2JOYA

Nmr structure of 50s ribosomal protein l14e from sulfolobus solfataricus: northeast structural genomics consortium target ssr105
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
96
structure length
96
Chain Sequence
b'MPAIEVGRICVKVKGREAGSKCVIVDIIDDNFVLVTGPKDITGVKRRRVNILHLEPTDKKIDIQKGASDEEVKKKLEESNLTEYMKEKIKIRMPTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L14e
publication title NMR Structure of 50S Ribosomal Protein L14e; Northeast Structural Genomics Consortium Target SSR105
rcsb
source organism Sulfolobus solfataricus
molecule tags Structural genomics, unknown function
total genus 18
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2joyA01
1QVGA 3CXCA 1M1KU 3CCLA 3G4SA 1XNIA 3CCRT 1Q81C 1W2BA 3CC4A 3G71A 3CCQA 3J80E 1KQSA 2JNGA 1YJWA 1NPRA 1NZ9A 3ER0A 3CCLT 1VQ6A 1YIJA 3G4ST 5FLXE 3CD6T 3LGLA 1VQ5A 2OTJA 3CCSA 1VQPA 1YJNT 3CC4T 3G71T 3CCQT 2MWOA 2JVVA 1YJWT 3CPWS 1K8AU 1YBYA 1EIFA 3HKSA 2LVMA 3OW2S 2G3RA 1KC8U 1QVFS 1YIJT 1QVGS 3CXCS 2JOYA 1VQ5T 3CCST 4ZN1A 2OTJT 5LL6S 1W2BS 1YI2A 2IG0A 2QA4A 1KQSS 1K73U 3CC7A 1Q86U 5DLQE 5DM7R 3CC2A 1K9MU 1BKBA 3OYYA 5A2QE 3J7AF 1YI2T 3CCEA 5HY6A 1Q81U 1VQ8A 2QA4T 3CC7T 3LGFA 3I56A 1X6OA 3CC2T 1VQOA 1M90C 2LQ8A 3LH0A 3JAME 1N8RC 4X34A 4ZN3A 1KD1C 3CCET 3DB3A 3CPFA 1JJ2S 3I56T 1S72A 1KD1U 4QQDA 1VQ6T 1VQ7A 3I55A 2OTLA 1VQPT 3J81E 3CMEA 1Q82C 2JUFA 1VQ4A 1M1GA 1S72T 4CRIA 1YJ9A 1Q82U 1VQ7T 3I55T 3CCJA 2OTLT 1YHQA 1Q7YC 1IZ6A 2L3RA 3CMET 1NJIC 2KVQG 1VQMA 1UEBA 3G6EA 1Q7YU 1VQ4T 4YTLA 3CCUA 1VQ9A 1KHIA 1NJIU 1YJ9T 3KBGA 1SSFA 3CCVA 3CCJT 2E6ZA 1YHQT 3CCMA 1YITA 3CCRA 1M90U 2KDSA 3A5ZB 1VQ8T 3PIOA 3G6ET 1N8RU 2QEXA 1M1KC 3CCUT 1NPPA 1VQ9T 1RL2A 2MI6A 1VQOT 5IAYA 3CCVT 3CCMT 4TVRA 3DB4A 1YITT 3CD6A 1YJNA 2LCLA 2MWPA 2QEXT 5J26A 5IT9E 2DO3A 3P8BB 1VQNA 1VQLA 3CMAA 1K8AC 2XHCA 1KC8C 4RG2A 1VQKA 3TREA 1VQNT 1VQLT 3DLLA 2E70A 5J3BA 3CMAT 2CKKA 2EIFA 1K73C 1VQMT 1Q86C 3PIPA 1XTDA 1VQKT 3CPWA 1JJ2A 3OW2A 1K9MC 1QVFA
chains in the Genus database with same CATH superfamily
4M75F 3M58A 2R5AA 1W70A 4J6YA 3CCRT 2HMAA 2COYA 2FL7A 2CDTA 3MP8A 2E10A 1I8FA 1XOVA 2BTTA 1BI3A 3CC4T 2JM9A 1M8MA 2CZ0B 3OW2S 1TUCA 2CP6A 4JRPA 2YRVA 3M4GA 4M77A 4ZN1A 2LJ1A 2QA4A 5CVIA 2KK4A 1ZX6A 3CCUQ 3CBMA 1QVFP 1NE8A 5FU6B 1ABOA 1R8OB 4Y92A 4M77B 2JT4A 2M9UA 1Q81U 2H3JA 2DL3A 4C8QD 3PVLA 4PKCC 4A54A 1WJSA 2VASA 4B9XA 1KD1C 3O5ZA 1X69A 2ZZDA 1X6GA 4RUGA 2VGMA 4OGCA 2D9TA 1SF9A 1VQ4A 3L2VA 1MNDA 1QVGP 1KQ1A 1H641 2AK5A 4BDYA 1WA7A 2OTLT 2K79A 2DJQA 4M78A 3G6EA 3CQTA 1EX4A 1EZZB 4C0ZA 3DLMA 1U5SA 3KBGA 1AT1B 1YN8A 2KT1A 3H0IA 3CCVA 4M78B 2LT1A 3Q1JA 2QEXA 2ZPHB 3EHRA 1NPPA 5CKFA 2DL4A 1WJRA 1SKUB 1VQPQ 2LRQA 2DERA 2B86A 3H41A 2DTIA 3JCMd 1PD0A 3TREA 4IKFA 3DLLA 3OYEA 4V2SA 2EQKA 5GANe 3CMAT 2F2WA 4BY6C 2EAYA 1FMKA 4XTXA 4LDXA 3A8HB 4J9DA 2DTOA 2OAWA 3RDVA 2KRNA 4ZGJB 3EGXA 2YWWA 1N6AA 3CCLT 5GAN2 2K2VA 3C4SA 4ZGDB 1YIJA 3G4ST 1WHHA 3GP8A 2XKOC 2YRCA 3EGXB 1M30A 3OYAA 4JRIA 2AKKA 1EIFA 5LJ3h 1QVFS 4BE2A 4E7ZA 4M7DD 1UGVA 3CXCP 1WI7A 2RQUA 5CO7A 4DOWA 1YI2T 1SPKA 2QTVA 4QKUA 4C8QC 2FB7A 5KCHA 3PE0A 2KGTA 4XU3A 1GBRA 2DRMA 4RMOA 4MDWA 4RCCA 1FWZA 1V29B 1VQLQ 1OX9A 1VQPT 3URGA 4HVWA 3T9NA 1CSKA 3MO8A 2CH4A 1KIKA 4R56A 1BB9A 2OJ2A 1VQKQ 4C92A 1M1GA 4CRIA 3JCMb 5LJ3g 4C0FA 4J9EA 3M0TA 1UEBA 4C92B 3FIFA 1Q7YU 3QZ9B 1UUEA 1M2VA 1UGPB 1PKSA 1YITA 5GJVB 2CUDA 4PJOC 1LCKA 1M2VB 4KH1B 4OMFB 5GAOl 1ZLMA 4EDUA 1M8VA 2MWPA 4PFZA 3RNJA 1T3LA 2KROA 4L6V5 4ZTFA 3VS7A 1RADB 1K73C 3LWIA 1LJOA 4XTUA 1JJ2A 2RM4A 5GAN7 3VS4A 1QKWA 2COWA 1SEMA 5KYUA 3GNGA 2RI3A 1YJWA 3LW5E 2CZ6B 2AZSA 1YP5A 1G3WA 4WTOB 3QWXX 1ABQA 2E12A 5KYUB 1M90R 1Y57A 1BIAA 4J7IA 3M0SA 2K2MA 1I07A 3QPHA 1LOJA 2DTHA 3CPWS 4II1A 2LVMA 2G3RA 3KUFA 2XDBA 3CXCS 2HQEA 2HDAA 5LJ5h 5GANd 4M7DC 4DBHA 1OV3A 4DQ2A 4JJDA 4OF1A 4WCIA 2RJFA 5HY6A 2GFAA 5GAMe 2QA4T 2RI5A 3O8VA 1I5OB 2GFUA 3CBPA 1CKAA 2NLUA 2VYTA 1GCPA 1YJNQ 5C6SA 4LN2A 4XTZA 5FU6C 2JMCA 2F1LA 2CP7A 4M77C 2FEIA 1VQNQ 2RA2A 1SRLA 5C0MA 1Q82C 4OMMA 1OPKA 2EJFA 1GRIA 3D7SB 3SWNA 1NJIC 3NGPA 1WDXA 4DBFA 1VQ4T 3VS5A 1VQ9A 4FYWB 1X2QA 3SWNB 1G3TA 4BD3A 5I22A 2XICA 3G6ET 1SSHA 1K9MR 3CCVT 4RTTA 1ZUKA 2HBPA 5FRNA 1H3ZA 2QEXT 5I2SA 1KG1A 5CKBA 2NUZA 1WHLA 4M78C 3JCMP 4XTWA 4PFPA 3QWYA 1TUGB 2PZ1A 5DLOA 3VV0A 4JLGA 1K73R 3EFSA 4HVUA 3PIPA 2YRDA 1G2BA 4CI0C 2RF0A 3BY7A 1RI9A 4LD6A 2CREA 4ESRA 2FZCB 1Y71A 2K57A 1KQSA 5I2MA 5D6WA 1ZBXA 1D1AA 1P92A 1VQ5A 5HK3A 1SRMA 4Y28E 1AD5A 1YJNT 2C0IA 4AG2C 3SHWA 3CMEQ 4XK8E 1K8AU 1UDLA 1YBYA 1JO8A 1YIJT 2JOYA 4DOVA 5LL6S 3VYHB 2KRMA 3EG1A 5A0LA 2LQWA 3AHUA 4IUQA 1WHGA 1TS9A 4N0AA 2VB6A 1ACMB 1VQ8A 2PVDB 1X6OA 4AFQC 2RN8A 1X75C 4PJJA 1W6XA 2DYIA 1G8XA 4J6XA 2X4YA 1KD1U 1X27A 4Z02A 2CSQA 2EKOA 3ME9A 4EMHA 2Y4YA 1HK9A 1HYOA 2WSCE 1ZHIA 2LNVA 1WGSA 4GLMA 2CP0A 3C94A 3CCJA 3GF5A 3OYFA 1QLYA 4VUBA 2ED0A 1B3QA 3RKYA 1UFFA 4XU0A 3ZEHA 3VKIA 3QDFA 4HCBA 1Q95G 2ATCB 2DX1A 4FIBA 4XU2A 1JXMA 2DRKA 1YITT 3CCSQ 1Q81R 4C92C 3OY9A 1H3HA 2L2PA 1YFNA 1I1JA 3VRYA 4C8QG 1VYUA 4CC3A 1M1FA 4OMNA 1TTHB 2XDDA 1AHJB 3I35A 4M7AA 2JTMA 3S6WA 1QW1A 3OMCA 1WIEA 2QI2A 3CC2Q 2EYWA 4IIMA 2EIFA 4M7AB 3OYCA 2FYKA 5D6XA 3ULRB 2LNHB 3HRTA 4KGZB 2E41A 2DE0X 1MNEA 3UA6A 1U1SA 3G71A 2HL3A 5GAOp 4XTYA 4OB3B 5ECAA 3ER0A 5AYFA 2PVOB 4EMKA 2OTJA 3VUBA 3OSSC 1Y7XA 3X24B 3HFOA 1YJWT 2F69A 2J7IA 4EMKB 2EBPA 2KEAA 1NEGA 2HBWA 1AZGB 3RMSA 3RBBB 3S3MA 1OU8A 2VV5A 2PUOB 3CC7A 9ATCB 1Q86U 3QYGB 5GAN6 2HZYA 1AZEA 2PU9B 4A4HA 2BZXA 1HD3A 2RQWA 2CP3A 2MCNA 1K9AA 2DBKA 2HQXA 3LGFA 3RUXA 3I56A 2GTJA 3M4YA 3PMTA 1M4ZA 3OYLA 1BI1A 4E6RA 3M57A 3X26B 5CKDA 2P0KA 2ZPBB 4JRKA 4MZMA 4HVVA 1JQQA 1VQ7A 3I55A 3BW1A 2DMOA 4OMOA 5GMKi 3NHNA 3OW2P 3DKMA 5HCKA 2QGGA 3CCRQ 3SD4A 2DD5A 2ZCFB 5LJ3d 2CP2A 1OI1A 1H92A 4QW2A 2KY9A 4PJLA 3JB9D 3JRZA 3CC4Q 2D6FA 4AFZC 3ZL7C 2E3IA 1VQ9T 4M7DG 5LJ5f 4OB0B 2MK5A 2DZCA 2M1HA 2DL8A 2X4XA 5GAN4 1QKXA 2VKNA 3LWHA 2FG0A 4RTWA 2WACA 3JCMV 3SWNC 1KHCA 1KC8C 1TUDA 2Y90A 3JCMJ 2CT4A 4MDXA 1HJDA 3P8HA 4F7UF 3M54A 3HTRA 2M51A 2GNCA 4PFOA 2RQRA 3EH1A 4Y91A 2O9SA 2QYZA 2AT1B 1Z9QA 2L3PA 2KXDA 5IN1A 4HT9A 3EGUA 2K3XA 2OTLQ 2FZKB 3V8LA 4LXCA 2O88A 1AWWA 2RHYA 2JZ2A 2LQNA 5KE3A 1UGSB 3PMIA 1VQ5T 2DD4A 4J5YA 1W1FA 1BK2A 2QQAA 1PM3A 2FRYA 5CK9A 2SRCA 2NYSA 4M78G 2RHIA 3GIBA 5A0DA 4F16A 2CZ7B 3EH2A 2IPOB 2YUPA 4DEYA 4OMQA 3QO3A 1PCXA 4LUEA 2VUBA 1K4US 4RTYA 2HKNA 2JXBA 2GBQA 5GAMh 4Z8AA 1OULA 4QVZA 3BDUA 3CMAQ 3JCMX 4LNPA 2ROTA 1Q82U 4N0AC 2C0TA 4RG8A 4KGVB 5AT1B 5GMKj 2DETA 1WPYA 3MEVA 4A4KA 5LJ5d 1NJIU 1F1BB 2KT8A 