFSA 4C0GA 1KD1C 4M78B 1XTDA 2CZ0B 2WSFE 5GAMh 3DLLA 3PT9A 1VQ6T 5LJ5h 2JN0A 2DJZA 1QVGA 5EG2A 4XTVA 4EMKB 5LJ3j 3E9FA 2VC8A 3L2VA 4M75F 2BUDA 2PQWA 3I56A 2EQJA 4J8OA 5D6YA 4E7JA 2PU9B 3P8BB 4M77E 5LJ3d 5LJ5j 4BACA 1D3BB 5CVIA 4BY6B 4MZMA 4PLLA 3QPHA 2F5TX 3OYKA 1KQSS 3MP6A 3OW2S 4E7LA 2FHDA 2K5FA 2KSSA 2LT1A 3OY9A 4OGEA 3X24B 4ZGDB 3DKMA 4M78C 4E7IA 2YLBA 1KC8C 4QVZA 3OB9A 3RKWA 3QSUA 5GAN2 1OYXA 2DTHA 3CBPA 3OS5A 1FX7A 5GAN5 3PTAA 1YITT 3JB9F 1Q7YU 1N6AA 1TH7A 2DIGA 5CKDA 1VQ7A 1Y96B 3CCVT 3J81E 2RHIA 3O8VA 4DOWA 4QVCA 1YITA 4XU2A 2RHYA 4XTWA 4X9CA 4RCBA 4C92C 3CCST 5KE3A 2DPPB 2PVOB 2K3YA 2X4YA 3L1AA 4OMFB 4QQGA 3HPWA 2JNGA 3PIOA 4EMGA 1S72A 1YCYA 4OB2B 4Y91A 3GLXA 2ZPEB 3HHTB 3VJPA 1JJ2S 4PJOA 4N4HA 2IG0A 1S72T 2LT4A 3M56A 5GAN3 4C5HA 1UGSB 2EFIA 1UB4A 1EIFA 2RA2A 4C92E 3SFMA 3CCSA 2HAXA 1YHQA 3BDLA 2K5IA 3A8OB 5CO7A 1VQPA 2O4XB 3A8MB 4M78A 5CK9A 4C0FA 2M9UA 4ELYC 1G3SA 1YJ9T 2OTLT 2LX9A 3MP1A 3JCMd 3QZ5B 3JB9G 2CZ6B 3P8DA 2VUBA 2XDDA 4FIBA 1KQSA 3R6OA 3JCMJ 2R5AA 4EMKC 1WNLA 4RKUE 4LDVA 4HCCA 4BDZA 4HA8A 2DK3A 3GP8A 4HCBA 2OTJT 4O6JA 1YJ9A 1QVFA 3G71T 5IT9E 4BB7A 3CCVA 4PJOG 5I2SA 4JJNK 2CYZB 1VQ4T 4VUBA 5GMKi 2KY9A 3M53A 2LRQA 3OYCA 4M7AA 4N0AA 2EIFA 5CAIA 3JB9I 1KD1U 3LX7A 1KC8U 4X34A 2E64A 4PKCC 1W2BS 4M77A 1BI2A 4L5GA 2K4YA 5IAYA 5GAOq 4BDYA 3JAME 4LDWA 1VQMA 4JRPA 4J83A 5GAMe 4OVAA 1K73C 4XAXB 2D6FA 1YBYA 3QYHB 3HP9A 3N5BB 5FU6C 4FT4A 5CCAA 4GLKA 3HKSA 5LJ5f 2JOYA 4QW2A 3G7ZA 1VQ7T 5GAMf 3X20B 1RI0A 4JRIA 1ZHIA 3MP8A 2CGHA 4XU0A 3UDCA 5A0GA 5KCHA 5DLOA 2XDPA 4EMHA 1B34A 3CPFA 5LJ3f 4M7DF 4LDYA 4C5IA 4LDXA 2DIQA 3QXEB 1PSEA 3AHUA 2JVVA 1K8AC 2DXTA 3L2UA 1XQHA 2RK2A 1BI0A 2BKDN 2EJFA 4R56A 1WGSA 1YJNA 3HRSA 4BE1A 2Y4XA 3QDRB 3TU4K 3OYLA 3DLMA 5HKCA 3CD6A 5GANf 4XU3A 3G6ET 4PNOA 1YI2T 2RHXA 3JCMb 3BY7A 1K9MC 3DB4A 4OF1A 2MAMA 1QW1A 1FXXA 2XD0A 3OSSC 1JB0E 3JCMg 2ZGWA 1U8RA 2KK4A 2XK0A 4JDSA 2EQUA 2JUFA 2RI2A 4XTUA 1KHIA 1BKBA 1BIBA 1QVPA 1G3TA 1G3WA 2DVEA 3M57A 4J5YA 3CCRA 2D9TA 1WQ7A 5A0DA 3PIPA 3CCJT 3FJPA 3RERA 3JCMQ 1RL2A 1IZ6A 3BFMA 5CKEA 2E5QA 2HBPA 2RI5A 5J26A 3RKXA 4MMLA 3G6EA 5I21A 2LNVA 2L5QA 2MWOA 1QP2A 2HD0A 3C95A 4WF2A 3BW1A 4Z02A 2QQAA 2XKOC 5KCOA 3CCUT 4ZTFA 3CCRT 4C8QA 1VQKT 2FYKA 2GF7A 1VQMT 2I2LA 4PJOF 1QP3A 3L2RA 2X35A 2V8JA 1VIFA 2DXUA 1U1SA 3F70A 4XK8E 2FB7A 2EAYA 1OI1A 2FL7A 2XIDA 3ZEHA 1W4SA 1WPYA 2FVUA 3VUZA 2VGNA 3Q1JA 3HSBA 4OP0A 1XOVA 1X01A 4NL2A 3QJ6A 1VQ4A 3QUIA 3CCJA 3OS2A 4TVRA 2LVMA 2ZPBB 3OYGA 3LLRA 5LJ3h 3NTIA 2MWPA 2RJDA 4QQ6A 4C8QB 3MEWA 2RM4A 3UWNA 3V7RA 5LJ3g 3HRUA 3S3MA 4YTLA 3CEYA 4J6WA 2XICA 2OTJA 5M9OA 2ZPHB 1VIEA 4ME7A 1YI2A 3RESA 3QO3A 3PGGA 4MZPA 4OGCA 4M7DC 2OTLA 3INZA 4ZGEB 5D6XA 3CCEA 2YLCA 2K3XA 4OB1B 2P0PA 3PMTA 4FU6A 3M9QA 3V7CA 1OZ3A 1Y07A 2QA4A 4A4HA 5LL6S 1YHQT 2K5LA 3KUFA 2RJFA 2DO3A 4L6V5 1SSFA 4A4KA 4F7UG 2BIVA 1I81A 1Y7XA 2CKKA 1NZ9A 4M7AB 2QQRA 4JLGA 3WXMB 3X26B 4R55A 4M7DE 3GNGA 4M78G 3CC4A 4D6WA 3T9NA 1YIJA 1I8FA 4ATOA 3QKJA 5FRNA 2AHJB 3NTHA 3CPWS 3OMGA 3JCMf 2EQMA 4IUVA 4B9XA 4C5EA 1WQWA 2E41A 1YJWT 3ASKA 3WVDB 5GAN6 1H641 2P0QA 2PVGB 2YHTA 3KBGA 3LGFA 4OB0B 5IN1A 4C8QG 5GAOn 4M7DD 1OZ2A 2KQWA 5C0MA 3G71A 4Y28E 3PMIA 4MMKA 2DD5A 2GCXA 1VQLT 2XI9A 3PNWC 5GAOp 3JB9H 3NTKA 2B8AA 4GY5A 4J7FA 2PUOB 2EKOA 3M59A 3CC2T 3UPUA 2DXCA 1N9RA 3C12A 3CD6T 3JCMX 2M1HA 1VQNA 3M54A 5CQYA 3CMEA 5GAMd 4FSXA 5GMKl 1YJNT 3MO8A 1VQPT 4JRKA 3I56T 3H8ZA 4QQDA 3OQ5A 4RG8A 4M7DA 2CS7A 4II1A 5GAOr 3A8GB 1MGQA 4M77C 4CI0C 2QDYB 4M75B 4M78F 4JS5A 5A2QE 1VQ6A 3GIBA 4J6XA 3M5AA 2E70A 4N0AC 1K73U 2L89A 3FB9A 3FLGA 2R58A 1O9SA 2WSEE 2V8IA 2D0QB 1M1GA 3HFOA 3OBYA 2LDMA 3SWNA 5GANj 1JJ2A 3VUBA 4NL3A 1NJIC 5GANd 1Q86U 2F69A 4N4IA 3L2WA 1N8RC 3V8LA 5HK0A 2HQEA 3H6ZA 4M7DG 2LQ8A 4NOYA 5FLXE 4Q5WA 3CC2A 2HQXA 4C92G 2KMTA 1ZBXA 1IREB 4M75D 3OYMA 3KXTA 4M75A 1I4K1 3M4GA 4IUPA 4LD9K 1D3BA 3HFNA 1MHNA 3OYYA 2KAFA 2X4WA 3QBYA 5GMKe 2MF2A 3MEVA 2LCLA 4JRQA 1Q82U 5GAN8 2VXFA 2RK1A 2DAQA 4BI3A 4C0ZA 1LOJA 2A3LA 5KH6A 3CC7A 3M55A 5GMKm 1LNXA 5FU7B 4M77G 3E9GA 4P5NA 3E1SA 3CC7T 4EMKA 2OAUA 3VKIA 1U1TA 1N8RU 3M4YA 4M78E 4PJOB 2GFAA 3OYHA 4M7AG 3CMAA 3JCMV 4ZGJB 4XTXA 3A8LB 2VV5A 4IUTA 1WJSA 4A4EA 3QIIA 5GANg 3CCMT 3CC4T 2ZPGB 2XHCA 5GMKh 1VQLA 3LYIA 2VXEA 4M77F 4C92F 5FROA 5GAN7 1Y96A 1VQ9T 1YJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX A;  1VQP A;  4ZN3 A;  4YTL A;  1VQ9 A;  1YJ9 T;  2OTL