2JOYA

Nmr structure of 50s ribosomal protein l14e from sulfolobus solfataricus: northeast structural genomics consortium target ssr105
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
96
structure length
96
Chain Sequence
b'MPAIEVGRICVKVKGREAGSKCVIVDIIDDNFVLVTGPKDITGVKRRRVNILHLEPTDKKIDIQKGASDEEVKKKLEESNLTEYMKEKIKIRMPTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L14e
publication title NMR Structure of 50S Ribosomal Protein L14e; Northeast Structural Genomics Consortium Target SSR105
rcsb
source organism Sulfolobus solfataricus
molecule tags Structural genomics, unknown function
total genus 18
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2joyA01
5J3BA 4YTLA 3CCLT 3J7AF 3J80E 2QEXA 3CCUT 4CRIA 1NJIU 2OTLT 3G6EA 1YI2A 1KQSA 1VQPA 3PIOA 1NJIC 2KDSA 2XHCA 2KVQG 1M90U 3CCSA 1K9MU 3I56T 1KD1U 1M90C 1VQ7A 3KBGA 1K9MC 1VQLT 1KD1C 2DO3A 3CXCA 1K8AU 3G71T 2E6ZA 1YJ9T 1VQ8A 1NPPA 1K8AC 4TVRA 1YIJA 1NZ9A 1VQ9T 4X34A 1KQSS 3CCRT 1VQNA 1KHIA 1VQ5A 3CCQT 3CMEA 2JOYA 1W2BA 3CCJT 1XTDA 3CC2T 1SSFA 2L3RA 1QVFA 1Q86U 1YITA 3CXCS 3TREA 3DLLA 3G6ET 1YI2T 1Q86C 3CC4A 1VQPT 2JVVA 3CCMA 2LQ8A 3LH0A 3HKSA 5DLQE 3CD6A 2QA4A 5IT9E 1M1GA 1W2BS 1VQ7T 1VQ6A 5IAYA 1VQOA 1XNIA 1QVFS 1VQMT 1YHQA 1YJWT 2EIFA 3CPFA 3I55A 1YIJT 1S72A 1VQNT 1YJNT 1NPRA 1VQ5T 1M1KU 1UEBA 3CMET 1X6OA 2MWOA 3PIPA 3CCEA 1M1KC 2OTJA 1QVGA 3OYYA 1Q81U 3CMAA 2QEXT 2CKKA 1IZ6A 1YITT 1Q81C 1VQ4A 2MWPA 3CC4T 3LGLA 4RG2A 3G4SA 1JJ2A 2JNGA 3CCMT 1K73U 1YBYA 3CD6T 3CCVA 4ZN1A 3A5ZB 1K73C 5J26A 3CCST 3CC7A 1QVGS 1VQ6T 1YJ9A 1VQOT 1VQKA 3CPWA 1VQ9A 1VQ8T 3I55T 1Q7YU 3LGFA 1S72T 1Q82U 3DB3A 2E70A 1Q7YC 1KC8U 1JJ2S 3CCLA 1Q82C 5A2QE 1KC8C 3CCJA 3CCET 2G3RA 5HY6A 3CC2A 2OTJT 3CCUA 2MI6A 3CMAT 2IG0A 2OTLA 1VQ4T 2LCLA 3CPWS 3DB4A 3JAME 3P8BB 3OW2A 5FLXE 3G4ST 1N8RU 4ZN3A 1N8RC 3I56A 3CCVT 2QA4T 3CC7T 2LVMA 1VQLA 3J81E 1RL2A 1VQMA 3G71A 1YJWA 1VQKT 5DM7R 1BKBA 3ER0A 4QQDA 1YJNA 5LL6S 1EIFA 3CCRA 1YHQT 3OW2S 3CCQA 2JUFA
chains in the Genus database with same CATH superfamily
4UC4A 2DTIA 1OU9A 1D1AA 1IHVA 2CUDA 2FO0A 3M4GA 3EFOB 4QKUA 1IGUA 3JCMX 2OTLT 1MUZA 2CZ1B 4D8KA 2K9GA 1K9MU 1D0YA 1M9SA 1FYNA 4VUBA 5LJ5g 4FYYB 2FZKB 3V8JA 2JXBA 3P8DA 1VQNA 2X4YA 4OMNA 2AKLA 2DERA 2EGCA 4J7IA 1MNDA 1VQ4Q 2LDMA 4FYVB 1M3AA 4PJOB 5A0GA 1Z9ZA 1H3HA 1VA7A 1XNIA 5IXBA 2DTOA 1YJWT 2JT4A 1RABB 2X51A 4DBFA 4F7UA 3CC2Q 2KYBA 3SDZA 2ROLA 3CCUQ 3CQTA 3OYYA 4QVDA 3JCMW 1N8RR 4ME7A 4PJOF 3SHWA 1YITT 4M75B 1JJ2A 2RQUA 2KI7A 2KSSA 3C12A 4KGZB 2BTTA 3S3MA 1HJDA 4ZNXA 5LJ5f 1JO8A 1PNJA 3EHQA 4C8QA 3ME9A 1PSFA 1BIAA 2P4RA 2PVOB 5HK3A 2KAFA 4M7DG 4M77A 4OMFB 1AOJA 2QQBA 1MMAA 2RNAA 2CGHA 3DB4A 1U06A 1YFNA 3H41A 4PL6A 3PVLA 4FYXB 1NM7A 1PD1A 1IB8A 1N8RC 1GBRA 2RN8A 1AWWA 2L0AA 4JZ3A 2CDTA 3VS0A 3X28B 3KUFA 1PM3A 2JTFA 5CCAA 2JZ2A 2A28A 2QG9B 1RAFB 4FU6A 1WDXA 2YUNA 1LVKA 3G6EA 1YI2A 1RAGB 2WACA 2I0NA 2VYTA 1R8OB 1PC0A 1KD1U 4AFUC 1VQLT 1KIKA 4MMKA 1KQ2A 1Z9QA 1VQ9T 1KQSS 1OEBA 1U1TA 3CCQT 3JV3A 3EGXB 4CC7A 2LQNA 2K5FA 4E7KA 3RR6A 3TREA 2RI3A 2HMAA 3HHTB 3CCMA 2VVKA 1OQKA 1MMNA 1SSHA 4M7DE 1M8MA 1VQ6A 1KC8R 2DEUA 3SWNB 1KK7A 1ZSZB 2RK1A 1QVFS 5GAOr 2RQTA 3LWIA 1BI3A 2K5LA 1VQ5T 2FPEA 