3CCLQ 3CCJT 3G4SQ 4JZ4A 1IHVA 2VVKA 2RJEA 1N8RU 3FEOA 2L5QA 3CEYA 3MKDA 1KJWA 1M2OA 1J3TA 2EGCA 1D3BA 2QQ9A 3EAEA 4FCYA 1WLPB 2EYXA 4F7UA 2DXBA 5J26A 2RH2A 5GAMg 1D3BB 4AMCA 4WF2A 4F7UB 2NUPA 4C0GA 2BIVA 4F04B 1WQ7A 3OA6A 1YI2Q 1KC8R 3ASKA 3MEAA 3OYGA 2NUPB 4P5NA 4LDYA 1OU9A 4PJOD 2ZAEA 4OVAA 2A7YA 2BE9B 1XNIA 2F5TX 3OBYA 2YHTA 5FROA 4C5HA 4F14A 1PSEA 1UGQB 1MV3A 5CIUA 4DEXA 5CKHA 5GAN5 3QXEB 4M75A 3CD6T 3JSCA 3A8LB 1GXIE 4M7AC 1D1CA 3G71T 2PUKB 2LJ0A 4M75B 3OS0A 3L2WA 2OTJT 3FJ5A 2D0NA 3THKA 2RNAA 4FYVB 4C92G 1PC0A 3OYDA 1VYVA 1UECA 1TU0B 5IH2A 3VYGA 3RKXA 1C1AA 3CC7T 2RQTA 4EMKC 1QP3A 1QCFA 2F2VA 3A98A 1M90C 3AT1B 2DK3A 3TCJA 3I56T 1S72A 1VQ6T 2DIGA 1MUZA 4IUTA 2QXFA 2DIQA 3UT1A 3J81E 1GFDA 3CPWP 4L5GA 2OX7A 3OYBA 4ME7A 1VQ7T 5HKCA 3I55T 2ZPEB 3G7ZA 5GANf 3MJXA 3UF4A 3FLGA 1VQMA 3M0RA 1K8AR 3QJYA 2CZ1B 3REAB 1UB4A 1WX6A 4PL6A 1UHCA 2HD0A 3M0QA 2DM1A 2QK0A 4M77D 4HCCA 1GL5A 2K7AA 2EPDA 1WFWA 3NMZC 4TVRA 4C5GA 1HSQA 4C0DC 1RAAB 3BDLA 4LDWA 1T3SA 2G6FX 2KAFA 2HQHA 2QA4Q 3PGGA 5GAOn 2JN0A 2C0OA 2FHDA 2K5IA 1IRXA 3L1AA 2BKDN 1MMAA 2W0ZA 3SDZA 5GJWB 3A8GB 4ZTJA 1I0CA 1K9MC 1QVGA 1M1KU 5IHIA 1I5LA 2AZVA 3VS1A 3UDCA 4JJBA 4M78D 2BZ8A 2IIMA 3UWNA 2K4YA 1TXQA 1VQ4Q 3E2UA 4BDZA 3VS6A 1R77A 2YUQA 2L0AA 4OP0A 1AOJA 3G6EQ 1XJWB 3CCVQ 4PJMA 2YT6A 3JB9H 1IXDA 2DF6A 2LMJA 4RTUA 2QEXQ 4J7FA 1VQOA 4IUPA 3M53A 2J06A 1G3SA 3VS0A 3S3OA 1R0BG 5CQXA 3MEUA 2CS7A 2RD1A 3FRNA 1RAFB 4BI3A 1NG2A 2RQVA 1PNJA 1E6GA 1FMVA 2EGEA 3GOXA 3BE3A 5FU7B 1YHQA 2E4HA 2HL5C 2QDYB 2SEMA 4IUUA 2XD0A 1M3AA 1SSFA 4Z88A 3TEEA 1YWPA 3CCMA 4E7SA 4JZ3A 1RACB 1Q86R 2ECZA 4HT8A 1RL2A 5KYWA 2BZYA 1YIJQ 2HEQA 3REBB 5GAN3 4UC4A 2XDPA 5KYWB 2EYZA 2EJ9A 3OMGA 1VOMA 1GBQA 1RAIB 1YCSB 2HNIA 1PWTA 1RAGB 1PSFA 3L2ZA 5J3BA 2CKKA 4MMKA 1WZOA 4C8QE 2DEUA 4PLIA 2QG9B 1D0ZA 1MV0B 2JS0A 2ZPGB 3FC3A 1Q81C 2QASA 2YDLA 2FPEA 4C92D 3CCQA 3IQLA 2K5FA 2DFUA 2MWOA 3JB9G 3U23A 2HSEB 3JCMh 2P0QA 3VS3A 1KSWA 1KQSS 4R55A 1M9SA 1B34A 7AT1B 3P8DA 3HRSA 3H9NA 3OYYA 1QQJA 4QQ6A 1YITQ 4E47A 2ABLA 2MAMA 3CCEA 2CSIA 3E9GA 5GANj 4M75C 1B34B 1BI2A 2ZGWA 3X20B 1FXXA 1Y96A 1FYNA 2RJCA 2EQIA 4QQDA 1U8RA 3META 4BE1A 2KYMA 3MCAB 2HAXA 1N5ZA 4FT2A 4FT4A 1Y96B 1IGQA 4FL6A 3QSUA 1S72T 4OMPA 1UJ0A 1YJ9A 2E3HA 3UATA 3JCMg 3JCMW 6AT1B 1TOVA 4LD9K 1IZ6A 2L3RA 2I2LA 2JS2A 4NOYA 2GQVA 5GAOq 2VXFA 3CCRA 3RERA 2KDSA 1X01A 4GY5A 1WYXA 2EQUA 2L3QA 1B07A 1YJWQ 2HKQB 5IAYA 3LYIA 4OGEA 1MMNA 2QGFB 3BFMA 3SB2A 1N9RA 1D0XA 2WSEE 4PLLA 1RLQC 2P4TA 4EMGA 3P8BB 4CC2A 4FYXB 4ZNXA 2XK0A 5GAMd 4M7DE 2XHCA 5GMKe 1OYXA 5LJ3f 1PKTA 2ROLA 4C8QF 4JJCA 1TSFA 1WXBA 3NPFA 4F17A 4CC7A 4ZGEB 1RLPC 2COZA 2JNGA 4HCZA 1ZSGA 2CP5A 4M77E 2KR3A 4KUIA 2AHJB 1LVKA 4FSSA 2V8IA 2V1RA 3QIIA 2FVUA 2RPNA 3V7SA 1GFCA 2H3EB 3EHQA 1VQ9Q 1QMCA 1VUBA 5DM7R 2K6DA 2DBMA 3V8JA 5A2QE 3J7AF 1OEBA 2DKGA 2KMTA 3QBYA 3L2UA 3DB3A 2RO0A 4Z89A 1D09B 4PJOG 4M78E 2R58A 4BY6B 1UG1A 1ZBJA 4E7JA 4AT1B 5L8RE 4NL2A 1BCOA 4GBQA 2RHUA 3C12A 5GAOr 3CCUA 3MEWA 4ELZC 1WHJA 3ZFJA 1ZUYA 1ZQ1A 2E6ZA 1ZA1B 1YHQT 1D1BA 1M3BA 2GGRA 5GMKm 1YCYA 3HSBA 4L59A 3JB9J 2E6NA 5FU7C 2MF2A 4FW1A 4NS5A 2K5LA 4B9WA 3CCMT 1VQ5Q 2KSSA 1Z9ZA 5IT9E 3M9QA 4C8QA 3OYKA 4PJNA 1U1TA 4RKUE 4RG2A 4A53A 2LCCA 4M7DF 4C8QB 3E1SA 4OB1B 1Y07A 3OS5A 2K9GA 1NEBA 1VQ8Q 1QP2A 2K3BA 4CC4B 2MPXC 2DPPB 1PG5B 1PD1A 1W2BA 4MZTA 3J80E 2JW4A 5L23A 3EG9A 4JLIA 5EG2A 1NPRA 2EKHA 2R57A 1C6VX 1H8KA 3E19A 3LGLA 4M77F 1VQPA 3CCQT 3LLRA 3EG9B 5HK0A 3EFRA 4EPCA 1N27A 3M0PA 3S3NA 1V76A 3NTKA 4J9CA 4KH0B 4JDSA 4M77G 3CCJQ 3MHXA 2E1HA 4MZPA 2DILA 1BIBA 4DA4A 1K73U 4A4FA 3JB9I 5DLQE 1B7TA 2FO0A 1Q7YR 2VXEA 4HXJA 3JCMe 1HXDA 1WJQA 2RI2A 4M7AD 4C92E 3CCET 1K1ZA 1O75A 1S1NA 1ZSZA 1M1KR 2F5KA 3GNFB 1KFZA 1X43A 4E7HA 4XAXB 4M78F 1ZSZB 2PTKA 2XG8D 3INZA 2E65A 2EGAA 3EG2A 5EC7A 3QHSA 2FZGB 4YTLA 3A8MB 1YJ9T 5M9OA 2FPFA 2X4WA 3CD6Q 2A0FB 1BU1A 2YLBA 3NTIA 3G1JA 3SEMA 1VQ8T 1IO6A 2GF7A 3G71Q 2V8JA 3OSVA 2FRWA 3LX7A 2MI6A 2QAZA 5KH6A 5LJ3j 1IHWA 4M7DA 2LX9A 2OTJQ 1X6BA 1OQKA 2MOXA 4J8OA 4LUDA 2EVRA 2MIOA 4E2FB 2CGHA 4M7DB 1LPLA 1VQLA 4M75G 2D8HA 4XTVA 4BUGA 1K8AC 4PNOA 1VQKA 3CC7Q 1C0MA 2M0OA 2BE7D 5J39A 1SG5A 3C0CA 4MMLA 3OYHA 3OW2A 3HL8A 4OMLA 2M02A 2DXUA 3WXMB 3I56Q 1VQ6Q 2JTEA 2H8HA 2AKLA 3UA7A 1XQHA 1RABB 5CKEA 3EG3A 2V8KA 1TH7A 1R0CB 2A28A 1VQ7Q 2VWFA 3I55Q 3TQ7P 2RK1A 3GBQA 3A1PA 2CT3A 2DZ9A 4ELYC 4AFUC 2M16A 4BE0A 3OS1A 1MGQA 3QDRB 2P4RA 2L8DA 5IHKA 1IB8A 1I81A 5CCAA 2D1XA 1MHNA 3QKJA 3WVEB 1PRLC 1BI0A 3KXTA 5KYYA 1ZUUA 4D8KA 5I21A 4JJNK 1A0NB 2DEQA 3N5BB 2A08A 4C92F 1Y0MA 2QQSA 5KYYB 2AIRB 1NYGA 2DA9A 2CH4W 3OQ5A 2EQJA 2RHXA 3EGDA 3UPUA 1JJ2P 5FRMA 2ZPFB 2D8JA 1KQ2A 1NYFA 3EGDB 2VGNA 2V1QA 2X35A 2P84A 4HA8A 1AWXA 2DXTA 1WHMA 3A5ZB 3PIOA 4D8DA 1KK7A 3RIRA 2LZ6B 2MYSA 3CCUT 5FWCA 3L2QA 4RTXA 2LX7A 5LJ5j 1JBMA 1YJNA 2DL7A 3NFCA 3VS2A 1VQNA 1FMWA 2RJDA 4GLKA 4HKEA 3OS2A 4J9FA 2JM8A 3HFNA 2IVWA 1JEGA 1BCMA 2ED1A 4BB7A 2KYBA 2E70A 3QUIA 1AWJA 1NBEB 2E5KA 1Q86C 2BUDA 2DVEA 1QVFA 2DYBA 1G3YA 2OI3A 4JRQA 1CKBA 2P0PA 5GMKh 3FDRA 4E7LA 2B8AA 4ORZA 5FLXE 2DNUA 1K0SA 2JVVA 1KD1R 1LNXA 4J9IA 5I11A 2KI7A 4PK4A 3PVQA 4E7KA 1WHKA 1QVGS 1JRIA 3A8OB 2XI9A 2IG0A 4RCBA 1OPLA 3H0FA 5IXFA 4N4GA 4KRTA 1E7OA 4FU6A 1QCNA 4FYYB 1EFNA 2LQ8A 2KBTA 2LC4A 3X28B 4XQ3A 1JJ2S 2JMAA 3GLXA 2W10A 1VA7A 1UHFA 3R6OA 3CMEA 5DY9A 2RK2A 1KQSP 2O9VA 1VIFA 5IXBA 3HHTB 1GCQA 4M75D 2PVGB 1X2KA 5CQYA 4J9HA 5FWBA 2HSPA 2M0YA 2J6OA 2JTFA 1NLPC 1ZSZC 4JPBW 2X9HA 1WQWA 4M7AE 3DB4A 1DJ7B 1U3OA 2LCLA 2LT4A 2RMOA 2YLCA 8AT1B 4D6WA 4EIKA 4O5VA 4DBQA 5KE2A 4Q5WA 1E6HA 3I5RA 2GTOA 4XU1A 2A37A 1RAHB 5CR2A 2XU8A 1VQLT 3QYHB 1WXTA 2J05A 5A0GA 4C5EA 2O31A 3CPWA 1VQKT 3VJPA 2X3WD 4J83A 3CXCA 1OX8A 3CBOA 2KRSA 3SFMA 3M5AA 1YNZA 4O6JA 2LDMA 4J6WA 4J9GA 1S72Q 3OYJA 1I4K1 2QDLA 1BYMA 3M59A 3CCSA 2EYQA 4RTVA 2L3SA 1UJYA 1KC8U 3HP9A 4A4GA 1W4SA 1UTIA 4X9CA 5D6YA 3TSWA 2E5QA 3MP1A 3PNWC 5GAMf 1VQMQ 1D0YA 3MPUB 3CC2A 4LE9A 3R6NA 4B6MA 3JB9F 1TG0A 1AEYA 5LJ5g 2EQMA 2EYYA 2JJ9A 5GMKl 2QQBA 3LH5A 1SHFA 3FB9A 2DJZA 4A4EA 3MP6A 4FM4B 4KT0E 2LP5A 3V7CA 3JAME 1N8RC 2ESWA 4J9BA 1M5Q1 1U06A 2LTOA 2PNIA 1BBZA 4ANJA 3V8KA 4OB2B 5CAIA 3RR6A 4FW2A 1AVZC 1VYTA 1OOTA 4PJOE 4IIOA 2GQIA 1M3CA 1NM7A 3HPWA 3NTHA 5FW9A 4QT7A 2CUBA 1QWEA 3RMQA 5KYXA 2WSFE 2EJGA 1O9SA 1QWFA 4BACA 2I0NA 2DVJA 3E9FA 5KYXB 1MMDA 3GPLA 4M7AF 1YWOA 2DO3A 1JU5C 1SHGA 2DXCA 1OZ2A 2ZPIB 1FX7A 1N9SA 1RI0A 3VUZA 2J6FA 3TVTA 2X4JA 4M7AG 3I5SA 1M27C 3HRUA 1VQNT 2D0QB 1VQMT 1PHTA 4HCKA 1OZ3A 1G83A 2VC8A 4C5IA 1VQOQ 2RB6A 3CC4A 5GAN8 4FSXA 5LJ3e 