T;  1YI2 A;  1M1K U;  3OW2 A;  1KQS A;  2OTL A;  1NPP A;  2G3R A;  3CCE A;  3CCL T;  1Q81 U;  2QEX T;  5DM7 R;  1VQO A;  2QA4 A;  3G4S T;  2OTJ T;  5LL6 S;  1YJ9 A;  1YHQ T;  1QVG S;  3CCR T;  3G71 T;  1QVF A;  2DO3 A;  1SSF A;  3G4S A;  5DLQ E;  5IT9 E;  2OTJ A;  2CKK A;  1NZ9 A;  3LH0 A;  3CCV A;  1QVF S;  1VQ4 T;  3CC4 A;  1Q82 C;  1Q86 C;  1VQN T;  1YIJ A;  2MI6 A;  1M1K C;  1VQ8 A;  1X6O A;  2EIF A;  3CMA T;  1KD1 U;  3CPW S;  1KC8 U;  4X34 A;  2KVQ G;  1W2B S;  1M90 U;  1M90 C;  1YJW T;  5IAY A;  3KBG A;  3LGF A;  3JAM E;  1VQM A;  3G71 A;  1K73 C;  1YBY A;  1Q7Y C;  3A5Z B;  3HKS A;  2JOY A;  1VQL T;  4ZN1 A;  1VQ7 T;  1VQ8 T;  3CCL A;  3CCM A;  3LGL A;  1YJW A;  1YIJ T;  3CC2 T;  3CPF A;  1W2B A;  2E6Z A;  3CD6 T;  3I55 T;  2JVV A;  1K8A C;  1VQN A;  3CME A;  3TRE A;  1YJN T;  1VQP T;  1KD1 C;  3I56 T;  1YJN A;  4QQD A;  1XTD A;  3CME T;  3DLL A;  2KDS A;  3CPW A;  3J80 E;  2QA4 T;  1VQ6 T;  3CD6 A;  1QVG A;  3G6E T;  5A2Q E;  1VQ6 A;  1YI2 T;  1K9M U;  1K9M C;  3DB4 A;  2E70 A;  3DB3 A;  1K73 U;  4CRI A;  3I56 A;  1KC8 C;  1VQ5 T;  1M1G A;  2JUF A;  1JJ2 A;  4RG2 A;  1KHI A;  1BKB A;  3CCR A;  3P8B B;  1NJI C;  1Q86 U;  1N8R C;  3PIP A;  3CCJ T;  1NPR A;  2LQ8 A;  5FLX E;  3CC2 A;  3ER0 A;  1KQS S;  1RL2 A;  1IZ6 A;  3OW2 S;  1NJI U;  3I55 A;  5J26 A;  3G6E A;  3OYY A;  2MWO A;  2LCL A;  1Q82 U;  3CCU T;  1VQK T;  3CC7 A;  1YIT T;  1Q7Y U;  1VQ7 A;  1VQM T;  3CCV T;  3J7A F;  3J81 E;  5J3B A;  1YIT A;  3CC7 T;  1XNI A;  1UEB A;  3CCS T;  1N8R U;  1VQO T;  3PIO A;  1VQ5 A;  2JNG A;  3CMA A;  3CCQ A;  1S72 A;  1JJ2 S;  5HY6 A;  3CCE T;  3CCU A;  1VQK A;  1Q81 C;  1K8A U;  3CCM T;  2L3R A;  3CC4 T;  2IG0 A;  3CCQ T;  2XHC A;  1VQ4 A;  1S72 T;  3CCJ A;  1VQL A;  4TVR A;  2LVM A;  1EIF A;  3CCS A;  1YHQ A;  1VQ9 T;  2MWP A;  3CXC A;  3CXC S; 
#chains in the Genus database with same CATH topology
 2JM9 A;  2OX7 A;  2YUO A;  3ZFJ A;  4RCC A;  3ZL7 C;  1PSF A;  1AHJ B;  3OW2 A;  4M75 C;  2LQK A;  2JTF A;  2FZK B;  1Q81 U;  2F2V A;  4KH1 B;  1D0Z A;  5LJ3 e;  4F14 A;  3H0I A;  3LH0 A;  3SWN C;  4BE0 A;  4O5V A;  2VGM A;  1AWJ A;  4KUD K;  1M1K C;  4J7I A;  1PCX A;  5L8R E;  4LE9 A;  1Q86 R;  2LTO A;  4LUD A;  5DY9 A;  4A4G A;  2F5K A;  3QZ9 B;  2KRO A;  2QQ9 A;  2RHZ A;  4KBM B;  3MJX A;  3M58 A;  3CBM A;  2LZ6 B;  1QVF P;  1M2V A;  1YIJ T;  2RPN A;  1FMW A;  2NUP A;  1JXO A;  1WXT A;  3JCM P;  5GMK j;  4M78 D;  2K57 A;  3A1P A;  4M7A C;  2RJE A;  3RIR A;  4F16 A;  4FL6 A;  2KDS A;  3CPW A;  5LJ5 e;  2X3W D;  4FW1 A;  3TCJ A;  7AT1 B;  2ZZD A;  1K9A A;  2K2M A;  3GF5 A;  3DB3 A;  4FYY B;  4JLI A;  1TUG B;  1VQ5 T;  5GAM j;  3HRT A;  1UGP B;  3MCA B;  2Y90 A;  4F7U E;  3VU3 C;  2EYZ A;  1IHV A;  3PVQ A;  5KE2 A;  1NJI U;  2EW3 A;  3RMQ A;  4BD3 A;  2BE7 D;  4Z88 A;  1LVK A;  4IUU A;  2DKG A;  4LD6 A;  3J7A F;  1BB9 A;  4E47 A;  1Q82 R;  1UHC A;  1TWB A;  1JRI A;  5HY6 A;  1EX4 A;  3C0C A;  3SB2 A;  3CCE T;  3V8K A;  3JB9 D;  2DYI A;  2L0A A;  4CC4 B;  2NWM A;  2RQW A;  4C8Q F;  2M51 A;  2DVJ A;  2XG8 D;  4B6M A;  4M77 B;  3OS0 A;  4DOV A;  1K1Z A;  1M8V A;  1LJO A;  5KYX A;  2WAC A;  4MDW A;  4C8Q C;  3SD4 A;  3CCR Q;  1JO8 A;  1FWZ A;  2JT4 A;  1U3O A;  2V1R A;  4B9W A;  3QHS A;  5GAM g;  3CCS Q;  4A53 A;  1BCM A;  1MMG A;  4FCY A;  2DTO A;  3V8J A;  1ZBJ A;  5CKH A;  1S72 Q;  3OYE A;  3EG9 A;  3L42 A;  2ZPF B;  2ABL A;  4NS5 A;  1YJ9 Q;  4LUE A;  3GPL A;  1Q95 G;  3CCL A;  2YWW A;  1JU5 C;  1BI1 A;  2XDB A;  1W2B A;  3M0Q A;  3OMC A;  4PL6 A;  1KD1 C;  4M78 B;  4XTV A;  2DEU A;  2HL3 A;  2OTJ Q;  5D6Y A;  4E7J A;  1RLQ C;  2HQH A;  3VS0 A;  4E7L A;  2BZY A;  3OY9 A;  4OGE A;  3ULR B;  3DKM A;  2K9G A;  2L3S A;  1D1B A;  3PTA A;  3VS3 A;  1TH7 A;  3CCV T;  3J81 E;  3O8V A;  4QVC A;  4RCB A;  4CC2 A;  4OB2 B;  4Y91 A;  5I11 A;  1RAI B;  3VS5 A;  1TSF A;  4AG1 C;  3CCS A;  3SFM A;  2HAX A;  1YHQ A;  3CC4 Q;  1VQP A;  4C0F A;  4ELY C;  1G3S A;  3JCM d;  2CZ6 B;  1D0X A;  3D7S B;  4FIB A;  4AFU C;  1WNL A;  1M27 C;  1QMC A;  4BDZ A;  2DK3 A;  1PHT A;  2OTJ T;  4O6J A;  1UJY A;  1YJ9 A;  4DBH A;  3G71 T;  5I2S A;  2GNC A;  1TG0 A;  3M53 A;  2PNI A;  4M7A A;  2CP7 A;  3M0S A;  2EIF A;  1YHQ Q;  4M77 A;  1BI2 A;  3KFV A;  2RQU A;  1K73 C;  1YBY A;  1AZE A;  2HDA A;  5FU6 C;  5CCA A;  1WLP B;  4GLK A;  1H3H A;  2LNH B;  2JOY A;  