2GTOA 1H92A 1D0XA 3RMQA 5HKCA 2CKKA 2OI3A 4Z8AA 4J6XA 3EGDA 1K73U 4FSXA 2P4TA 4HCBA 4QVZA 1XJWB 2A0FB 3JB9H 1MMDA 2E10A 1NE8A 5GAMd 1I81A 1OX8A 4M78C 1D1BA 1KC8C 1QVGP 2EPDA 1WNLA 2PNIA 4LD6A 1FX7A 2OTLA 3C95A 4J9EA 2FL7A 3CCSQ 2ZZDA 3OMGA 1YWPA 1ZUUA 2QK0A 5CIUA 5LJ5h 2DD4A 2V8JA 1G2BA 1B34A 4EPCA 1G8XA 3J80E 2HAXA 2E64A 2XU8A 4N0AA 3PIOA 1U8RA 1UGQB 1WXBA 1JU5C 1GRIA 4QT7A 4DOVA 4IUPA 4M7DB 2HBPA 2A7YA 2BKDN 1MHNA 3LYIA 4FYWB 1RLPC 1PG5B 1GCPA 3VS5A 1YITA 3O5ZA 4ELZC 2DILA 5C6SA 1ACMB 3VYGA 2FVUA 2YUPA 4JUVA 2OX7A 4M7DF 1OPKA 1ZBXA 3BDUA 1JRIA 1P92A 2YWWA 2BZXA 2J6KA 1OX9A 3ZEHA 4C92A 3H9NA 4E47A 3R6NA 3X25B 2YHTA 4M75D 1OOTA 2W10A 2RJCA 1M3CA 5GMKm 5D6XA 1YJ9A 1WPYA 1VQOT 3MEWA 2GQVA 5KYUA 4JJBA 4IIMA 4BE2A 5I11A 3G1JA 1E7OA 3FLGA 1M2OA 3RERA 3M9QA 1NLOC 4JLIA 2OTJT 3OYKA 2COZA 2XDDA 3RNJA 1SHGA 2AK5A 1M90R 1VQ4T 2DK3A 1N8RU 2XDPA 3L42A 1AZGB 3HFOA 1VQLA 1MMGA 2DYBA 1XQHA 1VQMA 4FCYA 2D0NA 3FEOA 3MEAA 4IIOA 1ZX6A 3CCQA 3MCAB 4HVUA 1QCNA 2X3XD 3J7AF 2CYZB 2CS7A 1QCOA 1BCMA 3CCUT 1BB9A 5CR2A 3OYAA 3HRSA 3QWXX 4BI4A 2VGMA 3I56T 4N4IA 1M90C 4QQ6A 4EMKB 2H3JA 4AMCA 1Y96B 1SKUB 1VQ5A 1IHWA 3NGPA 2A36A 1GFCA 1QVFP 3I35A 1VOMA 3CCJT 4AT1B 2NUPA 3PNWC 1YN8A 5KE3A 4OP0A 2M1HA 3DLLA 1UJYA 2K3BA 3VJPA 1LNXA 1YCYA 5IHKA 2HKNA 1QCFA 4FIBA 4PKCC 2LT1A 2NYSA 4XAXB 2VGNA 1PKSA 1Y0MA 2XD0A 2O9VA 2DBMA 2EJ9A 1PHTA 3OYFA 3LLRA 3JCMb 5DY9A 4PJNA 1QVGA 2D1XA 4C8QD 2ZGWA 4E7HA 1SPKA 2L8DA 2E4HA 2NUZA 2JS2A 3NFCA 5IHNA 4M77D 3TCJA 4ZN1A 3G71Q 2KRSA 2PUKB 3CCRQ 1R77A 5D7UA 5CO7A 1ZHIA 2C0TA 2E70A 2HSEB 5GMKh 1KC8U 2XI9A 1NJIR 3CCET 3JCMf 2NUTA 1A0NB 5CKEA 3V8KA 1OZ2A 4PK4A 1WFWA 1D3BA 3CPWS 1PD0A 4PFZA 4BY6C 4KRTA 3OYJA 5KE2A 1S72Q 4LDUA 3I5SA 1E6GA 1WIEA 2E3HA 4QQDA 5LL6S 2JJ9A 3CBOA 2CP2A 3QUIA 3UATA 2LTOA 2EVRA 3EAEA 3HFNA 1OU8A 4CRIA 3CC4Q 1NJIC 4CC4B 1I0CA 1BU1A 5A0LA 2DIQA 1NPPA 4BI3A 2KY9A 3TEEA 3P8HA 2J6FA 4E7IA 2RHIA 2EFIA 3NMZC 2LNVA 4E7SA 1IRXA 2PU9B 3OA6A 3E9GA 3JCMQ 2JVVA 2GBQA 2QQRA 2O4XB 1M1GA 5CQYA 1W2BS 1G3YA 1VQOA 4M75G 4F16A 1QWEA 5FU6C 1UEBA 1ZUKA 2OAWA 1M4ZA 2OTJA 1FMVA 3QKJA 1OULA 4C92C 1VQ4A 2L3SA 2MF2A 4A4GA 1TWBA 2JNGA 4J9CA 3S6WA 5KCHA 4DBRA 1YIJQ 3JCMV 4B9WA 2RA2A 3MO8A 1VYVA 3H8ZA 3QBYA 4M7AE 1KFZA 1FXXA 4XU2A 4BE1A 1T3LA 4C5HA 1N27A 1FMKA 3CC2A 4C0DB 4FW1A 3SEMA 3CCUA 4JRKA 2IG0A 4OGCA 3P8BB 4LDWA 1CKBA 1WZOA 4AFQC 3I56A 5KCOA 3CCVT 3UPUA 2DX1A 2LVMA 2PVDB 4DBQA 1G3TA 1Y07A 1RL2A 2LP5A 2RHUA 2HBWA 1UECA 4AFSC 4OB2B 4PJOA 4ZTJA 3CMEQ 5AT1B 3GF5A 1T0HA 2L89A 4M78A 4A54A 1KSWA 2IPOB 5GAMg 8ATCB 2FG0A 1M27C 2KXDA 3JCMh 1U3OA 2XDBA 3A98A 4M75E 4BDYA 2MOXA 1UGSB 2QA4Q 3CC7Q 4ANJA 1W1FA 1M90U 4RUGA 3UT1A 2QDLA 1VQKQ 1K9AA 3OS2A 4TVRA 1OPLA 1R0BG 4AFZC 1WQWA 3EG3A 1AEYA 2LJ1A 1SSFA 2F69A 4LDXA 1U1SA 8AT1B 4ESRA 5DLQE 1SG5A 2LRQA 2Z0WA 4CI0C 5EC7A 1PWTA 5KH6A 4C8QG 2FRWA 3CXCP 1Q82R 4C0ZA 5IAYA 3HTRA 2K57A 4N4HA 3QIIA 1QP2A 2W0ZA 3OB9A 2DE0X 1ZLMA 1PKTA 4M77G 1D1CA 4M7AB 3CCEA 4LE9A 5GAMf 2RJFA 4MZPA 2B8AA 3FC3A 1T0JA 4RTYA 4BI8B 2EKHA 3OYCA 2QYZA 1BCOA 1YBYA 3V8LA 4QQGA 3BE3A 1K0SA 3CPWP 1AVZC 4P5NA 3VUBA 5LJ3g 1VYUA 3TSZA 4M7AF 2D8JA 1NBEB 3A8LB 2YRCA 1Q82C 2GTJA 2DF6A 4K11A 3JB9I 3M58A 2E5KA 