1NZ9A 4K11A 4IUVA 4BI8B 5GAOm 1V1CA 2QTXA 2J6KA 4JS4A 1WNLA 2QQRA 2MMPA 2FPDA 2CYZB 2L89A 1YHQQ 3VRZA 3H0HA 3RESA 1Q82R 3RKWA 1QVPA 1BKBA 4RTZA 1W2BP 4QVCA 3CCMQ 1NJIR 3QZ5B 1TWBA 4X9DA 2KE9A 3LH0A 1N8RR 2NWMA 4X34A 4ZN3A 1RAEB 3PTAA 3CPFA 2OTLA 3OYIA 3C95A 3JCMc 2OAUA 3M0UA 2PQWA 2C06A 1T0HA 1Q7YC 4LDUA 2XIDA 3CMET 3PFSA 2O01E 4X1VA 4LDVA 4PJOF 1KHIA 2F2XA 4F7UE 2YXYA 4KULA 4QQGA 3I9QA 1M90U 3CCQQ 3EG0A 2NUTA 1M1KC 1NLOC 4JUVA 3ZBDA 1VQOT 3V7RA 4AFSC 3CD6A 1K0XA 3OB9A 2NUTB 3PT9A 5GANh 3QG1A 2EW3A 1PRMC 4KBMB 2DAQA 3CMAA 1GCQC 2LCSA 4BI4A 2R5MA 2KQWA 5IHNA 4IURA 2RHZA 2X51A 3CCEQ 4M75E 1ARKA 5GAMj 3CCLA 4JS5A 3G4SA 1T0JA 2XMFA 1IGUA 3KFVA 2Z0WA 5LJ5e 1VQ6A 3OBWA 4ATOA 3HKSA 4A63B 5GANg 3TU4K 1YJ9Q 3CCST 1RUWA 1W2BS 2A3LA 2KNBB 1YI2A 2GCXA 5KCOA 2O2OA 1MMGA 4NL3A 1K9MU 2V26A 8ATCB 4C0DB 1IREB 1K76A 2YUOA 3CC2T 3EFOA 2EFIA 2O4XA 3EFOB 2HCKA 3TSZA 3M56A 4PJOA 2O4XB 4QVDA 2ENMA 2DL5A 3OYMA 2JUFA 1AWOA 5KYNA 4PJOB 1VIEA 1JB0E 1ZA2B 3L2RA 2K3YA 4R0KA 5D7UA 2KVQG 3OYNA 2A36A 3M55A 4N4IA 1G5VA 3VU3C 4M4ZA 4KGXB 2YSQA 2E64A 1JXOA 4KUDK 2EWNA 3QJ6A 1WXUA 3H8ZA 4F7UG 1UGRB 3FJPA 2Y4XA 2DLPA 2LJ3A 2YUNA 4E7IA 3JV3A 4N4HA 3L42A 2X3XD 3H6ZA 4AG1C 3F70A 1QCOA 3WVDB 4DBRA 2LQKA 3X25B 1XTDA 1UE9A 3JCMQ 3JCMf 2KXCA
chains in the Genus database with same CATH topology
1G3YA 4M75F 3HRTA 3M58A 2ZPGB 2R5AA 3FC3A 4JRQA 2E41A 4J6YA 3CCRT 1Q81C 4C92D 1U1SA 2FL7A 2P0PA 5GMKh 3G71A 3CCQA 3FDRA 3MP8A 4E7LA 2B8AA 5GAOp 4XTYA 2K5FA 2E10A 4OB3B 3ER0A 5AYFA 1I8FA 1XOVA 2PVOB 4EMKA 5FLXE 2OTJA 3VUBA 1BI3A 3OSSC 3CC4T 2MWOA 3JB9G 2JVVA 1Y7XA 1LNXA 3HFOA 3X24B 1YJWT 2F69A 2CZ0B 4EMKB 3OW2S 4E7KA 3JCMh 2P0QA 4JRPA 1QVGS 2YRVA 3M4GA 4M77A 4ZN1A 1JRIA 3A8OB 3RMSA 3S3MA 2XI9A 2VV5A 2PUOB 2IG0A 2QA4A 1KQSS 5CVIA 3CC7A 2KK4A 1Q86U 4RCBA 3CBMA 3QYGB 1M9SA 1NE8A 5FU6B 4R55A 5GAN6 1B34A 1R8OB 2PU9B 3P8DA 3HRSA 3OYYA 4M77B 4A4HA 2M9UA 4N4GA 4QQ6A 4E47A 2MAMA 3CCEA 1Q81U 2HQXA 2H3JA 3E9GA 4C8QD 5GANj 3LGFA 4FU6A 1B34B 1BI2A 4M75C 3RUXA 3I56A 3M4YA 2ZGWA 1M4ZA 3PMTA 4PKCC 3X20B 4A54A 3OYLA 1WJSA 2LQ8A 1BI1A 4B9XA 1FXXA 3M57A 3X26B 1Y96A 1KD1C 2LC4A 2ZZDA 3X28B 4XQ3A 5CKDA 2P0KA 2RJCA 2ZPBB 1JJ2S 4JRKA 3GLXA 2VGMA 4QQDA 4MZMA 1U8RA 3META 4BE1A 4OGCA 1VQ7A 3I55A 3BW1A 3MCAB 2HAXA 2D9TA 4FT2A 4FT4A 1Y96B 5GMKi 3R6OA 3CMEA 4FL6A 1VQ4A 3L2VA 3QSUA 3DKMA 1KQ1A 1H641 1S72T 4BDYA 1YJ9A 5DY9A 2RK2A 2XDBA 3JCMg 2OTLT 3JCMW 4LD9K 4M78A 1IZ6A 3SD4A 2DD5A 1VIFA 2L3RA 2ZCFB 3HHTB 5LJ3d 2I2LA 3G6EA 4M75D 2PVGB 1OI1A 5CQYA 4C0ZA 3DLMA 3KBGA 2KY9A 4QW2A 4NOYA 3CCVA 3JB9D 2GQVA 4M78B 3S3NA 5GAOq 2VXFA 2LT1A 3JRZA 3Q1JA 3CCRA 2JTFA 1X01A 2KDSA 2D6FA 4GY5A 2EQUA 2QEXA 2ZPHB 1NPPA 1VQ9T 1WQWA 5CKFA 5IAYA 3LYIA 4OGEA 5LJ5f 4M7DG 1WJRA 4OB0B 4M7AE 2DZCA 3BFMA 3DB4A 3SB2A 1DJ7B 1N9RA 2LRQA 2M1HA 2LCLA 2LT4A 2WSEE 2X4XA 2YLCA 5GAN4 4D6WA 4PLLA 3LWHA 2P4TA 4O5VA 4EMGA 3P8BB 5KE2A 2WACA 3JCMV 4Q5WA 3SWNC 1KHCA 2XK0A 2DTIA 3JCMd 5GAMd 4M7DE 2XHCA 1KC8C 4XU1A 2Y90A 3JCMJ 4MDXA 3TREA 5CR2A 4IKFA 2XU8A 1VQLT 3DLLA 3OYEA 3QYHB 5GMKe 4V2SA 3P8HA 2EQKA 4F7UF 5GANe 4BY6C 3CMAT 3M54A 1OYXA 2EAYA 4C5EA 5LJ3f 5A0GA 3CPWA 1VQKT 3VJPA 4XTXA 4C8QF 4LDXA 4J83A 4Y91A 3CXCA 3A8HB 2DTOA 3CBOA 3SFMA 3M5AA 4O6JA 4ZGEB 2JNGA 4HCZA 5IN1A 4ZGJB 2LDMA 4J6WA 4M77E 4HT9A 1N6AA 3CCLT 5GAN2 2K2VA 3C4SA 2K3XA 1I4K1 4ZGDB 4KUIA 3OYJA 3G4ST 2AHJB 3M59A 1YIJA 1BYMA 3CCSA 3V8LA 2V8IA 3GP8A 2EYQA 2XKOC 3OYAA 2RHYA 4JRIA 2JZ2A 3RERA 1EIFA 5KE3A 1KC8U 1UGSB 3HP9A 3QIIA 5LJ3h 4A4GA 4BE2A 1W4SA 3PMIA 2FVUA 1QVFS 3V7SA 1VQ5T 4X9CA 5D6YA 2DD4A 2E5QA 3MP1A 3PNWC 4J5YA 5GAMf 4M7DD 2QQAA 1VUBA 5DM7R 3CC2A 5CK9A 3V8JA 5A2QE 5CO7A 3J7AF 3JB9F 4DOWA 4M78G 1YI2T 2RHIA 5LJ5g 2EQMA 2DKGA 3GIBA 5GMKl 2QQBA 4C8QC 5A0DA 2FB7A 5KCHA 2CZ7B 2DJZA 3FB9A 4A4EA 2KMTA 3MP6A 4FM4B 4KT0E 3QBYA 3L2UA 3QO3A 3V7CA 3JAME 1N8RC 4XU3A 2VUBA 3DB3A 2RO0A 4RMOA 4MDWA 4PJOG 5GAMh 4M78E 4RCCA 1FWZA 1V29B 1M5Q1 4QVZA 1VQPT 3BDUA 3URGA 2LTOA 3T9NA 2R58A 3MO8A 4BY6B 4R56A 3JCMX 4C92A 1M1GA 3V8KA 4OB2B 4CRIA 3JCMb 1Q82U 4N0AC 4E7JA 5CAIA 4RG8A 4C0FA 5LJ3g 5L8RE 4PJOE 5GMKj 4NL2A 1WPYA 1UEBA 4C92B 2RHUA 3FIFA 1Q7YU 3C12A 3HPWA 3MEVA 3NTHA 3QZ9B 3CCUA 5GAOr 4A4KA 3MEWA 4ELZC 5LJ5d 1NJIU 1UGPB 3ZFJA 3CCJT 4PLIA 1ZQ1A 2E6ZA 1YHQT 1YITA 3RMQA 5GMKm 1YCYA 2RJEA 1N8RU 2WSFE 3HSBA 4PJOC 2EJGA 4L59A 3FEOA 2E6NA 3JB9J 1O9SA 2L5QA 3CEYA 4OMFB 5FU7C 2MF2A 4BACA 5GAOl 4NS5A 1D3BA 2K5LA 2QQ9A 3E9FA 2KSSA 3EAEA 4B9WA 3CCMT 4EDUA 4F7UA 3GPLA 4M7AF 1M8VA 2DXBA 2MWPA 5IT9E 5J26A 2DO3A 2DXCA 2RH2A 1D3BB 3M9QA 4C8QA 5GAMg 4WF2A 1OZ2A 2ZPIB 3OYKA 1FX7A 4F7UB 1N9SA 1RI0A 4C0GA 2BIVA 3VUZA 1WQ7A 1U1TA 2X4JA 4L6V5 4RG2A 4RKUE 4A53A 3OA6A 4M7AG 2LCCA 4ZTFA 4M7DF 3ASKA 3HRUA 4C8QB 3E1SA 3MEAA 2D0QB 4OB1B 3OYGA 1Y07A 1VQNT 3OS5A 4P5NA 1K73C 1VQMT 4LDYA 1LJOA 3LWIA 4PJOD 4XTUA 1JJ2A 1QP2A 1OZ3A 4OVAA 2RM4A 2A7YA 5GAN7 2VC8A 4C5IA 2DPPB 2RB6A 1XNIA 2F5TX 3OBYA 2YHTA 5FROA 4C5HA 4MZTA 1W2BA 1PSEA 1UGQB 3CC4A 5GAN8 3J80E 3GNGA 4FSXA 5CIUA 4JLIA 2RI3A 5LJ3e 1YJWA 3LW5E 2CZ6B 1NPRA 1NZ9A 5EG2A 2R57A 4IUVA 1G3WA 5CKHA 4BI8B 5GAN5 5GAOm 3E19A 2E12A 3QXEB 4M75A 3CD6T 3JSCA 2QTXA 3LGLA 4M77F 3A8LB 1BIAA 1VQPA 4J7IA 1GXIE 4M7AC 3G71T 3LLRA 3CCQT 3QPHA 5HK0A 1LOJA 3EFRA 2PUKB 2DTHA 1N27A 4EPCA 3CPWS 4JS4A 4II1A 1WNLA 2LVMA 3NTKA 2G3RA 4M75B 3KUFA 4JDSA 3CXCS 2QQRA 3OS0A 2HQEA 2MMPA 4M77G 3L2WA 2L89A 2CYZB 5LJ5h 3MHXA 5GANd 2OTJT 2E1HA 4MZPA 3RESA 1BIBA 4DA4A 1K73U 4M7DC 4A4FA 3JB9I 4C92G 3RKWA 1QVPA 5DLQE 4DQ2A 3OYDA 1BKBA 4OF1A 4QVCA 2RJFA 2VXEA 3VYGA 3RKXA 5HY6A 2GFAA 5GAMe 3JCMe 2QA4T 3CC7T 2RI5A 3O8VA 3QZ5B 4X9DA 4EMKC 1QP3A 2GFUA 3CBPA 1HXDA 1WJQA 2NLUA 2RI2A 1M90C 2VYTA 3LH0A 4C92E 4M7AD 4X34A 2DK3A 4ZN3A 3PTAA 3CCET 3TCJA 3CPFA 1O75A 4XTZA 5C6SA 5FU6C 3I56T 1S72A 1VQ6T 2DIGA 2F5KA 3GNFB 4IUTA 2QXFA 4M77C 4E7HA 2DIQA 2RA2A 2OTLA 3OYIA 3UT1A 4XAXB 5C0MA 4M78F 3J81E 3C95A 3JCMc 4L5GA 2OAUA 1Q82C 2PQWA 2XG8D 3INZA 2E65A 3OYBA 4ME7A 2C06A 1VQ7T 5HKCA 3I55T 2EJFA 1Q7YC 2ZPEB 3SWNA 3G7ZA 4LDUA 2XIDA 5GANf 3CMET 3FLGA 3PFSA 1VQMA 1NJIC 3QHSA 3QJYA 1VQ4T 4YTLA 2O01E 4PJOF 4LDVA 1VQ9A 2CZ1B 1KHIA 3A8MB 1YJ9T 1UB4A 5M9OA 2X4WA 4F7UE 4PL6A 3SWNB 4KULA 2HD0A 2YLBA 1G3TA 3NTIA 4QQGA 4BD3A 1M90U 1VQ8T 2GF7A 2XICA 2V8JA 3G6ET 3OSVA 1M1KC 4JUVA 3LX7A 3ZBDA 2MI6A 1VQOT 4M77D 4HCCA 5LJ3j 5KH6A 3V7RA 4M7DA 3CCVT 2LX9A 4TVRA 4C5GA 3CD6A 2HBPA 3OB9A 5FRNA 4C0DC 1H3ZA 4J8OA 2QEXT 3PT9A 5GANh 5I2SA 1KG1A 3BDLA 4LDWA 2CGHA 4M7DB 5CKBA 3QG1A 1VQLA 4M75G 4M78C 4KBMB 2DAQA 4XTVA 3CMAA 3JCMP 4BUGA 1K8AC 4PNOA 