3G7Z A;  4OMP A;  3X20 B;  4JRI A;  5A0G A;  1E6G A;  2HSE B;  4EMH A;  1WHJ A;  3CPF A;  2YDL A;  3G6E Q;  2KEA A;  2JVV A;  3VS1 A;  1AWX A;  2KYB A;  1WGS A;  5KYU A;  4BE1 A;  3QDR B;  3DLM A;  4PNO A;  2RHX A;  3BY7 A;  4OF1 A;  1FXX A;  3OSS C;  2XK0 A;  2JUF A;  1AVZ C;  3M57 A;  1QVP A;  4J5Y A;  1G3T A;  1G3W A;  2ENM A;  2GTJ A;  2D9T A;  3A98 A;  3CCR A;  4OMM A;  5A0D A;  1PC0 A;  3JCM Q;  1RL2 A;  3BFM A;  2E5Q A;  1VYU A;  3G6E A;  5I21 A;  1OX8 A;  2L5Q A;  3C95 A;  4Z02 A;  3BW1 A;  1NEB A;  2A37 A;  2XKO C;  2FYK A;  2GF7 A;  2MPX C;  1VQM T;  2QK0 A;  4IIO A;  3LH5 A;  3ZEH A;  1W4S A;  2FVU A;  1M2V B;  2FZC B;  9ATC B;  3HSB A;  2DBM A;  4E7Z A;  1VQ4 A;  1T0J A;  3QUI A;  1WI7 A;  2ZPB B;  2KBT A;  4C8Q B;  3MEW A;  5LJ3 g;  2C0O A;  2FO0 A;  4Z89 A;  3S3M A;  4YTL A;  3CEY A;  4J6W A;  2J6F A;  4AT1 B;  3CME Q;  4DEX A;  3BE3 A;  3I5R A;  1VIE A;  4ME7 A;  3RES A;  3QO3 A;  1GCQ C;  4RTT A;  3JV3 A;  4OB1 B;  1N5Z A;  2P0P A;  4J9I A;  1Y07 A;  2YRC A;  4HVW A;  1WFW A;  2K5L A;  2RJF A;  2BIV A;  2GQI A;  2JS2 A;  4JLG A;  4R55 A;  3X26 B;  1U5S A;  3RDV A;  3G71 Q;  1G2B A;  1RAC B;  3CPW S;  3OMG A;  3JCM f;  2MYS A;  1YJW T;  3ASK A;  3WVD B;  5GAN 6;  2YUQ A;  4KH0 B;  2GCX A;  2NYS A;  2EKO A;  3NMZ C;  3CD6 T;  1HSQ A;  2DF6 A;  2LJ0 A;  2M1H A;  1VQN A;  3THK A;  4FSX A;  1SG5 A;  4QQD A;  1K4U S;  4II1 A;  5EC7 A;  3A8G B;  4CI0 C;  4M78 F;  2FPD A;  2O9S A;  3M5A A;  4N0A C;  3FB9 A;  5GJV B;  2R58 A;  2OAW A;  1GCQ A;  1O9S A;  3HFO A;  1KC8 C;  2D0Q B;  3OBY A;  1M1G A;  2HKQ B;  2LDM A;  1JJ2 A;  3VUB A;  4NL3 A;  2QAS A;  2DX1 A;  4PFP A;  4M7D G;  5FLX E;  1YI2 Q;  2HQX A;  2QTV A;  1PKS A;  4IUP A;  1MHN A;  1ZUK A;  2JJ9 A;  4BI3 A;  3CC7 A;  2A3L A;  4F04 B;  1LNX A;  3E9G A;  2C0T A;  3E1S A;  3VKI A;  1NM7 A;  1N8R U;  4PJO B;  2GFA A;  1MMA A;  3OYH A;  4A4E A;  1ABQ A;  3CCM T;  3CC4 T;  2ZPG B;  1HJD A;  3VRY A;  3CD6 Q;  5FRO A;  1UGV A;  2JMA A;  1VQ9 T;  2RO0 A;  1NG2 A;  5KYN A;  4XTZ A;  2X4X A;  4RTU A;  4C8Q D;  3JRZ A;  4PJO E;  2DZ9 A;  2DTI A;  1H3Z A;  3CCL T;  2QG9 B;  5DM7 R;  2QEX T;  5LJ5 g;  1QVG S;  3NFC A;  1TU0 B;  1JEG A;  4XQ3 A;  2DL5 A;  1KD1 R;  1V76 A;  2LCC A;  4FT2 A;  1VQN T;  1I5O B;  1C6V X;  2EQK A;  2MI6 A;  3NGP A;  3LWI A;  3EFR A;  3RBB B;  4IUR A;  1X2K A;  4ANJ A;  2KVQ G;  3SWN B;  1M90 U;  5FU6 B;  4BI8 B;  1SF9 A;  4KGV B;  2FZG B;  1AWW A;  2J05 A;  2KYM A;  5D6W A;  4E6R A;  4M7A E;  2CSQ A;  3EFS A;  2K3B A;  3VV0 A;  4HCK A;  1N9S A;  5GAO l;  4QT7 A;  2QTX A;  3R6N A;  3C94 A;  2O2O A;  2JM8 A;  2XU8 A;  5KYY B;  3GNF B;  1BI3 A;  3FEO A;  2DZC A;  1ZLM A;  3FIF A;  3VS4 A;  2HNI A;  2V8K A;  2RJC A;  3JCM h;  2J7I A;  5CKF A;  3OYD A;  2CZ1 B;  1NPR A;  2IPO B;  1G8X A;  4HVV A;  2KE9 A;  1OUL A;  2NLU A;  3L2Q A;  1R8O B;  1WA7 A;  2CDT A;  3X28 B;  4BI4 A;  4DQ2 A;  1VUB A;  3OYN A;  3OYI A;  2Y4Y A;  1X75 C;  4J9D A;  3AT1 B;  1UGR B;  5J3B A;  2P0K A;  3E2U A;  4C92 D;  3UF4 A;  1LPL A;  1VYT A;  5GJW B;  3CCU A;  4MDX A;  2AZV A;  1K8A U;  4ESR A;  4PJO D;  4C8Q E;  2X51 A;  1UGQ B;  2GGR A;  2QQS A;  5CKB A;  3CXC A;  2QEX A;  2E1H A;  3RMS A;  2PUK B;  1Y71 A;  2E4H A;  4F7U B;  2FPE A;  1WHL A;  2KT8 A;  2JTM A;  3LWH A;  1M4Z A;  1D0Y A;  4M7A F;  5CQX A;  1QVG P;  2HKN A;  3G4S T;  4J9F A;  2EPD A;  1NE8 A;  3VYH B;  2OTJ A;  2H3E B;  3I56 Q;  2R57 A;  1C0M A;  1X6O A;  3CMA T;  3OBW A;  2EJ9 A;  3HL8 A;  4HXJ A;  4C0D C;  2RHU A;  2BZX A;  5GAN h;  1K9M R;  1Q7Y C;  4L59 A;  1H8K A;  3BDU A;  1KQ1 A;  1D09 B;  1P92 A;  3JB9 J;  3OSV A;  1KQ2 A;  1FYN A;  4HCZ A;  5AT1 B;  2RB6 A;  1K8A R;  3SHW A;  1XTD A;  3DLL A;  1N8R R;  1VQ6 T;  1QVG A;  2DM1 A;  3H41 A;  5EG2 A;  1QCO A;  4EMK B;  3REA B;  3EG0 A;  2BUD A;  2PQW A;  1ABO A;  4J8O A;  4DBR A;  2ROL A;  2COZ A;  3P8B B;  4BY6 B;  4J9B A;  4PLL A;  2CH4 A;  1ZSZ C;  3OYK A;  1TUC A;  3OW2 S;  2K6D A;  4AFZ C;  2YLB A;  4PFZ A;  2DRM A;  3RKW A;  5GAN 2;  4LNP A;  3UAT A;  1OYX A;  1YIT T;  5CKD A;  1Y96 B;  2I0N A;  2RHI A;  1GBQ A;  4ZNX A;  2RQT A;  2RHY A;  2K3Y A;  4OMF B;  3PIO A;  4EMG A;  1S72 A;  1YCY A;  1JJ2 S;  3HHT B;  4PJO A;  2IG0 A;  2LT4 A;  2L3P A;  1UGS B;  2EFI A;  1NLO C;  4C92 E;  2JW4 A;  3BDL A;  3A8M B;  1R0B G;  4CC3 A;  3RNJ A;  3MP1 A;  