4C0FA 1I5OB 2RF0A 5FU7B 5GANe 2DXUA 4F04B 1UUEA 3V7RA 1EZZB 2L3QA 3OS1A 4RG8A 3MP8A 1VQ8Q 3I55Q 2RK2A 4Q5WA 2CUBA 4C5EA 1EIFA 5KYYA 3FRNA 2XG8D 1BI2A 3OS5A 2YXYA 2FYKA 3FJ5A 1V1CA 2R5MA 4J9IA 4A53A 1UHFA 4C8QE 2I2LA 4M75F 1NJIU 3OW2P 2EQUA 1UGVA 1WHLA 4M77E 3CCSA 1TUGB 1WXUA 2KRMA 1WHKA 2ABLA 3NTKA 1WYXA 1YHQQ 2DO3A 1QKXA 5LJ3f 3EG9B 3G71T 1YJ9T 3META 3MHXA 1X6GA 3FDRA 3KFVA 3CCRT 1KHIA 1Q81R 2R57A 4ZGEB 2E5QA 1QVPA 3A8OB 4J5YA 4KULA 2EGAA 1XTDA 2L3RA 1WHJA 2DBKA 3VS2A 4RTWA 4L59A 3EH2A 2CP6A 4KH0B 5C0MA 2KT1A 1N9RA 4KUDK 2EWNA 2J7IA 3NHNA 1VQMT 5GAN5 3BDLA 4PJMA 3L2VA 2HL5C 2B86A 1UJ0A 1ZA1B 3L2WA 2MWOA 3GOXA 1X75C 4J9GA 4HA8A 5IH2A 1IZ6A 1Q81C 4FT2A 1WX6A 4FM4B 1N6AA 3CC4T 4IURA 3OYBA 2E12A 3QHSA 3CCVA 3WVEB 4PNOA 3M59A 1AWXA 4D6WA 3C94A 3F70A 1TS9A 2DFUA 2ZPGB 2MAMA 2K6DA 2DTHA 4BDZA 4M7DA 5GAMh 4HCCA 3M5AA 2CZ0B 2F2VA 3E2UA 3OY9A 1HYOA 4C8QB 3JCMP 1I07A 1NLPC 5IHIA 4A4HA 4M77B 4PJOC 3DKMA 3RIRA 1Q86R 3OQ5A 4C8QF 5GAN3 2GGRA 2J05A 4M77F 3SB2A 1BK2A 4EMGA 3H6ZA 4OVAA 3ZFJA 4C5GA 3E9FA 3CXCA 4M75C 4ZGDB 2DJZA 1WI7A 3QPHA 4OB1B 2DAQA 1TH7A 2R5AA 2KROA 1HK9A 1PCXA 3HSBA 3CMAQ 2Y90A 2HEQA 2CSQA 2CZ6B 2ENMA 1Q86C 2ZPIB 3PT9A 4XU1A 3TVTA 2D8HA 3ZL7C 3OYGA 4R56A 5LJ3h 1AZEA 4LUDA 5AYFA 3CMET 4M7AD 3MEUA 1QW1A 2DZ9A 2YT6A 2RQVA 2QQ9A 3GIBA 3G6EQ 1YI2Q 2QTVA 2AIRB 2DYIA 2QGFB 5LJ3d 2DNUA 3EG0A 5GANj 1TUDA 4J9HA 1YNZA 1K4US 4JLGA 3A8GB 2K4YA 2SEMA 1YJNQ 5FWCA 1Y57A 3OYMA 2DL7A 1HD3A 1Q82U 1JJ2S 2X4XA 3EGDB 1ZSGA 4EMKA 3M57A 2QEXQ 3H0IA 1RADB 2RD1A 4DBHA 4O5VA 4NS5A 1IO6A 3CCMQ 2X4WA 4M78D 2HZYA 4JS5A 3OW2A 4BACA 2YRVA 3QZ5B 2G6FX 2MK5A 2KE9A 2DXCA 3G71A 3NTIA 2H3EB 3UWNA 3CCRA 2ZPEB 2V26A 3VU3C 5KYWB 4QW2A 3N5BB 3O8VA 4OMPA 1W70A 2F1LA 3SWNC 1ZSZC 3VKIA 1PSEA 5GANg 1C1AA 3FB9A 3PFSA 1G5VA 2EQJA 1B34B 3REAB 3RKWA 2BIVA 1UGPB 4OB3B 3E1SA 4HT8A 2V8IA 4LDVA 2ATCB 3QSUA 2JN0A 1QP3A 2Y4YA 1WJSA 4DOWA 1TTHB 5CK9A 3CC2T 4AG1C 1KQSP 2E3IA 3CC4A 1KHCA 1PRMC 3SD4A 1KQ1A 1BI1A 2QASA 1Q7YR 4BE0A 3FIFA 1GXIE 1SF9A 5I2MA 2C0IA 3M53A 1TUCA 3CCLQ 3KXTA 1NPRA 2QGGA 3GNGA 3L2UA 2CREA 3PIPA 2BZ8A 3C0CA 4OMLA 2CP7A 2O01E 1Q81U 1VIEA 4LD9K 5CQXA 2ECZA 3TU4K 4KT0E 1B07A 4C5IA 1YJWQ 5LJ5e 5GMKl 2DMOA 3T9NA 1YWOA 2O88A 1HXDA 2CP0A 3LGFA 2AZVA 2XMFA 2E6NA 1Q7YC 1H3ZA 1YITQ 2JMAA 5EG2A 2DPPB 5D6WA 4M7DC 1W6XA 2RHYA 2M16A 5KYUB 3QXEB 2KK4A 2FB7A 2X9HA 3THKA 2HCKA 1VQ7Q 3IQLA 2JM9A 3OSVA 1LCKA 1X2KA 2PQWA 4D8DA 1KJWA 4KUIA 2JUFA 1BBZA 2IIMA 2KXCA 4A63B 3RUXA 2ESWA 3BY7A 4XTVA 2JTMA 2LCCA 1WA7A 4IUUA 1FMWA 4DEYA 4OF1A 2K7AA 4XU3A 2SRCA 2EJGA 5GAOm 1SRMA 4NL3A 5KYXA 3HL8A 3GNFB 3CMEA 1E6HA 1MGQA 2DL5A 1ABQA 3QJ6A 4Y91A 1Q86U 3OYIA 4M7AG 2CSIA 3LH0A 1VQLQ 2RJDA 1WGSA 3INZA 2QA4A 2RHXA 4RTUA 2ZAEA 1VQ9Q 4Y92A 2NUPB 2EYYA 1G83A 5GAOq 1IGQA 2JMCA 2LX7A 3TQ7P 4JRQA 4R0KA 4RTTA 1JJ2P 2MWPA 3FJPA 2D0QB 3M56A 4E6RA 2AKKA 3OSSC 3CCST 2NLUA 3WXMB 5FRNA 4M78G 1VQ5Q 2CP5A 2RI2A 4PJLA 2FHDA 3MP6A 4RTXA 4EMKC 3VRZA 2VASA 3VS3A 3OBWA 3OYHA 3CMAT 3M54A 1M2VA 1VQPQ 4LDYA 2VWFA 4OMOA 1WHGA 5FLXE 2F2XA 2MIOA 1RAHB 2MCNA 4EMHA 4MZTA 1UHCA 3M0TA 3EFOA 4J83A 1M3BA 3J81E 3QDRB 2NUTB 2QQAA 2DRKA 1BKBA 1K76A 4EDUA 1BYMA 1D3BB 2BZYA 4YTLA 4KBMB 4PFPA 5GANd 2LC4A 