4BI4A 2KAFA 2R5MA 1VQKA 2KQWA 4XTWA 3PGGA 5GAOn 2JN0A 2M0OA 3JCMf 2FHDA 2K5IA 5DLOA 3VV0A 4IURA 5J39A 3L1AA 4JLGA 2RHZA 3EFSA 4MMLA 2BKDN 3PIPA 3OYHA 4M75E 3SDZA 4CI0C 3A8GB 3OW2A 4ZTJA 1K9MC 3HL8A 3BY7A 1QVGA 2DXUA 3WXMB 5GAMj 4LD6A 1M1KU 3CCLA 4JS5A 3G4SA 1I5LA 1Y71A 2K57A 3UDCA 1XQHA 1KQSA 5CKEA 5I2MA 5D6WA 1VQ6A 2V8KA 5LJ5e 1TH7A 1ZBXA 4M78D 1P92A 1VQ5A 5HK3A 2RK1A 3OBWA 4Y28E 1YJNT 4ATOA 3UWNA 4XK8E 2K4YA 2DZ9A 4ELYC 1K8AU 1YBYA 3HKSA 5GANg 4BDZA 3TU4K 1YIJT 2JOYA 2M16A 3CCST 4BE0A 4DOVA 3OS1A 4OP0A 5LL6S 1W2BS 2A3LA 1YI2A 1MGQA 3QDRB 3VYHB 2GCXA 5KCOA 5A0LA 2L8DA 3AHUA 4IUQA 4NL3A 1K9MU 4N0AA 3JB9H 1I81A 5CCAA 1VQ8A 2PVDB 1MHNA 1IREB 4C0DB 3QKJA 3WVEB 4J7FA 1BI0A 1X6OA 3KXTA 3CC2T 1VQOA 2EFIA 1X75C 2O4XA 4IUPA 3M53A 5I21A 4JJNK 1G3SA 2DEQA 3N5BB 4J6XA 2X4YA 4C92F 2QQSA 1KD1U 4Z02A 4PJOA 3M56A 3S3OA 2EKOA 2O4XB 3ME9A 5CQXA 3MEUA 2CS7A 4EMHA 4QVDA 2RD1A 3FRNA 2Y4YA 3OQ5A 2EQJA 2RHXA 1HK9A 3UPUA 2WSCE 4BI3A 2JUFA 3OYMA 4PJOB 5D6XA 1VIEA 1ZHIA 1JB0E 2LNVA 3GOXA 1WGSA 2ZPFB 5FU7B 5FRMA 3C94A 3L2RA 3CCJA 1YHQA 1KQ2A 2K3YA 2QDYB 2VGNA 3GF5A 2KVQG 4VUBA 3OYFA 4IUUA 2XD0A 2X35A 3OYNA 3RKYA 3M55A 4XU0A 4N4IA 1SSFA 1G5VA 4HA8A 3ZEHA 3VKIA 3TEEA 3VU3C 2DXTA 3CCMA 3A5ZB 4HCBA 3PIOA 2E64A 3RIRA 3CCUT 4HT8A 1RL2A 4FIBA 4XU2A 4KUDK 2EWNA 3L2QA 3QJ6A 5LJ5j 1YITT 3H8ZA 1JBMA 4F7UG 4C92C 1YJNA 5GAN3 3OY9A 1UGRB 4UC4A 2XDPA 3NFCA 3FJPA 2Y4XA 2EJ9A 3OMGA 4C8QG 1VQNA 2RJDA 4GLKA 4HKEA 3OS2A 4E7IA 3HFNA 1M1FA 4N4HA 2HNIA 3L42A 2IVWA 3H6ZA 1AHJB 2XDDA 4M7AA 2JTMA 3S6WA 1QW1A 3OMCA 3F70A 2QI2A 3WVDB 4BB7A 1PSFA 3L2ZA 2E70A 3QUIA 5J3BA 2CKKA 2EIFA 4MMKA 2LQKA 4M7AB 1Q86C 3X25B 4C8QE 1XTDA 3JCMQ 3OYCA 2BUDA 2DVEA 2FYKA 1QVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG A;  3CXC A;  1M1K U;  3CCL A;  3G4S A;  1XNI A;  3CCR T;  1Q81 C;  1W2B A;  3CC4 A;  3G71 A;  3CCQ A;  3J80 E;  1KQS A;  2JNG A;  1YJW A;  1NPR A;  1NZ9 A;  3ER0 A;  3CCL T;  1VQ6 A;  1YIJ A;  3G4S T;  5FLX E;  3CD6 T;  3LGL A;  1VQ5 A;  2OTJ A;  3CCS A;  1VQP A;  1YJN T;  3CC4 T;  3G71 T;  3CCQ T;  2MWO A;  2JVV A;  1YJW T;  3CPW S;  1K8A U;  1YBY A;  1EIF A;  3HKS A;  2LVM A;  3OW2 S;  2G3R A;  1KC8 U;  1QVF S;  1YIJ T;  1QVG S;  3CXC S;  2JOY A;  1VQ5 T;  3CCS T;  4ZN1 A;  2OTJ T;  5LL6 S;  1W2B S;  1YI2 A;  2IG0 A;  2QA4 A;  1KQS S;  1K73 U;  3CC7 A;  1Q86 U;  5DLQ E;  5DM7 R;  3CC2 A;  1K9M U;  1BKB A;  3OYY A;  5A2Q E;  3J7A F;  1YI2 T;  3CCE A;  5HY6 A;  1Q81 U;  1VQ8 A;  2QA4 T;  3CC7 T;  3LGF A;  3I56 A;  1X6O A;  3CC2 T;  1VQO A;  1M90 C;  2LQ8 A;  3LH0 A;  3JAM E;  1N8R C;  4X34 A;  4ZN3 A;  1KD1 C;  3CCE T;  3DB3 A;  3CPF A;  1JJ2 S;  3I56 T;  1S72 A;  1KD1 U;  4QQD A;  1VQ6 T;  1VQ7 A;  3I55 A;  2OTL A;  1VQP T;  3J81 E;  3CME A;  1Q82 C;  2JUF A;  1VQ4 A;  1M1G A;  1S72 T;  4CRI A;  1YJ9 A;  1Q82 U;  1VQ7 T;  3I55 T;  3CCJ A;  2OTL T;  1YHQ A;  1Q7Y C;  1IZ6 A;  2L3R A;  3CME T;  1NJI C;  2KVQ G;  1VQM A;  1UEB A;  3G6E A;  1Q7Y U;  1VQ4 T;  4YTL A;  3CCU A;  1VQ9 A;  1KHI A;  1NJI U;  1YJ9 T;  3KBG A;  1SSF A;  3CCV A;  3CCJ T;  2E6Z A;  1YHQ T;  3CCM A;  1YIT A;  3CCR A;  1M90 U;  2KDS A;  3A5Z B;  1VQ8 T;  3PIO A;  3G6E T;  1N8R U;  2QEX A;  1M1K C;  3CCU T;  1NPP A;  1VQ9 T;  1RL2 A;  2MI6 A;  1VQO T;  5IAY A;  3CCV T;  3CCM T;  4TVR A;  3DB4 A;  1YIT T;  3CD6 A;  1YJN A;  2LCL A;  2MWP A;  2QEX T;  5J26 A;  5IT9 E;  2DO3 A;  3P8B B;  1VQN A;  1VQL A;  3CMA A;  1K8A C;  2XHC A;  1KC8 C;  4RG2 A;  1VQK A;  3TRE A;  1VQN T;  1VQL T;  3DLL A;  2E70 A;  5J3B A;  3CMA T;  2CKK A;  2EIF A;  1K73 C;  1VQM T;  1Q86 C;  3PIP A;  1XTD A;  1VQK T;  3CPW A;  1JJ2 A;  3OW2 A;  1K9M C;  1QVF A; 
#chains in the Genus database with same CATH topology
 4M75 F;  3M58 A;  2R5A A;  1W70 A;  4J6Y A;  3CCR T;  2HMA A;  2COY A;  2FL7 A;  2CDT A;  3MP8 A;  2E10 A;  1I8F A;  1XOV A;  2BTT A;  1BI3 A;  3CC4 T;  2JM9 A;  1M8M A;  2CZ0 B;  3OW2 S;  1TUC A;  2CP6 A;  4JRP A;  2YRV A;  3M4G A;  4M77 A;  4ZN1 A;  2LJ1 A;  2QA4 A;  5CVI A;  2KK4 A;  1ZX6 A;  3CCU Q;  3CBM A;  1QVF P;  1NE8 A;  5FU6 B;  1ABO A;  1R8O B;  4Y92 A;  4M77 B;  2JT4 A;  2M9U A;  1Q81 U;  2H3J A;  2DL3 A;  4C8Q D;  3PVL A;  4PKC C;  4A54 A;  1WJS A;  2VAS A;  4B9X A;  1KD1 C;  3O5Z A;  1X69 A;  2ZZD A;  1X6G A;  4RUG A;  2VGM A;  4OGC A;  2D9T A;  1SF9 A;  1VQ4 A;  3L2V A;  1MND A;  1QVG P;  1KQ1 A;  1H64 1;  2AK5 A;  4BDY A;  1WA7 A;  2OTL T;  2K79 A;  2DJQ A;  4M78 A;  3G6E A;  3CQT A;  1EX4 A;  1EZZ B;  4C0Z A;  3DLM A;  1U5S A;  3KBG A;  1AT1 B;  1YN8 A;  2KT1 A;  3H0I A;  3CCV A;  4M78 B;  2LT1 A;  3Q1J A;  2QEX A;  2ZPH B;  3EHR A;  1NPP A;  5CKF A;  2DL4 A;  1WJR A;  1SKU B;  1VQP Q;  2LRQ A;  2DER A;  2B86 A;  3H41 A;  2DTI A;  3JCM d;  1PD0 A;  3TRE A;  4IKF A;  3DLL A;  3OYE A;  4V2S A;  2EQK A;  5GAN e;  3CMA T;  2F2W A;  4BY6 C;  2EAY A;  1FMK A;  4XTX A;  4LDX A;  3A8H B;  4J9D A;  2DTO A;  2OAW A;  3RDV A;  2KRN A;  4ZGJ B;  3EGX A;  2YWW A;  1N6A A;  3CCL T;  5GAN 2;  2K2V A;  3C4S A;  4ZGD B;  1YIJ A;  3G4S T;  1WHH A;  3GP8 A;  2XKO C;  2YRC A;  3EGX B;  1M30 A;  3OYA A;  4JRI A;  2AKK A;  1EIF A;  5LJ3 h;  1QVF S;  4BE2 A;  4E7Z A;  4M7D D;  1UGV A;  3CXC P;  1WI7 A;  2RQU A;  5CO7 A;  4DOW A;  1YI2 T;  1SPK A;  2QTV A;  4QKU A;  4C8Q C;  2FB7 A;  5KCH A;  3PE0 A;  2KGT A;  4XU3 A;  1GBR A;  2DRM A;  4RMO A;  4MDW A;  4RCC A;  1FWZ A;  1V29 B;  1VQL Q;  1OX9 A;  1VQP T;  3URG A;  4HVW A;  3T9N A;  1CSK A;  3MO8 A;  2CH4 A;  1KIK A;  4R56 A;  1BB9 A;  2OJ2 A;  1VQK Q;  4C92 A;  1M1G A;  4CRI A;  3JCM b;  5LJ3 g;  4C0F A;  4J9E A;  3M0T A;  1UEB A;  4C92 B;  3FIF A;  1Q7Y U;  3QZ9 B;  1UUE A;  1M2V A;  1UGP B;  1PKS A;  1YIT A;  5GJV B;  2CUD A;  4PJO C;  1LCK A;  1M2V B;  4KH1 B;  4OMF B;  5GAO l;  1ZLM A;  4EDU A;  1M8V A;  2MWP A;  4PFZ A;  3RNJ A;  1T3L A;  2KRO A;  4L6V 5;  4ZTF A;  3VS7 A;  1RAD B;  1K73 C;  3LWI A;  1LJO A;  4XTU A;  1JJ2 A;  2RM4 A;  5GAN 7;  3VS4 A;  1QKW A;  2COW A;  1SEM A;  5KYU A;  3GNG A;  2RI3 A;  1YJW A;  3LW5 E;  2CZ6 B;  2AZS A;  1YP5 A;  1G3W A;  4WTO B;  3QWX X;  1ABQ A;  2E12 A;  5KYU B;  1M90 R;  1Y57 A;  1BIA A;  4J7I A;  3M0S A;  2K2M A;  1I07 A;  3QPH A;  1LOJ A;  2DTH A;  3CPW S;  4II1 A;  2LVM A;  2G3R A;  3KUF A;  2XDB A;  3CXC S;  2HQE A;  2HDA A;  5LJ5 h;  5GAN d;  4M7D C;  4DBH A;  1OV3 A;  4DQ2 A;  4JJD A;  4OF1 A;  4WCI A;  2RJF A;  5HY6 A;  2GFA A;  5GAM e;  2QA4 T;  2RI5 A;  3O8V A;  1I5O B;  2GFU A;  3CBP A;  1CKA A;  2NLU A;  