3JB9 G;  2JS0 A;  2VUB A;  1FMK A;  1KQS A;  2C0I A;  4EMK C;  2YT6 A;  4LDV A;  3I9Q A;  4HA8 A;  3GP8 A;  4HCB A;  1E6H A;  3IQL A;  3EGX B;  1QVF A;  4BB7 A;  2JTE A;  2ATC B;  3M0P A;  2K7A A;  1VQ4 T;  2ESW A;  2LRQ A;  2LJ1 A;  4KGZ B;  4N0A A;  3JB9 I;  1KD1 U;  1VQ7 Q;  2DRK A;  4FW2 A;  4X34 A;  3CCU Q;  5IAY A;  4L5G A;  1PRL C;  1VQM A;  2AZS A;  4JRP A;  2O31 A;  3N5B B;  4QW2 A;  2DL3 A;  1RI0 A;  4XU0 A;  1PD0 A;  2EGE A;  2CGH A;  2KT1 A;  3QXE B;  3AHU A;  1K8A C;  3L2U A;  3CC2 Q;  2EJF A;  3HRS A;  2QDL A;  2Y4X A;  1BBZ A;  3TU4 K;  4WCI A;  1IGQ A;  1NYG A;  3OYL A;  5GAN f;  2P84 A;  3JCM b;  4PFO A;  2MAM A;  1QW1 A;  1BCO A;  3JCM g;  2KK4 A;  4JDS A;  1VQP Q;  1PM3 A;  1BKB A;  1BIB A;  1UFF A;  2DVE A;  4DEY A;  1WQ7 A;  3PIP A;  3RER A;  4GLM A;  1SSH A;  1WX6 A;  2GBQ A;  5CKE A;  2LNV A;  2MWO A;  4D8K A;  1QP2 A;  2SEM A;  3CCU T;  2CP3 A;  4C8Q A;  2F2X A;  1OU9 A;  3L2R A;  2CUB A;  3F70 A;  4XK8 E;  2MIO A;  2XID A;  2MCN A;  1XOV A;  3QJ6 A;  3CCJ A;  4J9G A;  2RJD A;  4QQ6 A;  3UWN A;  3V7R A;  3HRU A;  1WXB A;  1W2B P;  1ZUU A;  1UUE A;  1YI2 A;  1TXQ A;  4OGC A;  4HVU A;  4AFQ C;  3INZ A;  1AOJ A;  3CCE A;  3TSW A;  3M9Q A;  2QA4 A;  1YHQ T;  2DO3 A;  1Y7X A;  2CKK A;  1NZ9 A;  2VAS A;  2QQR A;  3WXM B;  3CC4 A;  1MV3 A;  4D6W A;  1YWO A;  1E7O A;  5IXF A;  1I8F A;  5FRN A;  1K76 A;  4M4Z A;  4B9X A;  1WQW A;  1BU1 A;  1H64 1;  4OB0 B;  2F1L A;  4J9C A;  4AMC A;  1OZ2 A;  2KQW A;  3I55 Q;  2CT4 A;  3G71 A;  1ZSG A;  1VQL T;  2XI9 A;  3PNW C;  4EIK A;  2B8A A;  4RTX A;  2A28 A;  3CCE Q;  2L3Q A;  4OMQ A;  5GAM d;  2W0Z A;  4M7D A;  4RG8 A;  4M77 C;  4M75 B;  2LP5 A;  4JS5 A;  3M0T A;  4J6X A;  2E70 A;  1K73 U;  2L89 A;  3FLG A;  2WSE E;  2V8I A;  3HTR A;  1WDX A;  1PG5 B;  2JXB A;  1ZA1 B;  2RNA A;  2DL8 A;  2QEX Q;  4JZ4 A;  4OML A;  1NJI C;  1Q86 U;  2F69 A;  4N4I A;  3L2W A;  3UA7 A;  2HQE A;  2LQ8 A;  1WIE A;  1AD5 A;  1JQQ A;  2ED1 A;  3OYM A;  1I4K 1;  3M4G A;  4LD9 K;  1D3B A;  3QBY A;  3OYY A;  2MF2 A;  2LCL A;  4C0Z A;  2RK1 A;  5KH6 A;  1SKU B;  5GMK m;  2CH4 W;  1NEG A;  4P5N A;  3CC7 T;  4EMK A;  2OAU A;  3M4Y A;  4XTX A;  3A8L B;  1CKA A;  1WJS A;  1VQO Q;  1VQL A;  2VXE A;  4C92 F;  2J06 A;  3TEE A;  1QCF A;  4OMO A;  2V1Q A;  1VQ9 A;  1SRM A;  2A36 A;  2E65 A;  5L23 A;  1M1K U;  1EFN A;  4J6Y A;  2BZ8 A;  1CSK A;  2RI3 A;  4XTY A;  2MMP A;  2KNB B;  1UG1 A;  3G4S A;  3CBO A;  1HD3 A;  2FPF A;  4JS4 A;  3VS7 A;  2QI2 A;  3QG1 A;  4M7A D;  2RH2 A;  2VVK A;  3VS6 A;  5C6S A;  2EKH A;  2H3J A;  1RAD B;  2RD1 A;  2X9H A;  4BY6 C;  4RUG A;  3TSZ A;  1GFD A;  4M7D B;  1NBE B;  3LGL A;  2O4X A;  4C92 A;  2CP2 A;  2GQV A;  3OYA A;  5GAO m;  3EG1 A;  3TRE A;  3WVE B;  3NHN A;  4IUQ A;  5LJ5 d;  1JXM A;  1I0C A;  3J80 E;  2QA4 T;  4JJC A;  2IVW A;  4N4G A;  1TUD A;  1K9M U;  4ELZ C;  4HKE A;  1M2O A;  1Z9Z A;  4CRI A;  1G83 A;  2O9V A;  4QVD A;  1IHW A;  1HXD A;  3S3N A;  2M0O A;  3I35 A;  1RAH B;  3RUX A;  4OMN A;  4WTO B;  4XU1 A;  1V29 B;  3QJY A;  1VQ5 Q;  1AWO A;  2KXC A;  2EJG A;  3EAE A;  4CC7 A;  1YN8 A;  2EBP A;  1UHF A;  2RMO A;  4OB3 B;  4M77 D;  1XNI A;  4LDU A;  3FRN A;  3GBQ A;  2YSQ A;  2OI3 A;  3C4S A;  3ME9 A;  3CCQ A;  1Z9Q A;  1I5L A;  8ATC B;  2DD4 A;  1TTH B;  1M3B A;  4M75 E;  2A7Y A;  1Q82 C;  4FM4 B;  3L2Z A;  5KYU B;  2O88 A;  1MNE A;  1W1F A;  3P8H A;  1UJ0 A;  3GOX A;  3JSC A;  4DBF A;  2DXB A;  1NPP A;  2LMJ A;  1X69 A;  2R5M A;  4RTW A;  3RKY A;  1GXI E;  1H92 A;  2VKN A;  1Y57 A;  4KUI A;  4RMO A;  1VQN Q;  1WJQ A;  1VOM A;  5DLQ E;  5FRM A;  1QVF S;  4PJO C;  3LW5 E;  2D8H A;  5KYW B;  2PTK A;  4A4F A;  3MET A;  2EWN A;  2DLP A;  1M5Q 1;  1G3Y A;  1Y0M A;  1YNZ A;  4E7K A;  1BYM A;  1VQL Q;  1BIA A;  5I2M A;  3SDZ A;  3A5Z B;  2QQB A;  4BUG A;  1U06 A;  2NUP B;  2BTT A;  4JUV A;  1D1A A;  2AIR B;  3CCM A;  5IH2 A;  3OYJ A;  3EHQ A;  1ZQ1 A;  2E6Z A;  3JCM W;  2VYT A;  3I55 T;  3JCM e;  1AEY A;  3E19 A;  5CR2 A;  4M75 G;  2IIM A;  5GAM h;  2KR3 A;  2WSF E;  2E3I A;  3PT9 A;  1VA7 A;  2JN0 A;  2DJZ A;  1OX9 A;  3E9F A;  1PKT A;  3L2V A;  4M75 F;  4KRT A;  1GCP A;  4BAC A;  5LJ3 d;  4M77 E;  5CVI A;  4MZM A;  2F5T X;  2DET A;  2FHD A;  2K5F A;  3X24 B;  4ZGD B;  4M78 C;  3EGD A;  4QVZ A;  3OB9 A;  3QSU A;  3PVL A;  3CBP A;  3OS5 A;  2KRS A;  8AT1 B;  1Q7Y