2EW3A 3NPFA 1MV3A 3A8MB 2DM1A 2VB6A 1KQSA 2YRDA 5I22A 3HP9A 1V29B 2KYMA 1WJRA 4JPBW 4JRPA 3A8HB 4ZTFA 1UTIA 4ATOA 1VQ8A 2EJFA 3PE0A 2QDYB 1QVFA 5CAIA 1NEGA 2KNBB 4M78E 2IVWA 4XU0A 4IKFA 3HKSA 2RQWA 2V1RA 2K3XA 1CKAA 2MMPA 3QDFA 3PMIA 1YHQA 2DJQA 1I8FA 5GMKe 2RH2A 4M75A 4F7UG 5LJ5j 2DLPA 1X6OA 3QWYA 2COYA 2RB6A 1VIFA 4ORZA 4JS4A 4A4KA 2DL4A 4ZGJB 3QG1A 1SHFA 4Z89A 3JCMJ 2O31A 2VXEA 1D0ZA 2GQIA 2C06A 2X3WD 1HSQA 2HDAA 5J26A 3X24B 4LN2A 1QMCA 1QVGS 3EFSA 2VKNA 4C92D 5FROA 4PFOA 2P84A 3V7SA 1Q7YU 4KGXB 1NYFA 2WSEE 5CKBA 3EG9A 2GNCA 2DKGA 4NOYA 1V76A 2OJ2A 4X9CA 4ZN3A 2M0YA 2O9SA 1VQOQ 1BI0A 3OYEA 2ZCFB 3VS7A 3VV0A 2BE7D 2M0OA 2FRYA 2VUBA 3C4SA 2FPDA 3ER0A 3QYHB 1GL5A 2OTJQ 7AT1B 3CCLT 2EQIA 3PTAA 2MPXC 3LW5E 2EYQA 4OMQA 2A37A 4F7UE 3CD6Q 4M78B 1RAIB 3EGXA 1X6BA 4J9BA 4J9FA 3UDCA 1EFNA 4MDXA 3M0UA 1GFDA 4A4EA 3BFMA 2E1HA 1RACB 2E6ZA 1GCQC 2LT4A 1VYTA 3DLMA 1AT1B 4X34A 2EYWA 4HCZA 2CT3A 1ABOA 1I1JA 2L3PA 3SWNA 1ZSZA 2E41A 2BE9B 2Y4XA 3CBPA 4X9DA 4M78F 4HT9A 3HPWA 3G4SQ 3WVDB 3U23A 3I56Q 4RTVA 1Q95G 3SFMA 3JRZA 3M0QA 4II1A 1FWZA 2LX9A 4C0DC 3RDVA 1M1FA 3VS4A 1VQ7T 1IREB 4BB7A 1NG2A 2LJ0A 2YLBA 2XICA 2EGEA 3CCJQ 2VXFA 2RQRA 3NTHA 1W2BP 3LX7A 2DEQA 3MKDA 3CMAA 4XTZA 2AHJB 3PMTA 5I2SA 3JB9J 3LGLA 6AT1B 3URGA 3EGUA 2XKOC 4DQ2A 3V7CA 2XK0A 1UB4A 2P0PA 5KYNA 2ED0A 1S72T 3DB3A 4J7FA 1TXQA 2QAZA 2X4JA 1JB0E 1OI1A 5HY6A 1OYXA 2CT4A 3JCMe 2MI6A 5GAN4 2DETA 2PZ1A 2CH4W 3RKXA 3X20B 1LOJA 1K8AR 2X35A 1RI0A 4F7UB 4R55A 4B6MA 1YCSB 4RKUE 2KGTA 3L1AA 2AT1B 1VQNQ 1YJNA 3VS1A 2M9UA 3CCEQ 2COWA 2D9TA 2RPNA 1VUBA 3JSCA 4FT4A 3Q1JA 2QEXA 2RJEA 2RI5A 5GAN7 4L6V5 2V1QA 4FW2A 1LPLA 2RMOA 4F7UF 5KYYB 4M7AC 4PLIA 2DL3A 4M4ZA 1MNEA 3ULRB 3H0HA 3TSWA 3KBGA 2EQKA 3MJXA 3M4YA 4HVWA 2DRMA 1K8AC 5CKDA 2HQHA 1X69A 2DIGA 2YSQA 3EG1A 5GMKj 3HRTA 2DXBA 2K2MA 4E7JA 2FEIA 1UDLA 5CKHA 2HSPA 1R0CB 4JJDA 4E2FB 1LJOA 1UFFA 1VQPT 2F5KA 2J06A 3EFRA 5FU7C 4JDSA 3I5RA 1J3TA 4NL2A 2EIFA 1YIJT 4GLMA 4XTXA 4FSSA 5D6YA 3MPUB 1G3SA 3JB9D 3QJYA 4XTWA 4C92G 5KYWA 2QXFA 4KH1B 1JQQA 4XK8E 1H641 3L2RA 3QYGB 3CPWA 3PGGA 2M51A 4F17A 4PLLA 2P0QA 3CCLA 4DA4A 4WTOB 4RCCA 1QQJA 5LJ5d 2KMTA 5L23A 1WHMA 2MYSA 5J39A 4E7LA 2QA4T 3CC7T 1M8VA 1H8KA 2HNIA 1NYGA 2F5TX 2QQSA 1YJWA 1VQKT 3S3OA 1WQ7A 5GAOp 4OGEA 4WCIA 1X2QA 4HVVA 3EG2A 1UG1A 1DJ7B 3VUZA 3AHUA 1Y96A 4PJOD 5GAN8 3QZ9B 2KDSA 2HL3A 3OS0A 3CCVQ 3H0FA 5GJVB 2HD0A 2ZPFB 3QO3A 1VQ6Q 1O9SA 3OBYA 1VQ7A 4JJCA 4C92E 1YP5A 1M1KR 1AWJA 3REBB 3MEVA 3OYDA 1UE9A 2ED1A 2H8HA 4BY6B 2XIDA 1ZUYA 1W2BA 1SEMA 1M30A 5CVIA 1B3QA 3M0SA 2LCSA 4IUTA 2LZ6B 4CC3A 5CKFA 2LQ8A 1QLYA 4Z02A 1D09B 5IT9E 1OZ3A 1AD5A 1W4SA 4L5GA 4RCBA 4C8QC 2DXTA 4BD3A 1S72A 1I4K1 5HK0A 3M55A 2K79A 4AG2C 1M1KC 4M77C 5GAMe 4XQ3A 2OTLQ 3M0PA 1RAEB 2DVEA 3VYHB 1ZQ1A 3OMCA 4RMOA 3RESA 1G3WA 2GFUA 3CD6T 1XOVA 3CEYA 2DL8A 1S1NA 3ZBDA 4BUGA 3M0RA 1VQ9A 1VQ8T 2L5QA 3I55T 2VC8A 4N4GA 3JCMc 2KRNA 3E19A 2EAYA 1GBQA 4O6JA 1X43A 2KQWA 5FRMA 4Y28E 2DD5A 3ASKA 1K9MR 4KGVB 3PVQA 2FZGB 5GANf 1IXDA 4HCKA 3G4ST 5FU6B 2QI2A 1T3SA 4MZMA 4LXCA 3GP8A 2WSFE 1ARKA 3LH5A 1TU0B 1K0XA 2QTXA 5DM7R 4C92B 1SRLA 4CC2A 3MP1A 4LNPA 3GPLA 1YHQT 2EQMA 3LWHA 3JCMg 2HKQB 3RMSA 2YDLA 2JS0A 4JZ4A 