2VYT A;  1GCP A;  1YJN Q;  5C6S A;  4LN2 A;  4XTZ A;  5FU6 C;  2JMC A;  2F1L A;  2CP7 A;  4M77 C;  2FEI A;  1VQN Q;  2RA2 A;  1SRL A;  5C0M A;  1Q82 C;  4OMM A;  1OPK A;  2EJF A;  1GRI A;  3D7S B;  3SWN A;  1NJI C;  3NGP A;  1WDX A;  4DBF A;  1VQ4 T;  3VS5 A;  1VQ9 A;  4FYW B;  1X2Q A;  3SWN B;  1G3T A;  4BD3 A;  5I22 A;  2XIC A;  3G6E T;  1SSH A;  1K9M R;  3CCV T;  4RTT A;  1ZUK A;  2HBP A;  5FRN A;  1H3Z A;  2QEX T;  5I2S A;  1KG1 A;  5CKB A;  2NUZ A;  1WHL A;  4M78 C;  3JCM P;  4XTW A;  4PFP A;  3QWY A;  1TUG B;  2PZ1 A;  5DLO A;  3VV0 A;  4JLG A;  1K73 R;  3EFS A;  4HVU A;  3PIP A;  2YRD A;  1G2B A;  4CI0 C;  2RF0 A;  3BY7 A;  1RI9 A;  4LD6 A;  2CRE A;  4ESR A;  2FZC B;  1Y71 A;  2K57 A;  1KQS A;  5I2M A;  5D6W A;  1ZBX A;  1D1A A;  1P92 A;  1VQ5 A;  5HK3 A;  1SRM A;  4Y28 E;  1AD5 A;  1YJN T;  2C0I A;  4AG2 C;  3SHW A;  3CME Q;  4XK8 E;  1K8A U;  1UDL A;  1YBY A;  1JO8 A;  1YIJ T;  2JOY A;  4DOV A;  5LL6 S;  3VYH B;  2KRM A;  3EG1 A;  5A0L A;  2LQW A;  3AHU A;  4IUQ A;  1WHG A;  1TS9 A;  4N0A A;  2VB6 A;  1ACM B;  1VQ8 A;  2PVD B;  1X6O A;  4AFQ C;  2RN8 A;  1X75 C;  4PJJ A;  1W6X A;  2DYI A;  1G8X A;  4J6X A;  2X4Y A;  1KD1 U;  1X27 A;  4Z02 A;  2CSQ A;  2EKO A;  3ME9 A;  4EMH A;  2Y4Y A;  1HK9 A;  1HYO A;  2WSC E;  1ZHI A;  2LNV A;  1WGS A;  4GLM A;  2CP0 A;  3C94 A;  3CCJ A;  3GF5 A;  3OYF A;  1QLY A;  4VUB A;  2ED0 A;  1B3Q A;  3RKY A;  1UFF A;  4XU0 A;  3ZEH A;  3VKI A;  3QDF A;  4HCB A;  1Q95 G;  2ATC B;  2DX1 A;  4FIB A;  4XU2 A;  1JXM A;  2DRK A;  1YIT T;  3CCS Q;  1Q81 R;  4C92 C;  3OY9 A;  1H3H A;  2L2P A;  1YFN A;  1I1J A;  3VRY A;  4C8Q G;  1VYU A;  4CC3 A;  1M1F A;  4OMN A;  1TTH B;  2XDD A;  1AHJ B;  3I35 A;  4M7A A;  2JTM A;  3S6W A;  1QW1 A;  3OMC A;  1WIE A;  2QI2 A;  3CC2 Q;  2EYW A;  4IIM A;  2EIF A;  4M7A B;  3OYC A;  2FYK A;  5D6X A;  3ULR B;  2LNH B;  3HRT A;  4KGZ B;  2E41 A;  2DE0 X;  1MNE A;  3UA6 A;  1U1S A;  3G71 A;  2HL3 A;  5GAO p;  4XTY A;  4OB3 B;  5ECA A;  3ER0 A;  5AYF A;  2PVO B;  4EMK A;  2OTJ A;  3VUB A;  3OSS C;  1Y7X A;  3X24 B;  3HFO A;  1YJW T;  2F69 A;  2J7I A;  4EMK B;  2EBP A;  2KEA A;  1NEG A;  2HBW A;  1AZG B;  3RMS A;  3RBB B;  3S3M A;  1OU8 A;  2VV5 A;  2PUO B;  3CC7 A;  9ATC B;  1Q86 U;  3QYG B;  5GAN 6;  2HZY A;  1AZE A;  2PU9 B;  4A4H A;  2BZX A;  1HD3 A;  2RQW A;  2CP3 A;  2MCN A;  1K9A A;  2DBK A;  2HQX A;  3LGF A;  3RUX A;  3I56 A;  2GTJ A;  3M4Y A;  3PMT A;  1M4Z A;  3OYL A;  1BI1 A;  4E6R A;  3M57 A;  3X26 B;  5CKD A;  2P0K A;  2ZPB B;  4JRK A;  4MZM A;  4HVV A;  1JQQ A;  1VQ7 A;  3I55 A;  3BW1 A;  2DMO A;  4OMO A;  5GMK i;  3NHN A;  3OW2 P;  3DKM A;  5HCK A;  2QGG A;  3CCR Q;  3SD4 A;  2DD5 A;  2ZCF B;  5LJ3 d;  2CP2 A;  1OI1 A;  1H92 A;  4QW2 A;  2KY9 A;  4PJL A;  3JB9 D;  3JRZ A;  3CC4 Q;  2D6F A;  4AFZ C;  3ZL7 C;  2E3I A;  1VQ9 T;  4M7D G;  5LJ5 f;  4OB0 B;  2MK5 A;  2DZC A;  2M1H A;  2DL8 A;  2X4X A;  5GAN 4;  1QKX A;  2VKN A;  3LWH A;  2FG0 A;  4RTW A;  2WAC A;  3JCM V;  3SWN C;  1KHC A;  1KC8 C;  1TUD A;  2Y90 A;  3JCM J;  2CT4 A;  4MDX A;  1HJD A;  3P8H A;  4F7U F;  3M54 A;  3HTR A;  2M51 A;  2GNC A;  4PFO A;  2RQR A;  3EH1 A;  4Y91 A;  2O9S A;  2QYZ A;  2AT1 B;  1Z9Q A;  2L3P A;  2KXD A;  5IN1 A;  4HT9 A;  3EGU A;  2K3X A;  2OTL Q;  2FZK B;  3V8L A;  4LXC A;  2O88 A;  1AWW A;  2RHY A;  2JZ2 A;  2LQN A;  5KE3 A;  1UGS B;  3PMI A;  1VQ5 T;  2DD4 A;  4J5Y A;  1W1F A;  1BK2 A;  2QQA A;  1PM3 A;  2FRY A;  5CK9 A;  2SRC A;  2NYS A;  4M78 G;  2RHI A;  3GIB A;  5A0D A;  4F16 A;  2CZ7 B;  3EH2 A;  2IPO B;  2YUP A;  4DEY A;  4OMQ A;  3QO3 A;  1PCX A;  4LUE A;  2VUB A;  1K4U S;  4RTY A;  2HKN A;  2JXB A;  2GBQ A;  5GAM h;  4Z8A A;  1OUL A;  4QVZ A;  3BDU A;  3CMA Q;  3JCM X;  4LNP A;  2ROT A;  1Q82 U;  4N0A C;  2C0T A;  4RG8 A;  4KGV B;  5AT1 B;  5GMK j;  2DET A;  1WPY A;  3MEV A;  4A4K A;  5LJ5 d;  1NJI U;  1F1B B;  2KT8 A;  3CCL Q;  3CCJ T;  3G4S Q;  4JZ4 A;  1IHV A;  2VVK A;  2RJE A;  1N8R U;  3FEO A;  2L5Q A;  3CEY A;  3MKD A;  1KJW A;  1M2O A;  1J3T A;  2EGC A;  1D3B A;  2QQ9 A;  3EAE A;  4FCY A;  1WLP B;  2EYX A;  4F7U A;  2DXB A;  5J26 A;  2RH2 A;  5GAM g;  1D3B B;  4AMC A;  4WF2 A;  4F7U B;  2NUP A;  4C0G A;  2BIV A;  4F04 B;  1WQ7 A;  3OA6 A;  1YI2 Q;  1KC8 R;  3ASK A;  3MEA A;  3OYG A;  2NUP B;  4P5N A;  4LDY A;  1OU9 A;  4PJO D;  2ZAE A;  4OVA A;  2A7Y A;  2BE9 B;  1XNI A;  2F5T X;  3OBY A;  2YHT A;  5FRO A;  4C5H A;  4F14 A;  1PSE A;  1UGQ B;  1MV3 A;  5CIU A;  4DEX A;  5CKH A;  5GAN 5;  3QXE B;  4M75 A;  3CD6 T;  3JSC A;  3A8L B;  1GXI E;  4M7A C;  1D1C A;  3G71 T;  2PUK B;  2LJ0 A;  4M75 B;  3OS0 A;  3L2W A;  2OTJ T;  3FJ5 A;  2D0N A;  3THK A;  2RNA A;  4FYV B;  4C92 G;  1PC0 A;  3OYD A;  1VYV A;  1UEC A;  1TU0 B;  5IH2 A;  3VYG A;  3RKX A;  1C1A A;  3CC7 T;  2RQT A;  4EMK C;  1QP3 A;  1QCF A;  2F2V A;  3A98 A;  1M90 C;  3AT1 B;  2DK3 A;  3TCJ A;  3I56 T;  1S72 A;  1VQ6 T;  2DIG A;  1MUZ A;  4IUT A;  2QXF A;  2DIQ A;  3UT1 A;  3J81 E;  1GFD A;  3CPW P;  4L5G A;  2OX7 A;  3OYB A;  4ME7 A;  1VQ7 T;  5HKC A;  3I55 T;  2ZPE B;  3G7Z A;  5GAN f;  3MJX A;  3UF4 A;  3FLG A;  1VQM A;  3M0R A;  1K8A R;  3QJY A;  2CZ1 B;  3REA B;  1UB4 A;  1WX6 A;  4PL6 A;  1UHC A;  2HD0 A;  3M0Q A;  2DM1 A;  2QK0 A;  4M77 D;  4HCC A;  1GL5 A;  2K7A A;  2EPD A;  1WFW A;  3NMZ C;  4TVR A;  4C5G A;  1HSQ A;  4C0D C;  1RAA B;  3BDL A;  4LDW A;  1T3S A;  2G6F X;  2KAF A;  2HQH A;  2QA4 Q;  3PGG A;  5GAO n;  2JN0 A;  2C0O A;  2FHD A;  2K5I A;  1IRX A;  3L1A A;  2BKD N;  1MMA A;  2W0Z A;  3SDZ A;  5GJW B;  3A8G B;  4ZTJ A;  1I0C A;  1K9M C;  1QVG A;  1M1K U;  5IHI A;  1I5L A;  2AZV A;  3VS1 A;  3UDC A;  4JJB A;  4M78 D;  2BZ8 A;  2IIM A;  3UWN A;  2K4Y A;  1TXQ A;  1VQ4 Q;  3E2U A;  4BDZ A;  3VS6 A;  1R77 A;  2YUQ A;  2L0A A;  4OP0 A;  1AOJ A;  3G6E Q;  1XJW B;  3CCV Q;  4PJM A;  2YT6 A;  3JB9 H;  1IXD A;  2DF6 A;  2LMJ A;  4RTU A;  2QEX Q;  4J7F A;  1VQO A;  4IUP A;  3M53 A;  2J06 A;  1G3S A;  3VS0 A;  3S3O A;  1R0B G;  5CQX A;  3MEU A;  2CS7 A;  2RD1 A;  3FRN A;  1RAF B;  4BI3 A;  1NG2 A;  2RQV A;  1PNJ A;  1E6G A;  1FMV A;  2EGE A;  3GOX A;  3BE3 A;  5FU7 B;  1YHQ A;  2E4H A;  2HL5 C;  2QDY B;  2SEM A;  4IUU A;  2XD0 A;  1M3A A;  1SSF A;  4Z88 A;  3TEE A;  1YWP A;  3CCM A;  4E7S A;  4JZ3 A;  1RAC B;  1Q86 R;  2ECZ A;  4HT8 A;  1RL2 A;  5KYW A;  2BZY A;  1YIJ Q;  2HEQ A;  3REB B;  5GAN 3;  4UC4 A;  2XDP A;  5KYW B;  2EYZ A;  2EJ9 A;  3OMG A;  1VOM A;  1GBQ A;  1RAI