U;  1YP5 A;  1YIT A;  4XTW A;  4X9C A;  4C92 C;  3CCS T;  2ROT A;  5KE3 A;  2DPP B;  3L1A A;  2X4Y A;  1KC8 R;  3HPW A;  2DBK A;  2ZPE B;  1VQ8 Q;  2G6F X;  4PJN A;  4N4H A;  1S72 T;  1T0H A;  1EIF A;  2RA2 A;  3EG3 A;  2K5I A;  3A8O B;  3CPW P;  1WHH A;  3MKD A;  4M78 A;  2RN8 A;  1IXD A;  1YJ9 T;  2OTL T;  2LX9 A;  1WXU A;  4PJL A;  2XDD A;  2Z0W A;  4RKU E;  2EQI A;  4HCC A;  2RF0 A;  2QAZ A;  4J9H A;  1MND A;  2V26 A;  4PJO G;  3CCV A;  2E3H A;  2CYZ B;  1T3L A;  3OYC A;  2L2P A;  3CCQ Q;  1FMV A;  2E64 A;  4PKC C;  1W2B S;  2DL7 A;  4JJD A;  2COW A;  4J83 A;  5GAM e;  1WHM A;  4XAX B;  1UEC A;  1ZUY A;  3QYH B;  5GAN j;  4FT4 A;  3HKS A;  4FYV B;  5HCK A;  2A0F B;  5DLO A;  3MP8 A;  3EGU A;  2FRW A;  2XDP A;  1EZZ B;  4QKU A;  1M90 R;  1B34 A;  1IO6 A;  1PRM C;  2W10 A;  4LDY A;  1PSE A;  2D0N A;  2QA4 Q;  3CCV Q;  2BKD N;  3M0U A;  4R56 A;  2FRY A;  5HKC A;  3G6E T;  1K9M C;  3DB4 A;  4RTZ A;  1U8R A;  2XD0 A;  2ZGW A;  3REB B;  1V1C A;  2EQU A;  2RI2 A;  4XTU A;  1SHF A;  2GTO A;  4KGX B;  3CCJ T;  3FJP A;  4J9E A;  1M8M A;  1IZ6 A;  5J26 A;  1OEB A;  5I22 A;  4MML A;  4WF2 A;  1X2Q A;  2QQA A;  5KCO A;  4ZTF A;  1X6G A;  2I2L A;  4AFS C;  2KRN A;  2X35 A;  2V8J A;  2DXU A;  1U1S A;  4Y92 A;  4F17 A;  2EAY A;  1OI1 A;  2FL7 A;  1WPY A;  3VUZ A;  2CUD A;  4GBQ A;  3Q1J A;  4OP0 A;  1X01 A;  1VQM Q;  3OS2 A;  4TVR A;  2LVM A;  3OYG A;  1B7T A;  1F1B B;  3NTI A;  1SEM A;  2RM4 A;  5M9O A;  2CP0 A;  2ZPH B;  4PK4 A;  3PGG A;  4MZP A;  4M7D C;  1WZO A;  2OTL A;  3VS2 A;  1OV3 A;  5D6X A;  1GL5 A;  4FU6 A;  3V7C A;  2KXD A;  2KI7 A;  2K79 A;  5LL6 S;  1WHG A;  1OOT A;  1YJN Q;  1I81 A;  4M7A B;  4M78 G;  5IHI A;  1YIJ A;  4ATO A;  3QKJ A;  5IXB A;  1QWF A;  2EQM A;  4IUV A;  4C5E A;  2H8H A;  2E41 A;  3KBG A;  2YHT A;  2LQW A;  5IN1 A;  4M7D D;  5GAO n;  3PMI A;  3CC7 Q;  2DD5 A;  3I5S A;  5GAO p;  4GY5 A;  4J7F A;  3M59 A;  2F2W A;  3CC2 T;  3UPU A;  2DXC A;  1B07 A;  2DJQ A;  3M54 A;  4FYW B;  1YCS B;  5CQY A;  3CME A;  3M0R A;  1YJN T;  3MO8 A;  1VQP T;  4R0K A;  2CP6 A;  1YIJ Q;  2RQV A;  5GAO r;  1MGQ A;  2QDY B;  5ECA A;  1VQ6 A;  3GIB A;  3O5Z A;  1NLP C;  1I1J A;  2HCK A;  3SWN A;  1C1A A;  3V8L A;  5FWB A;  5HK0 A;  1JJ2 P;  3H6Z A;  2AT1 B;  4Q5W A;  3CC2 A;  1AZG B;  1K0S A;  1ZBX A;  1RUW A;  4M75 A;  3HFN A;  2KAF A;  5GMK e;  3CMA Q;  2DIL A;  3MEV A;  4JRQ A;  1Q82 U;  2DAQ A;  1IB8 A;  4FYX B;  1X6B A;  2HEQ A;  2CSI A;  4M77 G;  4M78 E;  3EGX A;  3JCM V;  4ZGJ B;  4IUT A;  4PJJ A;  1SHG A;  4AG2 C;  2XHC A;  5GMK h;  3LYI A;  2J6K A;  4M77 F;  1Y96 A;  2OJ2 A;  2VWF A;  2AKL A;  3G1J A;  4ZN3 A;  4ZTJ A;  1R0C B;  4F7U F;  1O75 A;  3VYG A;  2NUT A;  2LQN A;  2X3X D;  2DL4 A;  5A0L A;  2G3R A;  3FC3 A;  2HSP A;  4DA4 A;  3ZBD A;  4HT8 A;  1HK9 A;  3OYB A;  2HMA A;  1JBM A;  1G5V A;  3UT1 A;  2EYW A;  2P4T A;  2ZPI B;  2KGT A;  1ARK A;  2QYZ A;  2M16 A;  2GFU A;  4D8D A;  5KYW A;  3EHR A;  1QKX A;  2E6N A;  4PLI A;  4EDU A;  4HT9 A;  1KG1 A;  1M90 C;  1YFN A;  1GFC A;  1K0X A;  4PJM A;  4MZT A;  3JCM c;  2DEQ A;  3EH2 A;  4ZN1 A;  1VQ8 T;  2O01 E;  1SPK A;  2VB6 A;  1TS9 A;  2QXF A;  3QYG B;  3S6W A;  1B34 B;  1KFZ A;  5HK3 A;  1PD1 A;  2DYB A;  4KUL A;  5FWC A;  3CME T;  4IKF A;  1PWT A;  2X4J A;  1RI9 A;  3S3O A;  2ED0 A;  5GAN e;  1WJR A;  1LCK A;  5IHK A;  4RG2 A;  3MEU A;  1VQ9 Q;  1UE9 A;  1A0N B;  2E12 A;  3ER0 A;  3H0F A;  2C06 A;  5IHN A;  1XJW B;  2DA9 A;  3I55 A;  2JZ2 A;  1M3A A;  2CZ7 B;  1UDL A;  4UC4 A;  3MHX A;  3CCL Q;  2PVD B;  3OW2 P;  2MOX A;  4C0D B;  1DJ7 B;  3OA6 A;  3CCJ Q;  1W70 A;  4A54 A;  1ZA2 B;  2LC4 A;  1UEB A;  2LX7 A;  4E7S A;  1VQO T;  1VQ5 A;  2BE9 B;  3A8H B;  3V7S A;  1S1N A;  1VQK A;  1J3T A;  1Q81 C;  2L3R A;  3CCQ T;  1KK7 A;  3URG A;  2L8D A;  4F7U A;  5CIU A;  4E7H A;  4KT0 E;  3CXC S;  1M30 A;  4X9D A;  5AYF A;  1M1F A;  2E10 A;  5GAN g;  4C92 B;  4BE2 A;  1QCN A;  1KHC A;  4JJB A;  5J39 A;  1RAF B;  3MEA A;  3SEM A;  2XMF A;  2YRV A;  3X25 B;  2M02 A;  1B3Q A;  5FU7 C;  1VQO A;  1OPL A;  2K2V A;  1BK2 A;  4C5G A;  1NYF A;  5GAN 4;  1Q86 C;  4V2S A;  3VRZ A;  2CRE A;  4IIM A;  1VQ8 A;  1N27 A;  4K11 A;  3FDR A;  1GBR A;  1K73 R;  2ZCF B;  1W6X A;  2D1X A;  1ZSZ A;  4EPC A;  3OYF A;  2HL5 C;  1Q7Y R;  4JPB W;  3OS1 A;  1YWP A;  2LJ3 A;  1RAE B;  3FJ5 A;  1HYO