3BW1A 1VQPA 3D7SB 2XHCA 1N9SA 2KVQG 2YUQA 1K9MC 4C92F 2EBPA 4F14A 5LJ3e 1K8AU 1JXMA 2E65A 1JEGA 1YIJA 1C0MA 2O4XA 3L2QA 9ATCB 2KT8A 3UA6A 4PJJA 2VV5A 3CXCS 1JBMA 2KEAA 2P0KA 3JB9G 2BUDA 3RBBB 5GAOn 2LJ3A 1YJ9Q 3EH1A 1I5LA 3A1PA 1NEBA 3RKYA 1GCQA 3CPFA 4J6WA 1VQNT 2AZSA 3L2ZA 1ZBJA 2FZCB 5FW9A 2ROTA 2KR3A 5L8RE 1K1ZA 1C6VX 5GAN2 3R6OA 4RG2A 1UGRB 3S3NA 4QVCA 4LUEA 2O2OA 4MMLA 2EYXA 5GMKi 3CC7A 1VQMQ 2CH4A 2GFAA 5IN1A 1VQKA 1TSFA 4B9XA 4XTYA 4EIKA 2PVGB 3CCQQ 1RUWA 2DA9A 2WSCE 4HKEA 1WXTA 1QKWA 2K5IA 1Y71A 2CP3A 4N0AC 1ZA2B 2RHZA 2A3LA 2LCLA 1KD1R 3I9QA 2A08A 1CSKA 4FL6A 2JTEA 2YUOA 4Z88A 4M7DD 4PJOG 2NWMA 2LQWA 1BIBA 2M02A 4C0GA 4OB0B 3OW2S 2KBTA 1Y7XA 2ZPHB 2GF7A 4HXJA 1N5ZA 5J3BA 4E7ZA 4JRIA 3VS6A 4DEXA 2JM8A 1WHHA 1JXOA 2RO0A 4J6YA 1OV3A 1MV0B 4IUVA 5GANh 2K2VA 5HCKA 4OMMA 2OAUA 2F2WA 1KD1C 2DVJA 5GAOl 4GY5A 1NZ9A 5GJWB 1TG0A 4WF2A 2D6FA 2JOYA 2LQKA 2K3YA 4X1VA 2ZPBB 2EKOA 1TOVA 5ECAA 1KG1A 1K73R 4ELYC 1PRLC 4V2SA 5GAMj 3G6ET 5GAN6 1WJQA 5IXFA 5KYXB 5DLOA 1YI2T 3EHRA 3GLXA 3HRUA 4M7AA 2CZ7B 4GBQA 3CD6A 3G7ZA 5M9OA 5FWBA 2L2PA 1X01A 4J8OA 3OYNA 1WLPB 2DZCA 3I55A 2JW4A 1YJNT 4IUQA 5A0DA 4A4FA 3OYLA 1M1KU 3CBMA 4XTUA 2YLCA 3X26B 2QEXT 4PJOE 2EYZA 1U5SA 2GCXA 1QWFA 3G4SA 3CCMT 1F1BB 2FPFA 3A5ZB 4J9DA 1K73C 2J6OA 2PTKA 1VQ6T 2V8KA 1AWOA 3GBQA 4JJNK 4MDWA 1O75A 5A2QE 3CCJA 2C0OA 2G3RA 3UF4A 2RM4A 3JAME 1EX4A 1M5Q1 2PUOB 5I21A 1AHJB 1RLQC 2R58A 3VRYA 2LMJA 2HQXA 3AT1B 3UA7A 1B7TA 1X27A 1RI9A 2HQEA 3JCMd 1M2VB 4RTZA 4GLKA 3JB9F 1RAAB 5LJ3j 2LNHB
chains in the Genus database with same CATH topology
4QW2A 3QUIA 3N5BB 3O8VA 2LTOA 1VUBA 4UC4A 2DTIA 3JSCA 3EAEA 4FT4A 3HFNA 3Q1JA 3SWNC 3M4GA 2QEXA 2RJEA 2RI5A 4CRIA 3JCMX 5GAN7 4L6V5 1PSEA 3VKIA 5GANg 2OTLT 2CZ1B 3FB9A 3PFSA 1NJIC 4F7UF 3CBOA 1G5VA 4M7AC 4PLIA 2EQJA 1B34B 1K9MU 3RKWA 5A0LA 4V2SA 1M9SA 2BIVA 3KBGA 4VUBA 5LJ5g 1UGPB 2DIQA 2EQKA 4OB3B 3M4YA 3E1SA 3V8JA 4HT8A 1NPPA 2V8IA 3P8DA 4BI3A 4LDVA 1K8AC 5CKDA 1VQNA 2X4YA 2KY9A 3TEEA 3QSUA 3P8HA 2DIGA 2JN0A 4E7IA 1QP3A 2Y4YA 5GMKj 3HRTA 1WJSA 2RHIA 2EFIA 4DOWA 4J7IA 2DXBA 5CK9A 3CC2T 4E7JA 2LDMA 2LNVA 5CKHA 3CC4A 2PU9B 3OA6A 1VQPT 1LJOA 1KHCA 3E9GA 2F5KA 2JVVA 3EFRA 3JCMQ 4PJOB 2QQRA 2O4XB 5FU7C 3SD4A 1KQ1A 1BI1A 1M1GA 5CQYA 5A0GA 1W2BS 4BE0A 4JDSA 3FIFA 1GXIE 1G3YA 1VQOA 1XNIA 4M75G 5I2MA 2DTOA 4NL2A 3M53A 1YJWT 2EIFA 5FU6C 1YIJT 4XTXA 5D6YA 3KXTA 1NPRA 1G3SA 3GNGA 3JB9D 1UEBA 4F7UA 3L2UA 3QJYA 3PIPA 3SDZA 1M4ZA 4XTWA 4C92G 2OTJA 3OYYA 2O01E 3QKJA 4QVDA 3JCMW 1Q81U 1VIEA 4ME7A 5CQXA 4PJOF 4C92C 1VQ4A 1YITT 4LD9K 2QXFA 2MF2A 4A4GA 3TU4K 4M75B 1JJ2A 2JNGA 2KSSA 3C12A 4KT0E 4XK8E 1H641 3S6WA 3S3MA 4C5IA 3L2RA 5KCHA 5LJ5e 5LJ5f 5GMKl 3JCMV 3T9NA 3QYGB 4B9WA 2RA2A 4C8QA 3CPWA 3ME9A 1PSFA 1HXDA 3PGGA 3MO8A 1BIAA 3LGFA 3H8ZA 3QBYA 4PLLA 2PVOB 4M7AE 2E6NA 1Q7YC 1FXXA 4XU2A 2P0QA 4BE1A 5HK3A 3CCLA 2KAFA 4DA4A 1H3ZA 4M7DG 4C5HA 5EG2A 1N27A 4M77A 3CC2A 4C0DB 4OMFB 2DPPB 3CCUA 4JRKA 2QQBA 5D6WA 4M7DC 2RHYA 4RCCA 2M16A 2IG0A 2CGHA 3DB4A 3QXEB 4OGCA 4PL6A 3P8BB 5LJ5d 4LDWA 2KMTA 2KK4A 2FB7A 5J39A 3I56A 5KCOA 3CCVT 3UPUA 4E7LA 2QA4T 1N8RC 3CC7T 3JB9F 1M8VA 2LVMA 2PVDB 3OSVA 1G3TA 1Y07A 2HNIA 1RL2A 2F5TX 2QQSA 2RHUA 2PQWA 