B;  1YCS B;  2HNI A;  1PWT A;  1RAG B;  1PSF A;  3L2Z A;  5J3B A;  2CKK A;  4MMK A;  1WZO A;  4C8Q E;  2DEU A;  4PLI A;  2QG9 B;  1D0Z A;  1MV0 B;  2JS0 A;  2ZPG B;  3FC3 A;  1Q81 C;  2QAS A;  2YDL A;  2FPE A;  4C92 D;  3CCQ A;  3IQL A;  2K5F A;  2DFU A;  2MWO A;  3JB9 G;  3U23 A;  2HSE B;  3JCM h;  2P0Q A;  3VS3 A;  1KSW A;  1KQS S;  4R55 A;  1M9S A;  1B34 A;  7AT1 B;  3P8D A;  3HRS A;  3H9N A;  3OYY A;  1QQJ A;  4QQ6 A;  1YIT Q;  4E47 A;  2ABL A;  2MAM A;  3CCE A;  2CSI A;  3E9G A;  5GAN j;  4M75 C;  1B34 B;  1BI2 A;  2ZGW A;  3X20 B;  1FXX A;  1Y96 A;  1FYN A;  2RJC A;  2EQI A;  4QQD A;  1U8R A;  3MET A;  4BE1 A;  2KYM A;  3MCA B;  2HAX A;  1N5Z A;  4FT2 A;  4FT4 A;  1Y96 B;  1IGQ A;  4FL6 A;  3QSU A;  1S72 T;  4OMP A;  1UJ0 A;  1YJ9 A;  2E3H A;  3UAT A;  3JCM g;  3JCM W;  6AT1 B;  1TOV A;  4LD9 K;  1IZ6 A;  2L3R A;  2I2L A;  2JS2 A;  4NOY A;  2GQV A;  5GAO q;  2VXF A;  3CCR A;  3RER A;  2KDS A;  1X01 A;  4GY5 A;  1WYX A;  2EQU A;  2L3Q A;  1B07 A;  1YJW Q;  2HKQ B;  5IAY A;  3LYI A;  4OGE A;  1MMN A;  2QGF B;  3BFM A;  3SB2 A;  1N9R A;  1D0X A;  2WSE E;  4PLL A;  1RLQ C;  2P4T A;  4EMG A;  3P8B B;  4CC2 A;  4FYX B;  4ZNX A;  2XK0 A;  5GAM d;  4M7D E;  2XHC A;  5GMK e;  1OYX A;  5LJ3 f;  1PKT A;  2ROL A;  4C8Q F;  4JJC A;  1TSF A;  1WXB A;  3NPF A;  4F17 A;  4CC7 A;  4ZGE B;  1RLP C;  2COZ A;  2JNG A;  4HCZ A;  1ZSG A;  2CP5 A;  4M77 E;  2KR3 A;  4KUI A;  2AHJ B;  1LVK A;  4FSS A;  2V8I A;  2V1R A;  3QII A;  2FVU A;  2RPN A;  3V7S A;  1GFC A;  2H3E B;  3EHQ A;  1VQ9 Q;  1QMC A;  1VUB A;  5DM7 R;  2K6D A;  2DBM A;  3V8J A;  5A2Q E;  3J7A F;  1OEB A;  2DKG A;  2KMT A;  3QBY A;  3L2U A;  3DB3 A;  2RO0 A;  4Z89 A;  1D09 B;  4PJO G;  4M78 E;  2R58 A;  4BY6 B;  1UG1 A;  1ZBJ A;  4E7J A;  4AT1 B;  5L8R E;  4NL2 A;  1BCO A;  4GBQ A;  2RHU A;  3C12 A;  5GAO r;  3CCU A;  3MEW A;  4ELZ C;  1WHJ A;  3ZFJ A;  1ZUY A;  1ZQ1 A;  2E6Z A;  1ZA1 B;  1YHQ T;  1D1B A;  1M3B A;  2GGR A;  5GMK m;  1YCY A;  3HSB A;  4L59 A;  3JB9 J;  2E6N A;  5FU7 C;  2MF2 A;  4FW1 A;  4NS5 A;  2K5L A;  4B9W A;  3CCM T;  1VQ5 Q;  2KSS A;  1Z9Z A;  5IT9 E;  3M9Q A;  4C8Q A;  3OYK A;  4PJN A;  1U1T A;  4RKU E;  4RG2 A;  4A53 A;  2LCC A;  4M7D F;  4C8Q B;  3E1S A;  4OB1 B;  1Y07 A;  3OS5 A;  2K9G A;  1NEB A;  1VQ8 Q;  1QP2 A;  2K3B A;  4CC4 B;  2MPX C;  2DPP B;  1PG5 B;  1PD1 A;  1W2B A;  4MZT A;  3J80 E;  2JW4 A;  5L23 A;  3EG9 A;  4JLI A;  5EG2 A;  1NPR A;  2EKH A;  2R57 A;  1C6V X;  1H8K A;  3E19 A;  3LGL A;  4M77 F;  1VQP A;  3CCQ T;  3LLR A;  3EG9 B;  5HK0 A;  3EFR A;  4EPC A;  1N27 A;  3M0P A;  3S3N A;  1V76 A;  3NTK A;  4J9C A;  4KH0 B;  4JDS A;  4M77 G;  3CCJ Q;  3MHX A;  2E1H A;  4MZP A;  2DIL A;  1BIB A;  4DA4 A;  1K73 U;  4A4F A;  3JB9 I;  5DLQ E;  1B7T A;  2FO0 A;  1Q7Y R;  2VXE A;  4HXJ A;  3JCM e;  1HXD A;  1WJQ A;  2RI2 A;  4M7A D;  4C92 E;  3CCE T;  1K1Z A;  1O75 A;  1S1N A;  1ZSZ A;  1M1K R;  2F5K A;  3GNF B;  1KFZ A;  1X43 A;  4E7H A;  4XAX B;  4M78 F;  1ZSZ B;  2PTK A;  2XG8 D;  3INZ A;  2E65 A;  2EGA A;  3EG2 A;  5EC7 A;  3QHS A;  2FZG B;  4YTL A;  3A8M B;  1YJ9 T;  5M9O A;  2FPF A;  2X4W A;  3CD6 Q;  2A0F B;  1BU1 A;  2YLB A;  3NTI A;  3G1J A;  3SEM A;  1VQ8 T;  1IO6 A;  2GF7 A;  3G71 Q;  2V8J A;  3OSV A;  2FRW A;  3LX7 A;  2MI6 A;  2QAZ A;  5KH6 A;  5LJ3 j;  1IHW A;  4M7D A;  2LX9 A;  2OTJ Q;  1X6B A;  1OQK A;  2MOX A;  4J8O A;  4LUD A;  2EVR A;  2MIO A;  4E2F B;  2CGH A;  4M7D B;  1LPL A;  1VQL A;  4M75 G;  2D8H A;  4XTV A;  4BUG A;  1K8A C;  4PNO A;  1VQK A;  3CC7 Q;  1C0M A;  2M0O A;  2BE7 D;  5J39 A;  1SG5 A;  3C0C A;  4MML A;  3OYH A;  3OW2 A;  3HL8 A;  4OML A;  2M02 A;  2DXU A;  3WXM B;  3I56 Q;  1VQ6 Q;  2JTE A;  2H8H A;  2AKL A;  3UA7 A;  1XQH A;  1RAB B;  5CKE A;  3EG3 A;  2V8K A;  1TH7 A;  1R0C B;  2A28 A;  1VQ7 Q;  2VWF A;  3I55 Q;  3TQ7 P;  2RK1 A;  3GBQ A;  3A1P A;  2CT3 A;  2DZ9 A;  4ELY C;  4AFU C;  2M16 A;  4BE0 A;  3OS1 A;  1MGQ A;  3QDR B;  2P4R A;  2L8D A;  5IHK A;  1IB8 A;  1I81 A;  5CCA A;  2D1X A;  1MHN A;  3QKJ A;  3WVE B;  1PRL C;  1BI0 A;  3KXT A;  5KYY A;  1ZUU A;  4D8K A;  5I21 A;  4JJN K;  1A0N B;  2DEQ A;  3N5B B;  2A08 A;  4C92 F;  1Y0M A;  2QQS A;  5KYY B;  2AIR B;  1NYG A;  2DA9 A;  2CH4 W;  3OQ5 A;  2EQJ A;  2RHX A;  3EGD A;  3UPU A;  1JJ2 P;  5FRM A;  2ZPF B;  2D8J A;  1KQ2 A;  1NYF A;  3EGD B;  2VGN A;  2V1Q A;  2X35 A;  2P84 A;  4HA8 A;  1AWX A;  2DXT A;  1WHM A;  3A5Z B;  3PIO A;  4D8D A;  1KK7 A;  3RIR A;  2LZ6 B;  2MYS A;  3CCU T;  5FWC A;  3L2Q A;  4RTX A;  2LX7 A;  5LJ5 j;  1JBM A;  1YJN A;  2DL7 A;  3NFC A;  3VS2 A;  1VQN A;  1FMW A;  2RJD A;  4GLK A;  4HKE A;  3OS2 A;  4J9F A;  2JM8 A;  3HFN A;  2IVW A;  1JEG A;  1BCM A;  2ED1 A;  4BB7 A;  2KYB A;  2E70 A;  3QUI A;  1AWJ A;  1NBE B;  2E5K A;  1Q86 C;  2BUD A;  2DVE A;  1QVF A;  2DYB A;  1G3Y A;  2OI3 A;  4JRQ A;  1CKB A;  2P0P A;  5GMK h;  3FDR A;  4E7L A;  2B8A A;  4ORZ A;  5FLX E;  2DNU A;  1K0S A;  2JVV A;  1KD1 R;  1LNX A;  4J9I A;  5I11 A;  2KI7 A;  4PK4 A;  3PVQ A;  4E7K A;  1WHK A;  1QVG S;  1JRI A;  3A8O B;  2XI9 A;  2IG0 A;  4RCB A;  1OPL A;  3H0F A;  5IXF A;  4N4G A;  4KRT A;  1E7O A;  4FU6 A;  1QCN A;  4FYY B;  1EFN A;  2LQ8 A;  2KBT A;  2LC4 A;  3X28 B;  4XQ3 A;  1JJ2 S;  2JMA A;  3GLX A;  2W10 A;  1VA7 A;  1UHF A;  3R6O A;  3CME A;  5DY9 A;  2RK2 A;  1KQS P;  2O9V A;  1VIF A;  5IXB A;  3HHT B;  1GCQ A;  4M75 D;  2PVG B;  1X2K A;  5CQY A;  4J9H A;  5FWB A;  2HSP A;  2M0Y A;  2J6O A;  2JTF A;  1NLP C;  1ZSZ C;  4JPB W;  2X9H A;  1WQW A;  4M7A E;  3DB4 A;  1DJ7 B;  1U3O A;  2LCL A;  2LT4 A;  2RMO A;  2YLC A;  8AT1 B;  4D6W A;  4EIK A;  4O5V A;  4DBQ A;  5KE2 A;  4Q5W A;  1E6H A;  3I5R A;  2GTO A;  4XU1 A;  2A37 A;  1RAH B;  5CR2 A;  2XU8 A;  1VQL T;  3QYH B;  1WXT A;  2J05 A;  5A0G A;  4C5E A;  2O31 A;  3CPW A;  1VQK T;  3VJP A;  2X3W D;  4J83 A;  3CXC A;  1OX8 A;  3CBO A;  2KRS A;  3SFM A;  3M5A A;  1YNZ A;  4O6J A;  2LDM A;  4J6W A;  4J9G A;  1S72 Q;  3OYJ A;  1I4K 1;  2QDL A;  1BYM A;  3M59 A;  3CCS A;  2EYQ A;  4RTV A;  2L3S A;  1UJY A;  1KC8 U;  3HP9 A;  4A4G A;  1W4S A;  1UTI A;  4X9C A;  5D6Y A;  3TSW A;  2E5Q A;  3MP1 A;  3PNW C;  5GAM f;  1VQM Q;  1D0Y A;  3MPU B;  3CC2 A;  4LE9 A;  3R6N A;  4B6M A;  3JB9 F;  1TG0 A;  1AEY A;  5LJ5 g;  2EQM A;  2EYY A;  2JJ9 A;  5GMK l;  2QQB A;  3LH5 A;  1SHF A;  3FB9 A;  2DJZ A;  4A4E A;  3MP6 A;  4FM4 B;  4KT0 E;  2LP5 A;  3V7C A;  3JAM E;  1N8R C;  2ESW A;  4J9B A;  1M5Q 