A;  2WSC E;  2EYQ A;  1GRI A;  1M9S A;  3PFS A;  4C0G A;  3H0H A;  2CZ0 B;  3CXC P;  2ECZ A;  2P4R A;  1QLY A;  5LJ5 h;  4FSS A;  5D7U A;  1ACM B;  5LJ3 j;  2YRD A;  3CQT A;  2VC8 A;  3UA6 A;  1YJW Q;  3NPF A;  3I56 A;  2EQJ A;  4RTY A;  2YUN A;  2JMC A;  1SRL A;  2PU9 B;  5LJ5 j;  1D3B B;  2E5K A;  3QPH A;  1KIK A;  1KQS S;  3MP6 A;  4X1V A;  2KSS A;  2LT1 A;  2ZAE A;  4E7I A;  4E2F B;  2DTH A;  5GAN 5;  3JB9 F;  1FX7 A;  1N6A A;  2DIG A;  1VQ7 A;  4DOW A;  4XU2 A;  1OQK A;  2QGG A;  2PVO B;  2QGF B;  4QQG A;  2JNG A;  1WYX A;  3RR6 A;  5KYX B;  3VJP A;  3GLX A;  1RAG B;  1AT1 B;  2NUZ A;  1MV0 B;  3M56 A;  1ZSZ B;  5GAN 3;  4C5H A;  1UB4 A;  1RLP C;  5CO7 A;  1WHK A;  2O4X B;  5CK9 A;  2M9U A;  1QWE A;  4ORZ A;  3QZ5 B;  3P8D A;  2DER A;  3R6O A;  3JCM J;  2R5A A;  3EG2 A;  1MMD A;  3EGD B;  1MMN A;  5IT9 E;  2DE0 X;  2COY A;  1ZX6 A;  4JJN K;  4VUB A;  5GMK i;  2KY9 A;  1VQ6 Q;  5CAI A;  3LX7 A;  1QQJ A;  1KC8 U;  2HZY A;  1VQK Q;  5GAO q;  2K4Y A;  4BDY A;  3JAM E;  4LDW A;  2CT3 A;  2LCS A;  4OVA A;  1VQ4 Q;  2D6F A;  1X43 A;  3HP9 A;  5LJ5 f;  2YUP A;  1M1K R;  1VQ7 T;  5GAM f;  1YJW A;  1ZHI A;  3UDC A;  5KCH A;  4LXC A;  5LJ3 f;  4M7D F;  4C5I A;  4LDX A;  2DIQ A;  2EGC A;  3QDF A;  4Z8A A;  1YIT Q;  2DXT A;  1KJW A;  2CP5 A;  1XQH A;  2RK2 A;  1BI0 A;  2DFU A;  1VYV A;  1YJN A;  2PZ1 A;  3CD6 A;  4XU3 A;  1YI2 T;  1Q81 R;  1JB0 E;  3EG9 B;  3G4S Q;  2SRC A;  1KHI A;  2EGA A;  1X27 A;  2M0Y A;  2RQR A;  3MPU B;  2HBP A;  2RI5 A;  3RKX A;  3EFO A;  2HD0 A;  1VQK T;  4PJO F;  1QP3 A;  1VIF A;  2FB7 A;  1MUZ A;  1IGU A;  2VGN A;  2EYX A;  4NL2 A;  2MK5 A;  2EYY A;  3QWY A;  3LLR A;  5LJ3 h;  2MWP A;  5KYY A;  5FW9 A;  2XIC A;  1OU8 A;  4ZGE B;  2HBW A;  2YLC A;  2K3X A;  3PMT A;  2J6O A;  1OZ3 A;  4A4H A;  3CCR T;  2FEI A;  3KUF A;  4L6V 5;  4F7U G;  1SSF A;  4A4K A;  4M7D E;  1T3S A;  3GNG A;  3T9N A;  2DNU A;  2EVR A;  1I07 A;  2NUT B;  2AHJ B;  3NTH A;  4RTV A;  3TVT A;  2YXY A;  4JZ3 A;  1D1C A;  2P0Q A;  2PVG B;  3LGF A;  4C8Q G;  5C0M A;  2FG0 A;  4Y28 E;  4MMK A;  1M3C A;  3JB9 H;  3NTK A;  1R77 A;  2PUO B;  3U23 A;  1N9R A;  1CKB A;  3C12 A;  3JCM X;  1RAB B;  1UTI A;  5GMK l;  4JRK A;  3I56 T;  1RAA B;  3H8Z A;  3OQ5 A;  1TOV A;  2CS7 A;  2B86 A;  1KQS P;  1OPK A;  2D8J A;  5A2Q E;  1QKW A;  3TQ7 P;  3EFO B;  2AKK A;  5GAN d;  2KRM A;  1N8R C;  4NOY A;  1NJI R;  4C92 G;  2OTL Q;  2KMT A;  1IRE B;  4M75 D;  3KXT A;  2DMO A;  2X4W A;  3PE0 A;  1IRX A;  5GAN 8;  2VXF A;  6AT1 B;  1LOJ A;  3M55 A;  4A63 B;  5FU7 B;  1U1T A;  2AK5 A;  3CCM Q;  3H9N A;  4LN2 A;  4M7A G;  3CMA A;  2VV5 A;  3QII A;  4DBQ A;  1PNJ A;  1KSW A;  2A08 A;  5GAN 7;  3QWX X;  3EH1 A; 
#chains in the Genus database with same CATH homology
 2RO0 A;  3TEE A;  4ZN3 A;  4ZTJ A;  1VQ9 A;  4XTZ A;  3ZFJ A;  1O75 A;  2X4X A;  1PSF A;  4RCC A;  2E65 A;  3VYG A;  4F7U F;  1M1K U;  4C8Q D;  1AHJ B;  3JRZ A;  3OW2 A;  4PJO E;  2DZ9 A;  4M75 C;  5A0L A;  4J6Y A;  2LQK A;  2DTI A;  2G3R A;  2JTF A;  2RI3 A;  1H3Z A;  3CCL T;  1Q81 U;  3FC3 A;  4XTY A;  5DM7 R;  3ZBD A;  2QEX T;  4DA4 A;  4HT8 A;  5LJ5 g;  1HK9 A;  2MMP A;  5LJ3 e;  3OYB A;  3NFC A;  1QVG S;  4XQ3 A;  1JBM A;  3G4S A;  3CBO A;  3LH0 A;  3SWN C;  1G5V A;  2LCC A;  3UT1 A;  4BE0 A;  4O5V A;  2P4T A;  2VGM A;  2ZPI B;  4KUD K;  4JS4 A;  2M16 A;  4FT2 A;  1VQN T;  2GFU A;  2QI2 A;  2EQK A;  3QG1 A;  2MI6 A;  3LWI A;  1M1K C;  2E6N A;  3EFR A;  4J7I A;  4M7A D;  2RH2 A;  5L8R E;  4IUR A;  4PLI A;  4EDU A;  4HT9 A;  1KG1 A;  2LTO A;  2KVQ G;  3SWN B;  1M90 U;  5DY9 A;  4A4G A;  1M90 C;  5FU6 B;  2F5K A;  4BI8 B;  3QZ9 B;  5C6S A;  2QQ9 A;  2RHZ A;  4KBM B;  2H3J A;  2RD1 A;  4MZT A;  3JCM c;  3M58 A;  5D6W A;  3CBM A;  2DEQ A;  4BY6 C;  4ZN1 A;  1VQ8 T;  4M7A E;  4M7D B;  2O01 E;  3LGL A;  2O4X A;  4C92 A;  1YIJ T;  3EFS A;  3VV0 A;  3JCM P;  2GQV A;  5GMK j;  4M78 D;  1N9S A;  3OYA A;  5GAO l;  2QTX A;  5GAO m;  2QXF A;  2K57 A;  3QYG B;  3S6W A;  3C94 A;  1B34 B;  3TRE A;  3WVE B;  5HK3 A;  4M7A C;  2RJE A;  2XU8 A;  3GNF B;  3RIR A;  4IUQ A;  5LJ5 d;  1BI3 A;  3FEO A;  4FL6 A;  4KUL A;  2DZC A;  3CME T;  2KDS A;  3CPW A;  4IKF A;  3J80 E;  5LJ5 e;  2X4J A;  2QA4 T;  3TCJ A;  2ZZD A;  3S3O A;  2IVW A;  4N4G A;  3FIF A;  1K9M U;  3GF5 A;  3DB3 A;  4ELZ C;  5GAN e;  2HNI A;  1WJR A;  4JLI A;  