1YJWA 1VQKT 3S3OA 4OB2B 4PJOA 4ZTJA 1WQ7A 3GF5A 3X28B 2L89A 2JTFA 2JUFA 3KUFA 4KUIA 4M78A 4OGEA 4A54A 5GAOp 5CCAA 2JZ2A 3RUXA 3BY7A 5GAMg 4XTVA 4FU6A 2JTMA 3JCMh 1DJ7B 2LCCA 4IUUA 3VUZA 3AHUA 1Y96A 3G6EA 1YI2A 4M75E 5GAN8 2XDBA 2WACA 3QZ9B 4PJOD 4OF1A 2KDSA 4BDYA 3OS0A 2VYTA 1UGSB 1R8OB 2HD0A 2ZPFB 4XU3A 3UT1A 3QO3A 1M90U 1O9SA 2EJGA 3OBYA 5GAOm 1KD1U 1VQ7A 1VQLT 4C92E 4NL3A 3OS2A 4MMKA 1KQ2A 4TVRA 3MEVA 3HL8A 1VQ9T 1KQSS 3OYDA 1U1TA 3CCQT 3GNFB 3CMEA 4BY6B 2XIDA 1MGQA 1W2BA 1WQWA 5CVIA 2K5FA 1SSFA 2F69A 4E7KA 3QJ6A 4Y91A 1Q86U 3TREA 4IUTA 2RI3A 4LDXA 3OYIA 4M7AG 1U1SA 3HHTB 3CCMA 5CKFA 2LQ8A 3LH0A 2RJDA 1WGSA 2LRQA 3INZA 5DLQE 4CI0C 2QA4A 2RHXA 4Z02A 5KH6A 5IT9E 4C8QG 1OZ3A 4M7DE 1VQ6A 1W4SA 4C0ZA 4L5GA 5IAYA 3SWNB 2RK1A 4RCBA 4C8QC 1QVFS 2DXTA 2K57A 4N4HA 5GAOr 3QIIA 1QP2A 4BD3A 5GAOq 3LWIA 1S72A 1I4K1 3OB9A 5HK0A 1BI3A 2K5LA 3M55A 1VQ5T 4M77G 4JRQA 4M7AB 3CCEA 4M77C 1M1KC 5GAMe 5GAMf 2RJFA 4MZPA 4XQ3A 2B8AA 3RMQA 5HKCA 2CKKA 3FC3A 2DVEA 4BI8B 2MWPA 3FJPA 3VYHB 2D0QB 3M56A 1ZQ1A 3OMCA 4J6XA 3OYCA 4RMOA 3RESA 1K73U 4FSXA 2P4TA 1YBYA 3V8LA 1G3WA 2GFUA 3CD6T 1XOVA 3CEYA 3OSSC 4QQGA 3CCST 4HCBA 4QVZA 2NLUA 3WXMB 4BUGA 3ZBDA 4P5NA 3JB9H 3VUBA 5LJ3g 2E10A 5FRNA 4M78G 1NE8A 5GAMd 1VQ9A 1I81A 2L5QA 1VQ8T 3I55T 2RI2A 4M7AF 2VC8A 4M78C 4N4GA 3JCMc 2FHDA 3E19A 3A8LB 2EAYA 3MP6A 4O6JA 1Q82C 1KC8C 2KQWA 4EMKC 4Y28E 3JB9I 1WNLA 3M58A 4C0FA 5FRMA 5FU7B 3OBWA 2DD5A 3OYHA 3CMAT 3ASKA 4LD6A 1FX7A 3M54A 4LDYA 2OTLA 3C95A 5GANe 2DXUA 5GANf 5FLXE 2FL7A 3V7RA 2ZZDA 5FU6B 3G4ST 2QI2A 4EMHA 3OS1A 4MZTA 4MZMA 4RG8A 3OMGA 3MP8A 3GP8A 2WSFE 4J83A 3J81E 2RK2A 3QDRB 5CIUA 2QQAA 4Q5WA 2QTXA 5LJ5h 1BKBA 4EDUA 5DM7R 2DD4A 4C92B 1BYMA 4C5EA 3MP1A 1EIFA 2V8JA 1D3BB 3GPLA 1YHQT 2EQMA 3FRNA 1B34A 4EPCA 2XG8D 3LWHA 1BI2A 3OS5A 4YTLA 4KBMB 3JCMg 2FYKA 2LC4A 5GANd 3J80E 2HAXA 3RMSA 2R5MA 2E64A 3A8MB 4A53A 4C8QE 2XU8A 4N0AA 2I2LA 3BW1A 4M75F 1NJIU 2EQUA 1KQSA 1VQPA 3PIOA 2XHCA 1N9SA 2KVQG 1U8RA 1UGQB 4M77E 3CCSA 3HP9A 1V29B 1WJRA 4JRPA 1K9MC 4C92F 3A8HB 3NTKA 4ZTFA 5LJ3e 2DO3A 5LJ3f 1K8AU 2E65A 3G71T 1YJ9T 1VQ8A 3META 4IUPA 3MHXA 4DOVA 4ATOA 4M7DB 1YIJA 2HBPA 3FDRA 2A7YA 2BKDN 3CCRT 1KHIA 2O4XA 1MHNA 2R57A 2EJFA 3LYIA 3L2QA 4ZGEB 2E5QA 1QVPA 4M7AD 3A8OB 4J5YA 2QDYB 4KULA 1XTDA 2VV5A 2L3RA 5CAIA 1QVFA 1YITA 3CXCS 1JBMA 2P0KA 4L59A 4ELZC 5C6SA 4M78E 3JB9G 2BUDA 2IVWA 3VYGA 2FVUA 4JUVA 4XU0A 4IKFA 5C0MA 3HKSA 5GAOn 4M7DF 2K3XA 2MMPA 1I5LA 3PMIA 1N9RA 4KUDK 2EWNA 1VQMT 1ZBXA 1YHQA 1I8FA 3RKYA 5GMKe 2RH2A 3BDUA 3BDLA 3CPFA 1JRIA 4J6WA 4M75A 4F7UG 5LJ5j 3L2VA 1VQNT 1P92A 1X6OA 3L2WA 2MWOA 3L2ZA 2RB6A 1VIFA 4JS4A 3GOXA 3ZEHA 1X75C 4HA8A 4C92A 4E47A 5L8RE 4A4KA 1IZ6A 3X25B 1Q81C 2YHTA 4FT2A 4FM4B 4ZGJB 1N6AA 4M75D 3QG1A 5GAN2 3CC4T 3R6OA 3JCMJ 4RG2A 2VXEA 4IURA 3OYBA 1UGRB 2E12A 3S3NA 4QVCA 2C06A 2RJCA 3QHSA 3CCVA 5GMKm 5J26A 4MMLA 3X24B 3WVEB 5GMKi 5D6XA 2GFAA 3M59A 4PNOA 3CC7A 1YJ9A 1QVGS 3EFSA 4C92D 1WPYA 5IN1A 1VQOT 4B9XA 3MEWA 2GQVA 4XTYA 3C94A 5FROA 4D6WA 1VQKA 2PVGB 3F70A 4BE2A 2WSCE 4HKEA 1Q7YU 3V7SA 2K5IA 2ZPGB 2WSEE 1Y71A 2MAMA 3FLGA 2DTHA 3RERA 3M9QA 4JLIA 5CKBA 2OTJT 3OYKA 2XDDA 4BDZA 4M7DA 4N0AC 5GAMh 4HCCA 3M5AA 2CZ0B 2RHZA 