1;  1U06 A;  2LTO A;  2PNI A;  1BBZ A;  4ANJ A;  3V8K A;  4OB2 B;  5CAI A;  3RR6 A;  4FW2 A;  1AVZ C;  1VYT A;  1OOT A;  4PJO E;  4IIO A;  2GQI A;  1M3C A;  1NM7 A;  3HPW A;  3NTH A;  5FW9 A;  4QT7 A;  2CUB A;  1QWE A;  3RMQ A;  5KYX A;  2WSF E;  2EJG A;  1O9S A;  1QWF A;  4BAC A;  2I0N A;  2DVJ A;  3E9F A;  5KYX B;  1MMD A;  3GPL A;  4M7A F;  1YWO A;  2DO3 A;  1JU5 C;  1SHG A;  2DXC A;  1OZ2 A;  2ZPI B;  1FX7 A;  1N9S A;  1RI0 A;  3VUZ A;  2J6F A;  3TVT A;  2X4J A;  4M7A G;  3I5S A;  1M27 C;  3HRU A;  1VQN T;  2D0Q B;  1VQM T;  1PHT A;  4HCK A;  1OZ3 A;  1G83 A;  2VC8 A;  4C5I A;  1VQO Q;  2RB6 A;  3CC4 A;  5GAN 8;  4FSX A;  5LJ3 e;  1NZ9 A;  4K11 A;  4IUV A;  4BI8 B;  5GAO m;  1V1C A;  2QTX A;  2J6K A;  4JS4 A;  1WNL A;  2QQR A;  2MMP A;  2FPD A;  2CYZ B;  2L89 A;  1YHQ Q;  3VRZ A;  3H0H A;  3RES A;  1Q82 R;  3RKW A;  1QVP A;  1BKB A;  4RTZ A;  1W2B P;  4QVC A;  3CCM Q;  1NJI R;  3QZ5 B;  1TWB A;  4X9D A;  2KE9 A;  3LH0 A;  1N8R R;  2NWM A;  4X34 A;  4ZN3 A;  1RAE B;  3PTA A;  3CPF A;  2OTL A;  3OYI A;  3C95 A;  3JCM c;  2OAU A;  3M0U A;  2PQW A;  2C06 A;  1T0H A;  1Q7Y C;  4LDU A;  2XID A;  3CME T;  3PFS A;  2O01 E;  4X1V A;  4LDV A;  4PJO F;  1KHI A;  2F2X A;  4F7U E;  2YXY A;  4KUL A;  4QQG A;  3I9Q A;  1M90 U;  3CCQ Q;  3EG0 A;  2NUT A;  1M1K C;  1NLO C;  4JUV A;  3ZBD A;  1VQO T;  3V7R A;  4AFS C;  3CD6 A;  1K0X A;  3OB9 A;  2NUT B;  3PT9 A;  5GAN h;  3QG1 A;  2EW3 A;  1PRM C;  4KBM B;  2DAQ A;  3CMA A;  1GCQ C;  2LCS A;  4BI4 A;  2R5M A;  2KQW A;  5IHN A;  4IUR A;  2RHZ A;  2X51 A;  3CCE Q;  4M75 E;  1ARK A;  5GAM j;  3CCL A;  4JS5 A;  3G4S A;  1T0J A;  2XMF A;  1IGU A;  3KFV A;  2Z0W A;  5LJ5 e;  1VQ6 A;  3OBW A;  4ATO A;  3HKS A;  4A63 B;  5GAN g;  3TU4 K;  1YJ9 Q;  3CCS T;  1RUW A;  1W2B S;  2A3L A;  2KNB B;  1YI2 A;  2GCX A;  5KCO A;  2O2O A;  1MMG A;  4NL3 A;  1K9M U;  2V26 A;  8ATC B;  4C0D B;  1IRE B;  1K76 A;  2YUO A;  3CC2 T;  3EFO A;  2EFI A;  2O4X A;  3EFO B;  2HCK A;  3TSZ A;  3M56 A;  4PJO A;  2O4X B;  4QVD A;  2ENM A;  2DL5 A;  3OYM A;  2JUF A;  1AWO A;  5KYN A;  4PJO B;  1VIE A;  1JB0 E;  1ZA2 B;  3L2R A;  2K3Y A;  4R0K A;  5D7U A;  2KVQ G;  3OYN A;  2A36 A;  3M55 A;  4N4I A;  1G5V A;  3VU3 C;  4M4Z A;  4KGX B;  2YSQ A;  2E64 A;  1JXO A;  4KUD K;  2EWN A;  3QJ6 A;  1WXU A;  3H8Z A;  4F7U G;  1UGR B;  3FJP A;  2Y4X A;  2DLP A;  2LJ3 A;  2YUN A;  4E7I A;  3JV3 A;  4N4H A;  3L42 A;  2X3X D;  3H6Z A;  4AG1 C;  3F70 A;  1QCO A;  3WVD B;  4DBR A;  2LQK A;  3X25 B;  1XTD A;  1UE9 A;  3JCM Q;  3JCM f;  2KXC A; 
#chains in the Genus database with same CATH homology
 1G3Y A;  4M75 F;  3HRT A;  3M58 A;  2ZPG B;  2R5A A;  3FC3 A;  4JRQ A;  2E41 A;  4J6Y A;  3CCR T;  1Q81 C;  4C92 D;  1U1S A;  2FL7 A;  2P0P A;  5GMK h;  3G71 A;  3CCQ A;  3FDR A;  3MP8 A;  4E7L A;  2B8A A;  5GAO p;  4XTY A;  2K5F A;  2E10 A;  4OB3 B;  3ER0 A;  5AYF A;  1I8F A;  1XOV A;  2PVO B;  4EMK A;  5FLX E;  2OTJ A;  3VUB A;  1BI3 A;  3OSS C;  3CC4 T;  2MWO A;  3JB9 G;  2JVV A;  1Y7X A;  1LNX A;  3HFO A;  3X24 B;  1YJW T;  2F69 A;  2CZ0 B;  4EMK B;  3OW2 S;  4E7K A;  3JCM h;  2P0Q A;  4JRP A;  1QVG S;  2YRV A;  3M4G A;  4M77 A;  4ZN1 A;  1JRI A;  3A8O B;  3RMS A;  3S3M A;  2XI9 A;  2VV5 A;  2PUO B;  2IG0 A;  2QA4 A;  1KQS S;  5CVI A;  3CC7 A;  2KK4 A;  1Q86 U;  4RCB A;  3CBM A;  3QYG B;  1M9S A;  1NE8 A;  5FU6 B;  4R55 A;  5GAN 6;  1B34 A;  1R8O B;  2PU9 B;  3P8D A;  3HRS A;  3OYY A;  4M77 B;  4A4H A;  2M9U A;  4N4G A;  4QQ6 A;  4E47 A;  2MAM A;  3CCE A;  1Q81 U;  2HQX A;  2H3J A;  3E9G A;  4C8Q D;  5GAN j;  3LGF A;  4FU6 A;  1B34 B;  1BI2 A;  4M75 C;  3RUX A;  3I56 A;  3M4Y A;  2ZGW A;  1M4Z A;  3PMT A;  4PKC C;  3X20 B;  4A54 A;  3OYL A;  1WJS A;  2LQ8 A;  1BI1 A;  4B9X A;  1FXX A;  3M57 A;  3X26 B;  1Y96 A;  1KD1 C;  2LC4 A;  2ZZD A;  3X28 B;  4XQ3 A;  5CKD A;  2P0K A;  2RJC A;  2ZPB B;  1JJ2 S;  4JRK A;  3GLX A;  2VGM A;  4QQD A;  4MZM A;  1U8R A;  3MET A;  4BE1 A;  4OGC A;  1VQ7 A;  3I55 A;  3BW1 A;  3MCA B;  2HAX A;  2D9T A;  4FT2 A;  4FT4 A;  1Y96 B;  5GMK i;  3R6O A;  3CME A;  4FL6 A;  1VQ4 A;  3L2V A;  3QSU A;  3DKM A;  1KQ1 A;  1H64 1;  1S72 T;  4BDY A;  1YJ9 A;  5DY9 A;  2RK2 A;  2XDB A;  3JCM g;  2OTL T;  3JCM W;  4LD9 K;  4M78 A;  1IZ6 A;  3SD4 A;  2DD5 A;  1VIF A;  2L3R A;  2ZCF B;  3HHT B;  5LJ3 d;  2I2L A;  3G6E A;  4M75 D;  2PVG B;  1OI1 A;  5CQY A;  4C0Z A;  3DLM A;  3KBG A;  2KY9 A;  4QW2 A;  4NOY A;  3CCV A;  3JB9 D;  2GQV A;  4M78 B;  3S3N A;  5GAO q;  2VXF A;  2LT1 A;  3JRZ A;  3Q1J A;  3CCR A;  2JTF A;  1X01 A;  2KDS A;  2D6F A;  4GY5 A;  2EQU A;  2QEX A;  2ZPH B;  1NPP A;  1VQ9 T;  1WQW A;  5CKF A;  5IAY A;  3LYI A;  4OGE A;  5LJ5 f;  4M7D G;  1WJR A;  4OB0 B;  4M7A E;  2DZC A;  3BFM A;  3DB4 A;  3SB2 A;  1DJ7 B;  1N9R A;  2LRQ A;  2M1H A;  2LCL A;  2LT4 A;  2WSE E;  2X4X A;  2YLC A;  5GAN 4;  4D6W A;  4PLL A;  3LWH A;  2P4T A;  4O5V A;  4EMG A;  3P8B B;  5KE2 A;  2WAC A;  3JCM V;  4Q5W A;  3SWN C;  1KHC A;  2XK0 A;  2DTI A;  3JCM d;  5GAM d;  4M7D E;  2XHC A;  1KC8 C;  4XU1 A;  2Y90 A;  3JCM J;  4MDX A;  3TRE A;  5CR2 A;  4IKF A;  2XU8 A;  1VQL T;  3DLL A;  3OYE A;  3QYH B;  5GMK e;  4V2S A;  3P8H A;  2EQK A;  4F7U F;  5GAN e;  4BY6 C;  3CMA T;  3M54 A;  1OYX A;  2EAY A;  4C5E A;  5LJ3 f;  5A0G A;  3CPW A;  1VQK T;  3VJP A;  4XTX A;  4C8Q F;  4LDX A;  4J83 A;  4Y91 A;  3CXC A;  3A8H B;  2DTO A;  3CBO A;  3SFM A;  3M5A A;  4O6J A;  4ZGE B;  2JNG A;  4HCZ A;  5IN1 A;  4ZGJ B;  2LDM A;  4J6W A;  4M77 E;  4HT9 A;  1N6A A;  3CCL T;  5GAN 2;  2K2V A;  3C4S A;  2K3X A;  1I4K 1;  4ZGD B;  4KUI A;  3OYJ A;  3G4S T;  2AHJ B;  3M59 A;  1YIJ A;  1BYM A;  3CCS A;  3V8L A;  2V8I A;  3GP8 A;  2EYQ A;  2XKO C;  3OYA A;  2RHY A;  4JRI A;  2JZ2 A;  3RER A;  1EIF A;  5KE3 A;  1KC8 U;  1UGS B;  3HP9 A;  3QII A;  5LJ3 h;  4A4G A;  4BE2 A;  1W4S A;  3PMI A;  2FVU A;  1QVF S;  3V7S A;  1VQ5 T;  4X9C A;  5D6Y A;  2DD4 A;  2E5Q A;  3MP1 A;  3PNW C;  4J5Y A;  5GAM f;  4M7D D;  2QQA A;  1VUB A;  5DM7 R;  3CC2 A;  5CK9 A;  3V8J A;  5A2Q E;  5CO7 A;  3J7A F;  3JB9 F;  4DOW A;  4M78 G;  1YI2 T;  2RHI A;  5LJ5 g;  2EQM A;  2DKG A;  3GIB A;  5GMK l;  2QQB A;  4C8Q C;  5A0D A;  2FB7 A;  5KCH A;  2CZ7 B;  2DJZ A;  3FB9 A;  4A4E A;  2KMT A;  3MP6 A;  4FM4 B;  4KT0 E;  3QBY A;  3L2U A;  3QO3 A;  3V7C A;  3JAM E;  1N8R C;  4XU3 A;  2VUB A;  3DB3 A;  2RO0 A;  4RMO A;  4MDW A;  4PJO G;  5GAM h;  4M78 E;  4RCC A;  1FWZ A;  1V29 B;  1M5Q 1;  