2V8K A;  4HKE A;  2RJC A;  4CRI A;  1VQ5 T;  5GAM j;  3JCM h;  4RG2 A;  3MEU A;  3HRT A;  1UGP B;  4QVD A;  5CKF A;  2E12 A;  2Y90 A;  3MCA B;  4F7U E;  1HXD A;  3OYD A;  3S3N A;  2CZ1 B;  1NPR A;  3VU3 C;  2M0O A;  3ER0 A;  3RUX A;  2C06 A;  5KE2 A;  4XU1 A;  1NJI U;  3I55 A;  2JZ2 A;  1V29 B;  2NLU A;  3L2Q A;  1R8O B;  3QJY A;  2CZ7 B;  3RMQ A;  2EJG A;  4BD3 A;  3EAE A;  3X28 B;  4UC4 A;  4BI4 A;  3MHX A;  4DQ2 A;  1VUB A;  2PVD B;  3OYN A;  4IUU A;  3OYI A;  2Y4Y A;  4C0D B;  1X75 C;  1DJ7 B;  2DKG A;  1UGR B;  4LD6 A;  3OA6 A;  3J7A F;  5J3B A;  4A54 A;  4E47 A;  4OB3 B;  2P0K A;  4M77 D;  1XNI A;  2LC4 A;  1UEB A;  3FRN A;  4LDU A;  4C92 D;  1VQO T;  3C4S A;  1JRI A;  1VQ5 A;  3ME9 A;  3A8H B;  3V7S A;  3CCQ A;  5HY6 A;  3SB2 A;  3CCE T;  3V8K A;  3CCU A;  3JB9 D;  1VQK A;  1I5L A;  4MDX A;  1Q81 C;  1K8A U;  2L3R A;  2DD4 A;  3CCQ T;  4PJO D;  3URG A;  4C8Q F;  4C8Q E;  2L8D A;  4F7U A;  5CIU A;  1UGQ B;  4E7H A;  4M75 E;  2A7Y A;  2XG8 D;  1Q82 C;  2QQS A;  4KT0 E;  5CKB A;  3CXC A;  3CXC S;  2QEX A;  4X9D A;  2E1H A;  1M1F A;  2E10 A;  3L2Z A;  4FM4 B;  4M77 B;  5AYF A;  3RMS A;  4C92 B;  3OS0 A;  4BE2 A;  3P8H A;  4DOV A;  1M8V A;  1LJO A;  1KHC A;  2WAC A;  3GOX A;  2PUK B;  4MDW A;  4C8Q C;  1Y71 A;  4F7U B;  3JSC A;  2DXB A;  3SD4 A;  5J39 A;  1NPP A;  3RKY A;  2R5M A;  3MEA A;  2JTM A;  1GXI E;  3LWH A;  1M4Z A;  2YRV A;  1FWZ A;  3X25 B;  4M7A F;  5CQX A;  5FU7 C;  1VQO A;  3G4S T;  4KUI A;  4RMO A;  2K2V A;  1WJQ A;  4B9W A;  1NE8 A;  3VYH B;  3QHS A;  5DLQ E;  5GAM g;  5FRM A;  1QVF S;  2R57 A;  4PJO C;  3LW5 E;  4A53 A;  4C5G A;  4A4F A;  3MET A;  5GAN 4;  2EWN A;  2DTO A;  1Q86 C;  3V8J A;  4V2S A;  1M5Q 1;  1VQ8 A;  1N27 A;  1X6O A;  5CKH A;  3CMA T;  3OYE A;  1G3Y A;  4E7K A;  3FDR A;  1BYM A;  3OBW A;  2EJ9 A;  2ZCF B;  3HL8 A;  1BIA A;  4C0D C;  5I2M A;  3L42 A;  2RHU A;  2ZPF B;  3SDZ A;  5GAN h;  1Q7Y C;  3A5Z B;  4L59 A;  4NS5 A;  4EPC A;  2QQB A;  3OYF A;  4BUG A;  3GPL A;  3BDU A;  4JUV A;  3CCL A;  3CCM A;  3OS1 A;  1KQ1 A;  2XDB A;  1BI1 A;  1P92 A;  3OYJ A;  3JB9 J;  1W2B A;  1ZQ1 A;  2E6Z A;  2WSC E;  3JCM W;  2EYQ A;  2VYT A;  3OSV A;  3I55 T;  1M9S A;  3JCM e;  3E19 A;  5CR2 A;  1KQ2 A;  3OMC A;  4M75 G;  4HCZ A;  4PL6 A;  2RB6 A;  3PFS A;  4C0G A;  1KD1 C;  4M78 B;  1XTD A;  2CZ0 B;  2WSF E;  5GAM h;  3DLL A;  3PT9 A;  1VQ6 T;  5LJ5 h;  2JN0 A;  2DJZ A;  1QVG A;  5EG2 A;  4XTV A;  4EMK B;  5LJ3 j;  3E9F A;  2VC8 A;  3L2V A;  4M75 F;  2BUD A;  2PQW A;  3I56 A;  2EQJ A;  4J8O A;  5D6Y A;  4E7J A;  2PU9 B;  3P8B B;  4M77 E;  5LJ3 d;  5LJ5 j;  4BAC A;  1D3B B;  5CVI A;  4BY6 B;  4MZM A;  4PLL A;  3QPH A;  2F5T X;  3OYK A;  1KQS S;  3MP6 A;  3OW2 S;  4E7L A;  2FHD A;  2K5F A;  2KSS A;  2LT1 A;  3OY9 A;  4OGE A;  3X24 B;  4ZGD B;  3DKM A;  4M78 C;  4E7I A;  2YLB A;  1KC8 C;  4QVZ A;  3OB9 A;  3RKW A;  3QSU A;  5GAN 2;  1OYX A;  2DTH A;  3CBP A;  3OS5 A;  1FX7 A;  5GAN 5;  3PTA A;  1YIT T;  3JB9 F;  1Q7Y U;  1N6A A;  1TH7 A;  2DIG A;  5CKD A;  1VQ7 A;  1Y96 B;  3CCV T;  3J81 E;  2RHI A;  3O8V A;  4DOW A;  4QVC A;  1YIT A;  4XU2 A;  2RHY A;  4XTW A;  4X9C A;  4RCB A;  4C92 C;  3CCS T;  5KE3 A;  2DPP B;  2PVO B;  2K3Y A;  2X4Y A;  3L1A A;  4OMF B;  4QQG A;  3HPW A;  2JNG A;  3PIO A;  4EMG A;  1S72 A;  1YCY A;  4OB2 B;  4Y91 A;  3GLX A;  2ZPE B;  3HHT B;  3VJP A;  1JJ2 S;  4PJO A;  4N4H A;  2IG0 A;  1S72 T;  2LT4 A;  3M56 A;  5GAN 3;  4C5H A;  1UGS B;  2EFI A;  1UB4 A;  1EIF A;  2RA2 A;  4C92 E;  3SFM A;  3CCS A;  2HAX A;  1YHQ A;  3BDL A;  2K5I A;  3A8O B;  5CO7 A;  1VQP A;  2O4X B;  3A8M B;  4M78 A;  5CK9 A;  4C0F A;  2M9U A;  4ELY C;  1G3S A;  1YJ9 T;  2OTL T;  2LX9 A;  3MP1 A;  3JCM d;  3QZ5 B;  3JB9 G;  2CZ6 B;  3P8D A;  2VUB A;  2XDD A;  4FIB A;  1KQS A;  3R6O A;  3JCM J;  2R5A A;  4EMK C;  1WNL A;  4RKU E;  4LDV A;  4HCC A;  4BDZ A;  4HA8 A;  2DK3 A;  3GP8 A;  4HCB A;  2OTJ T;  4O6J A;  1YJ9 A;  1QVF A;  3G71 T;  5IT9 E;  4BB7 A;  3CCV A;  4PJO G;  5I2S A;  4JJN K;  2CYZ B;  1VQ4 T;  4VUB A;  5GMK i;  2KY9 A;  3M53 A;  2LRQ A;  3OYC A;  4M7A A;  4N0A A;  2EIF A;  5CAI A;  3JB9 I;  1KD1 U;  3LX7 A;  1KC8 U;  4X34 A;  2E64 A;  4PKC C;  1W2B S;  4M77 A;  1BI2 A;  4L5G A;  2K4Y A;  5IAY A;  5GAO q;  4BDY A;  3JAM E;  4LDW A;  1VQM A;  4JRP A;  4J83 A;  5GAM e;  4OVA A;  1K73 C;  4XAX B;  