3OY9A 2A3LA 1VQ4T 2DKGA 2DK3A 2LCLA 4C8QB 4NOYA 4X9CA 4FL6A 3JCMP 1N8RU 4ZN3A 1BI0A 2XDPA 3L42A 3OYEA 2ZCFB 3HFOA 4A4HA 1VQLA 4M77B 4M7DD 3VV0A 4PJOG 1XQHA 1VQMA 2M0OA 2VUBA 3ER0A 3C4SA 1BIBA 3QYHB 4C0GA 4PJOC 3FEOA 3MEAA 3DKMA 4OB0B 1Y7XA 3RIRA 2ZPHB 3CCQA 3OW2S 2GF7A 5J3BA 3MCAB 3CCLT 3J7AF 3OQ5A 4JRIA 2CYZB 2CS7A 4C8QF 5GAN5 3CCUT 3PTAA 3LW5E 5GAN3 2EYQA 2RO0A 4J6YA 5CR2A 3OYAA 4IUVA 3HRSA 4F7UE 5GANh 4M77F 2K2VA 4M78B 3SB2A 4BI4A 4EMGA 3UDCA 2VGMA 2OAUA 3H6ZA 4OVAA 3ZFJA 4A4EA 3I56T 4MDXA 3BFMA 4N4IA 4C5GA 1M90C 4QQ6A 4EMKB 2E1HA 1KD1C 5GAOl 3E9FA 3CXCA 2E6ZA 2H3JA 4M75C 2LT4A 3DLMA 4GY5A 1NZ9A 1Y96B 4X34A 4ZGDB 1VQ5A 2DJZA 3QPHA 4OB1B 4WF2A 2D6FA 4HCZA 2JOYA 2DAQA 1TH7A 2LQKA 2R5AA 2K3YA 1HK9A 2ZPBB 3HSBA 2EKOA 2Y90A 3CCJT 1KG1A 3SWNA 3PNWC 5KE3A 2E41A 2Y4XA 2CZ6B 3CBPA 4ELYC 4OP0A 2M1HA 4X9DA 3DLLA 4M78F 5GAMj 3HPWA 1WJQA 5GAN6 5DLOA 3G6ET 1YI2T 1Q86C 4HT9A 3WVDB 3VJPA 2ZPIB 1LNXA 1YCYA 3JRZA 3GLXA 3HRUA 3SFMA 2CZ7B 4II1A 4M7AA 1FWZA 2LX9A 4C0DC 3CD6A 3G7ZA 1M1FA 3PT9A 5M9OA 4FIBA 4XU1A 1VQ7T 1IREB 1X01A 4J8OA 2LT1A 4PKCC 3OYNA 4XAXB 4BB7A 3OYGA 4R56A 2DZCA 2YLBA 2VGNA 5LJ3h 3I55A 2XD0A 2XICA 1YJNT 4IUQA 5A0DA 4A4FA 1M1KU 2VXFA 2EJ9A 5AYFA 3OYLA 3NTHA 3CMET 3MEUA 1QW1A 3CBMA 3LLRA 3LX7A 2DZ9A 4XTUA 3JCMb 3OYFA 5DY9A 1QVGA 2QQ9A 2DEQA 3GIBA 3CMAA 2YLCA 4XTZA 2AHJB 3X26B 2ZGWA 4C8QD 2QEXT 4PJOE 4E7HA 3PMTA 5I2SA 3JB9J 3LGLA 2GCXA 2L8DA 3G4SA 5LJ3d 3URGA 3CCMT 3NFCA 2XKOC 4M77D 3TCJA 3A5ZB 4ZN1A 5GANj 4DQ2A 1K73C 4JLGA 3V7CA 3A8GB 2XK0A 1UB4A 1VQ6T 3VU3C 2K4YA 2P0PA 2PUKB 2V8KA 3OYMA 1S72T 5CO7A 4JJNK 1ZHIA 1Q82U 2E70A 3DB3A 4MDWA 1O75A 5GMKh 1KC8U 1JJ2S 2XI9A 2X4JA 2X4XA 4J7FA 5A2QE 3CCJA 4EMKA 1JB0E 1OI1A 2G3RA 1OYXA 3M57A 5HY6A 3JCMf 3JCMe 3CCET 2RM4A 2RD1A 5CKEA 1OZ2A 2MI6A 3V8KA 5GAN4 4O5VA 4NS5A 1D3BA 3CPWS 2X4WA 3JAME 1M5Q1 4M78D 2PUOB 4JS5A 3OW2A 4BY6C 3RKXA 3X20B 5I21A 1LOJA 3OYJA 2YRVA 4BACA 1AHJB 2X35A 2R58A 1RI0A 3QZ5B 4F7UB 2HQXA 5KE2A 4R55A 2DXCA 4RKUE 4LDUA 3L1AA 3G71A 2HQEA 3NTIA 3JCMd 4QQDA 1YJNA 2M9UA 5LL6S 4GLKA 3UWNA 3CCRA 2ZPEB 5LJ3j 2D9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3B A;  4YTL A;  3CCL T;  3J7A F;  3J80 E;  2QEX A;  3CCU T;  4CRI A;  1NJI U;  2OTL T;  3G6E A;  1YI2 A;  1KQS A;  1VQP A;  3PIO A;  1NJI C;  2KDS A;  2XHC A;  2KVQ G;  1M90 U;  3CCS A;  1K9M U;  3I56 T;  1KD1 U;  1M90 C;  1VQ7 A;  3KBG A;  1K9M C;  1VQL T;  1KD1 C;  2DO3 A;  3CXC A;  1K8A U;  3G71 T;  2E6Z A;  1YJ9 T;  1VQ8 A;  1NPP A;  1K8A C;  4TVR A;  1YIJ A;  1NZ9 A;  1VQ9 T;  4X34 A;  1KQS S;  3CCR T;  1VQN A;  1KHI A;  1VQ5 A;  3CCQ T;  3CME A;  2JOY A;  1W2B A;  3CCJ T;  1XTD A;  3CC2 T;  1SSF A;  2L3R A;  1QVF A;  1Q86 U;  1YIT A;  3CXC S;  3TRE A;  3DLL A;  3G6E T;  1YI2 T;  1Q86 C;  3CC4 A;  1VQP T;  2JVV A;  3CCM A;  2LQ8 A;  3LH0 A;  3HKS A;  5DLQ E;  3CD6 A;  2QA4 A;  5IT9 E;  1M1G A;  1W2B S;  1VQ7 T;  1VQ6 A;  5IAY A;  1VQO A;  1XNI A;  1QVF S;  1VQM T;  1YHQ A;  1YJW T;  2EIF A;  3CPF A;  3I55 A;  1YIJ T;  1S72 A;  1VQN T;  1YJN T;  1NPR A;  1VQ5 T;  1M1K U;  1UEB A;  3CME T;  1X6O A;  2MWO A;  3PIP A;  3CCE A;  1M1K C;  2OTJ A;  1QVG A;  3OYY A;  1Q81 U;  3CMA A;  2QEX T;  