4QVZ A;  1VQP T;  3BDU A;  3URG A;  2LTO A;  3T9N A;  2R58 A;  3MO8 A;  4BY6 B;  4R56 A;  3JCM X;  4C92 A;  1M1G A;  3V8K A;  4OB2 B;  4CRI A;  3JCM b;  1Q82 U;  4N0A C;  4E7J A;  5CAI A;  4RG8 A;  4C0F A;  5LJ3 g;  5L8R E;  4PJO E;  5GMK j;  4NL2 A;  1WPY A;  1UEB A;  4C92 B;  2RHU A;  3FIF A;  1Q7Y U;  3C12 A;  3HPW A;  3MEV A;  3NTH A;  3QZ9 B;  3CCU A;  5GAO r;  4A4K A;  3MEW A;  4ELZ C;  5LJ5 d;  1NJI U;  1UGP B;  3ZFJ A;  3CCJ T;  4PLI A;  1ZQ1 A;  2E6Z A;  1YHQ T;  1YIT A;  3RMQ A;  5GMK m;  1YCY A;  2RJE A;  1N8R U;  2WSF E;  3HSB A;  4PJO C;  2EJG A;  4L59 A;  3FEO A;  2E6N A;  3JB9 J;  1O9S A;  2L5Q A;  3CEY A;  4OMF B;  5FU7 C;  2MF2 A;  4BAC A;  5GAO l;  4NS5 A;  1D3B A;  2K5L A;  2QQ9 A;  3E9F A;  2KSS A;  3EAE A;  4B9W A;  3CCM T;  4EDU A;  4F7U A;  3GPL A;  4M7A F;  1M8V A;  2DXB A;  2MWP A;  5IT9 E;  5J26 A;  2DO3 A;  2DXC A;  2RH2 A;  1D3B B;  3M9Q A;  4C8Q A;  5GAM g;  4WF2 A;  1OZ2 A;  2ZPI B;  3OYK A;  1FX7 A;  4F7U B;  1N9S A;  1RI0 A;  4C0G A;  2BIV A;  3VUZ A;  1WQ7 A;  1U1T A;  2X4J A;  4L6V 5;  4RG2 A;  4RKU E;  4A53 A;  3OA6 A;  4M7A G;  2LCC A;  4ZTF A;  4M7D F;  3ASK A;  3HRU A;  4C8Q B;  3E1S A;  3MEA A;  2D0Q B;  4OB1 B;  3OYG A;  1Y07 A;  1VQN T;  3OS5 A;  4P5N A;  1K73 C;  1VQM T;  4LDY A;  1LJO A;  3LWI A;  4PJO D;  4XTU A;  1JJ2 A;  1QP2 A;  1OZ3 A;  4OVA A;  2RM4 A;  2A7Y A;  5GAN 7;  2VC8 A;  4C5I A;  2DPP B;  2RB6 A;  1XNI A;  2F5T X;  3OBY A;  2YHT A;  5FRO A;  4C5H A;  4MZT A;  1W2B A;  1PSE A;  1UGQ B;  3CC4 A;  5GAN 8;  3J80 E;  3GNG A;  4FSX A;  5CIU A;  4JLI A;  2RI3 A;  5LJ3 e;  1YJW A;  3LW5 E;  2CZ6 B;  1NPR A;  1NZ9 A;  5EG2 A;  2R57 A;  4IUV A;  1G3W A;  5CKH A;  4BI8 B;  5GAN 5;  5GAO m;  3E19 A;  2E12 A;  3QXE B;  4M75 A;  3CD6 T;  3JSC A;  2QTX A;  3LGL A;  4M77 F;  3A8L B;  1BIA A;  1VQP A;  4J7I A;  1GXI E;  4M7A C;  3G71 T;  3LLR A;  3CCQ T;  3QPH A;  5HK0 A;  1LOJ A;  3EFR A;  2PUK B;  2DTH A;  1N27 A;  4EPC A;  3CPW S;  4JS4 A;  4II1 A;  1WNL A;  2LVM A;  3NTK A;  2G3R A;  4M75 B;  3KUF A;  4JDS A;  3CXC S;  2QQR A;  3OS0 A;  2HQE A;  2MMP A;  4M77 G;  3L2W A;  2L89 A;  2CYZ B;  5LJ5 h;  3MHX A;  5GAN d;  2OTJ T;  2E1H A;  4MZP A;  3RES A;  1BIB A;  4DA4 A;  1K73 U;  4M7D C;  4A4F A;  3JB9 I;  4C92 G;  3RKW A;  1QVP A;  5DLQ E;  4DQ2 A;  3OYD A;  1BKB A;  4OF1 A;  4QVC A;  2RJF A;  2VXE A;  3VYG A;  3RKX A;  5HY6 A;  2GFA A;  5GAM e;  3JCM e;  2QA4 T;  3CC7 T;  2RI5 A;  3O8V A;  3QZ5 B;  4X9D A;  4EMK C;  1QP3 A;  2GFU A;  3CBP A;  1HXD A;  1WJQ A;  2NLU A;  2RI2 A;  1M90 C;  2VYT A;  3LH0 A;  4C92 E;  4M7A D;  4X34 A;  2DK3 A;  4ZN3 A;  3PTA A;  3CCE T;  3TCJ A;  3CPF A;  1O75 A;  4XTZ A;  5C6S A;  5FU6 C;  3I56 T;  1S72 A;  1VQ6 T;  2DIG A;  2F5K A;  3GNF B;  4IUT A;  2QXF A;  4M77 C;  4E7H A;  2DIQ A;  2RA2 A;  2OTL A;  3OYI A;  3UT1 A;  4XAX B;  5C0M A;  4M78 F;  3J81 E;  3C95 A;  3JCM c;  4L5G A;  2OAU A;  1Q82 C;  2PQW A;  2XG8 D;  3INZ A;  2E65 A;  3OYB A;  4ME7 A;  2C06 A;  1VQ7 T;  5HKC A;  3I55 T;  2EJF A;  1Q7Y C;  2ZPE B;  3SWN A;  3G7Z A;  4LDU A;  2XID A;  5GAN f;  3CME T;  3FLG A;  3PFS A;  1VQM A;  1NJI C;  3QHS A;  3QJY A;  1VQ4 T;  4YTL A;  2O01 E;  4PJO F;  4LDV A;  1VQ9 A;  2CZ1 B;  1KHI A;  3A8M B;  1YJ9 T;  1UB4 A;  5M9O A;  2X4W A;  4F7U E;  4PL6 A;  3SWN B;  4KUL A;  2HD0 A;  2YLB A;  1G3T A;  3NTI A;  4QQG A;  4BD3 A;  1M90 U;  1VQ8 T;  2GF7 A;  2XIC A;  2V8J A;  3G6E T;  3OSV A;  1M1K C;  4JUV A;  3LX7 A;  3ZBD A;  2MI6 A;  1VQO T;  4M77 D;  4HCC A;  5LJ3 j;  5KH6 A;  3V7R A;  4M7D A;  3CCV T;  2LX9 A;  4TVR A;  4C5G A;  3CD6 A;  2HBP A;  3OB9 A;  5FRN A;  4C0D C;  1H3Z A;  4J8O A;  2QEX T;  3PT9 A;  5GAN h;  5I2S A;  1KG1 A;  3BDL A;  4LDW A;  2CGH A;  4M7D B;  5CKB A;  3QG1 A;  1VQL A;  4M75 G;  4M78 C;  4KBM B;  2DAQ A;  4XTV A;  3CMA A;  3JCM P;  4BUG A;  1K8A C;  4PNO A;  4BI4 A;  2KAF A;  2R5M A;  1VQK A;  2KQW A;  4XTW A;  3PGG A;  5GAO n;  2JN0 A;  2M0O A;  3JCM f;  2FHD A;  2K5I A;  5DLO A;  3VV0 A;  4IUR A;  5J39 A;  3L1A A;  4JLG A;  2RHZ A;  3EFS A;  4MML A;  2BKD N;  3PIP A;  3OYH A;  4M75 E;  3SDZ A;  4CI0 C;  3A8G B;  3OW2 A;  4ZTJ A;  1K9M C;  3HL8 A;  3BY7 A;  1QVG A;  2DXU A;  3WXM B;  5GAM j;  4LD6 A;  1M1K U;  3CCL A;  4JS5 A;  3G4S A;  1I5L A;  1Y71 A;  2K57 A;  3UDC A;  1XQH A;  1KQS A;  5CKE A;  5I2M A;  5D6W A;  1VQ6 A;  2V8K A;  5LJ5 e;  1TH7 A;  1ZBX A;  4M78 D;  1P92 A;  1VQ5 A;  5HK3 A;  2RK1 A;  3OBW A;  4Y28 E;  1YJN T;  4ATO A;  3UWN A;  4XK8 E;  2K4Y A;  2DZ9 A;  4ELY C;  1K8A U;  1YBY A;  3HKS A;  5GAN g;  4BDZ A;  3TU4 K;  1YIJ T;  2JOY A;  2M16 A;  3CCS T;  4BE0 A;  4DOV A;  3OS1 A;  4OP0 A;  5LL6 S;  1W2B S;  2A3L A;  1YI2 A;  1MGQ A;  3QDR B;  3VYH B;  2GCX A;  5KCO A;  5A0L A;  2L8D A;  3AHU A;  4IUQ A;  4NL3 A;  1K9M U;  4N0A A;  3JB9 H;  1I81 A;  5CCA A;  1VQ8 A;  2PVD B;  1MHN A;  1IRE B;  4C0D B;  3QKJ A;  3WVE B;  4J7F A;  1BI0 A;  1X6O A;  3KXT A;  3CC2 T;  1VQO A;  2EFI A;  1X75 C;  2O4X A;  4IUP A;  3M53 A;  5I21 A;  4JJN K;  1G3S A;  2DEQ A;  3N5B B;  4J6X A;  2X4Y A;  4C92 F;  2QQS A;  1KD1 U;  4Z02 A;  4PJO A;  3M56 A;  3S3O A;  2EKO A;  2O4X B;  3ME9 A;  5CQX A;  3MEU A;  2CS7 A;  4EMH A;  4QVD A;  2RD1 A;  3FRN A;  2Y4Y A;  3OQ5 A;  2EQJ A;  2RHX A;  1HK9 A;  3UPU A;  2WSC E;  4BI3 A;  2JUF A;  3OYM A;  4PJO B;  5D6X A;  1VIE A;  1ZHI A;  1JB0 E;  2LNV A;  3GOX A;  1WGS A;  2ZPF B;  5FU7 B;  5FRM A;  3C94 A;  3L2R A;  3CCJ A;  1YHQ A;  1KQ2 A;  2K3Y A;  2QDY B;  2VGN A;  3GF5 A;  2KVQ G;  4VUB A;  3OYF A;  4IUU A;  2XD0 A;  2X35 A;  3OYN A;  3RKY A;  3M55 A;  4XU0 A;  4N4I A;  1SSF A;  1G5V A;  4HA8 A;  3ZEH A;  3VKI A;  3TEE A;  3VU3 C;  2DXT A;  3CCM A;  3A5Z B;  4HCB A;  3PIO A;  2E64 A;  3RIR A;  3CCU T;  4HT8 A;  1RL2 A;  4FIB A;  4XU2 A;  4KUD K;  2EWN A;  3L2Q A;  3QJ6 A;  5LJ5 j;  1YIT T;  3H8Z A;  1JBM A;  4F7U G;  4C92 C;  1YJN A;  5GAN 3;  3OY9 A;  1UGR B;  4UC4 A;  2XDP A;  3NFC A;  3FJP A;  2Y4X A;  2EJ9 A;  3OMG A;  4C8Q G;  1VQN A;  2RJD A;  4GLK A;  4HKE A;  3OS2 A;  4E7I A;  3HFN A;  1M1F A;  4N4H A;  2HNI A;  3L42 A;  2IVW A;  3H6Z A;  1AHJ B;  2XDD A;  4M7A A;  2JTM A;  3S6W A;  1QW1 A;  3OMC A;  3F70 A;  2QI2 A;  3WVD B;  4BB7 A;  1PSF A;  3L2Z A;  2E70 A;  3QUI A;  5J3B A;  2CKK A;  2EIF A;  4MMK A;  2LQK A;  4M7A B;  1Q86 C;  3X25 B;  4C8Q E;  1XTD A;  3JCM Q;  3OYC A;  2BUD A;  2DVE A;  2FYK A;  1QVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...