2D6F A;  1YBY A;  3QYH B;  3HP9 A;  3N5B B;  5FU6 C;  4FT4 A;  5CCA A;  4GLK A;  3HKS A;  5LJ5 f;  2JOY A;  4QW2 A;  3G7Z A;  1VQ7 T;  5GAM f;  3X20 B;  1RI0 A;  4JRI A;  1ZHI A;  3MP8 A;  2CGH A;  4XU0 A;  3UDC A;  5A0G A;  5KCH A;  5DLO A;  2XDP A;  4EMH A;  1B34 A;  3CPF A;  5LJ3 f;  4M7D F;  4LDY A;  4C5I A;  4LDX A;  2DIQ A;  3QXE B;  1PSE A;  3AHU A;  2JVV A;  1K8A C;  2DXT A;  3L2U A;  1XQH A;  2RK2 A;  1BI0 A;  2BKD N;  2EJF A;  4R56 A;  1WGS A;  1YJN A;  3HRS A;  4BE1 A;  2Y4X A;  3QDR B;  3TU4 K;  3OYL A;  3DLM A;  5HKC A;  3CD6 A;  5GAN f;  4XU3 A;  3G6E T;  4PNO A;  1YI2 T;  2RHX A;  3JCM b;  3BY7 A;  1K9M C;  3DB4 A;  4OF1 A;  2MAM A;  1QW1 A;  1FXX A;  2XD0 A;  3OSS C;  1JB0 E;  3JCM g;  2ZGW A;  1U8R A;  2KK4 A;  2XK0 A;  4JDS A;  2EQU A;  2JUF A;  2RI2 A;  4XTU A;  1KHI A;  1BKB A;  1BIB A;  1QVP A;  1G3T A;  1G3W A;  2DVE A;  3M57 A;  4J5Y A;  3CCR A;  2D9T A;  1WQ7 A;  5A0D A;  3PIP A;  3CCJ T;  3FJP A;  3RER A;  3JCM Q;  1RL2 A;  1IZ6 A;  3BFM A;  5CKE A;  2E5Q A;  2HBP A;  2RI5 A;  5J26 A;  3RKX A;  4MML A;  3G6E A;  5I21 A;  2LNV A;  2L5Q A;  2MWO A;  1QP2 A;  2HD0 A;  3C95 A;  4WF2 A;  3BW1 A;  4Z02 A;  2QQA A;  2XKO C;  5KCO A;  3CCU T;  4ZTF A;  3CCR T;  4C8Q A;  1VQK T;  2FYK A;  2GF7 A;  1VQM T;  2I2L A;  4PJO F;  1QP3 A;  3L2R A;  2X35 A;  2V8J A;  1VIF A;  2DXU A;  1U1S A;  3F70 A;  4XK8 E;  2FB7 A;  2EAY A;  1OI1 A;  2FL7 A;  2XID A;  3ZEH A;  1W4S A;  1WPY A;  2FVU A;  3VUZ A;  2VGN A;  3Q1J A;  3HSB A;  4OP0 A;  1XOV A;  1X01 A;  4NL2 A;  3QJ6 A;  1VQ4 A;  3QUI A;  3CCJ A;  3OS2 A;  4TVR A;  2LVM A;  2ZPB B;  3OYG A;  3LLR A;  5LJ3 h;  3NTI A;  2MWP A;  2RJD A;  4QQ6 A;  4C8Q B;  3MEW A;  2RM4 A;  3UWN A;  3V7R A;  5LJ3 g;  3HRU A;  3S3M A;  4YTL A;  3CEY A;  4J6W A;  2XIC A;  2OTJ A;  5M9O A;  2ZPH B;  1VIE A;  4ME7 A;  1YI2 A;  3RES A;  3QO3 A;  3PGG A;  4MZP A;  4OGC A;  4M7D C;  2OTL A;  3INZ A;  4ZGE B;  5D6X A;  3CCE A;  2YLC A;  2K3X A;  4OB1 B;  2P0P A;  3PMT A;  4FU6 A;  3M9Q A;  3V7C A;  1OZ3 A;  1Y07 A;  2QA4 A;  4A4H A;  5LL6 S;  1YHQ T;  2K5L A;  3KUF A;  2RJF A;  2DO3 A;  4L6V 5;  1SSF A;  4A4K A;  4F7U G;  2BIV A;  1I81 A;  1Y7X A;  2CKK A;  1NZ9 A;  4M7A B;  2QQR A;  4JLG A;  3WXM B;  3X26 B;  4R55 A;  4M7D E;  3GNG A;  4M78 G;  3CC4 A;  4D6W A;  3T9N A;  1YIJ A;  1I8F A;  4ATO A;  3QKJ A;  5FRN A;  2AHJ B;  3NTH A;  3CPW S;  3OMG A;  3JCM f;  2EQM A;  4IUV A;  4B9X A;  4C5E A;  1WQW A;  2E41 A;  1YJW T;  3ASK A;  3WVD B;  5GAN 6;  1H64 1;  2P0Q A;  2PVG B;  2YHT A;  3KBG A;  3LGF A;  4OB0 B;  5IN1 A;  4C8Q G;  5GAO n;  4M7D D;  1OZ2 A;  2KQW A;  5C0M A;  3G71 A;  4Y28 E;  3PMI A;  4MMK A;  2DD5 A;  2GCX A;  1VQL T;  2XI9 A;  3PNW C;  5GAO p;  3JB9 H;  3NTK A;  2B8A A;  4GY5 A;  4J7F A;  2PUO B;  2EKO A;  3M59 A;  3CC2 T;  3UPU A;  2DXC A;  1N9R A;  3C12 A;  3CD6 T;  3JCM X;  2M1H A;  1VQN A;  3M54 A;  5CQY A;  3CME A;  5GAM d;  4FSX A;  5GMK l;  1YJN T;  3MO8 A;  1VQP T;  4JRK A;  3I56 T;  3H8Z A;  4QQD A;  3OQ5 A;  4RG8 A;  4M7D A;  2CS7 A;  4II1 A;  5GAO r;  3A8G B;  1MGQ A;  4M77 C;  4CI0 C;  2QDY B;  4M75 B;  4M78 F;  4JS5 A;  5A2Q E;  1VQ6 A;  3GIB A;  4J6X A;  3M5A A;  2E70 A;  4N0A C;  1K73 U;  2L89 A;  3FB9 A;  3FLG A;  2R58 A;  1O9S A;  2WSE E;  2V8I A;  2D0Q B;  1M1G A;  3HFO A;  3OBY A;  2LDM A;  3SWN A;  5GAN j;  1JJ2 A;  3VUB A;  4NL3 A;  1NJI C;  5GAN d;  1Q86 U;  2F69 A;  4N4I A;  3L2W A;  1N8R C;  3V8L A;  5HK0 A;  2HQE A;  3H6Z A;  4M7D G;  2LQ8 A;  4NOY A;  5FLX E;  4Q5W A;  3CC2 A;  2HQX A;  4C92 G;  2KMT A;  1ZBX A;  1IRE B;  4M75 D;  3OYM A;  3KXT A;  4M75 A;  1I4K 1;  3M4G A;  4IUP A;  4LD9 K;  1D3B A;  3HFN A;  1MHN A;  3OYY A;  2KAF A;  2X4W A;  3QBY A;  5GMK e;  2MF2 A;  3MEV A;  2LCL A;  4JRQ A;  1Q82 U;  5GAN 8;  2VXF A;  2RK1 A;  2DAQ A;  4BI3 A;  4C0Z A;  1LOJ A;  2A3L A;  5KH6 A;  3CC7 A;  3M55 A;  5GMK m;  1LNX A;  5FU7 B;  4M77 G;  3E9G A;  4P5N A;  3E1S A;  3CC7 T;  4EMK A;  2OAU A;  3VKI A;  1U1T A;  1N8R U;  3M4Y A;  4M78 E;  4PJO B;  2GFA A;  3OYH A;  4M7A G;  3CMA A;  3JCM V;  4ZGJ B;  4XTX A;  3A8L B;  2VV5 A;  4IUT A;  1WJS A;  4A4E A;  3QII A;  5GAN g;  3CCM T;  3CC4 T;  2ZPG B;  2XHC A;  5GMK h;  1VQL A;  3LYI A;  2VXE A;  4M77 F;  4C92 F;  5FRO A;  5GAN 7;  1Y96 A;  1VQ9 T;  1YJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...