2CKK A;  1IZ6 A;  1YIT T;  1Q81 C;  1VQ4 A;  2MWP A;  3CC4 T;  3LGL A;  4RG2 A;  3G4S A;  1JJ2 A;  2JNG A;  3CCM T;  1K73 U;  1YBY A;  3CD6 T;  3CCV A;  4ZN1 A;  3A5Z B;  1K73 C;  5J26 A;  3CCS T;  3CC7 A;  1QVG S;  1VQ6 T;  1YJ9 A;  1VQO T;  1VQK A;  3CPW A;  1VQ9 A;  1VQ8 T;  3I55 T;  1Q7Y U;  3LGF A;  1S72 T;  1Q82 U;  3DB3 A;  2E70 A;  1Q7Y C;  1KC8 U;  1JJ2 S;  3CCL A;  1Q82 C;  5A2Q E;  1KC8 C;  3CCJ A;  3CCE T;  2G3R A;  5HY6 A;  3CC2 A;  2OTJ T;  3CCU A;  2MI6 A;  3CMA T;  2IG0 A;  2OTL A;  1VQ4 T;  2LCL A;  3CPW S;  3DB4 A;  3JAM E;  3P8B B;  3OW2 A;  5FLX E;  3G4S T;  1N8R U;  4ZN3 A;  1N8R C;  3I56 A;  3CCV T;  2QA4 T;  3CC7 T;  2LVM A;  1VQL A;  3J81 E;  1RL2 A;  1VQM A;  3G71 A;  1YJW A;  1VQK T;  5DM7 R;  1BKB A;  3ER0 A;  4QQD A;  1YJN A;  5LL6 S;  1EIF A;  3CCR A;  1YHQ T;  3OW2 S;  3CCQ A;  2JUF A; 
#chains in the Genus database with same CATH topology
 4UC4 A;  2DTI A;  1OU9 A;  1D1A A;  1IHV A;  2CUD A;  2FO0 A;  3M4G A;  3EFO B;  4QKU A;  1IGU A;  3JCM X;  2OTL T;  1MUZ A;  2CZ1 B;  4D8K A;  2K9G A;  1K9M U;  1D0Y A;  1M9S A;  1FYN A;  4VUB A;  5LJ5 g;  4FYY B;  2FZK B;  3V8J A;  2JXB A;  3P8D A;  1VQN A;  2X4Y A;  4OMN A;  2AKL A;  2DER A;  2EGC A;  4J7I A;  1MND A;  1VQ4 Q;  2LDM A;  4FYV B;  1M3A A;  4PJO B;  5A0G A;  1Z9Z A;  1H3H A;  1VA7 A;  1XNI A;  5IXB A;  2DTO A;  1YJW T;  2JT4 A;  1RAB B;  2X51 A;  4DBF A;  4F7U A;  3CC2 Q;  2KYB A;  3SDZ A;  2ROL A;  3CCU Q;  3CQT A;  3OYY A;  4QVD A;  3JCM W;  1N8R R;  4ME7 A;  4PJO F;  3SHW A;  1YIT T;  4M75 B;  1JJ2 A;  2RQU A;  2KI7 A;  2KSS A;  3C12 A;  4KGZ B;  2BTT A;  3S3M A;  1HJD A;  4ZNX A;  5LJ5 f;  1JO8 A;  1PNJ A;  3EHQ A;  4C8Q A;  3ME9 A;  1PSF A;  1BIA A;  2P4R A;  2PVO B;  5HK3 A;  2KAF A;  4M7D G;  4M77 A;  4OMF B;  1AOJ A;  2QQB A;  1MMA A;  2RNA A;  2CGH A;  3DB4 A;  1U06 A;  1YFN A;  3H41 A;  4PL6 A;  3PVL A;  4FYX B;  1NM7 A;  1PD1 A;  1IB8 A;  1N8R C;  1GBR A;  2RN8 A;  1AWW A;  2L0A A;  4JZ3 A;  2CDT A;  3VS0 A;  3X28 B;  3KUF A;  1PM3 A;  2JTF A;  5CCA A;  2JZ2 A;  2A28 A;  2QG9 B;  1RAF B;  4FU6 A;  1WDX A;  2YUN A;  1LVK A;  3G6E A;  1YI2 A;  1RAG B;  2WAC A;  2I0N A;  2VYT A;  1R8O B;  1PC0 A;  1KD1 U;  4AFU C;  1VQL T;  1KIK A;  4MMK A;  1KQ2 A;  1Z9Q A;  1VQ9 T;  1KQS S;  1OEB A;  1U1T A;  3CCQ T;  3JV3 A;  3EGX B;  4CC7 A;  2LQN A;  2K5F A;  4E7K A;  3RR6 A;  3TRE A;  2RI3 A;  2HMA A;  3HHT B;  3CCM A;  2VVK A;  1OQK A;  1MMN A;  1SSH A;  4M7D E;  1M8M A;  1VQ6 A;  1KC8 R;  2DEU A;  3SWN B;  1KK7 A;  1ZSZ B;  2RK1 A;  1QVF S;  5GAO r;  2RQT A;  3LWI A;  1BI3 A;  2K5L A;  1VQ5 T;  2FPE A;  2GTO A;  1H92 A;  1D0X A;  3RMQ A;  5HKC A;  2CKK A;  2OI3 A;  4Z8A A;  4J6X A;  3EGD A;  1K73 U;  4FSX A;  2P4T A;  4HCB A;  4QVZ A;  1XJW B;  2A0F B;  3JB9 H;  1MMD A;  2E10 A;  1NE8 A;  5GAM d;  1I81 A;  1OX8 A;  4M78 C;  1D1B A;  1KC8 C;  1QVG P;  2EPD A;  1WNL A;  2PNI A;  4LD6 A;  1FX7 A;  2OTL A;  3C95 A;  4J9E A;  2FL7 A;  3CCS Q;  2ZZD A;  3OMG A;  1YWP A;  1ZUU A;  2QK0 A;  5CIU A;  5LJ5 h;  2DD4 A;  2V8J A;  1G2B A;  1B34 A;  4EPC A;  1G8X A;  3J80 E;  2HAX A;  2E64 A;  2XU8 A;  4N0A A;  3PIO A;  1U8R A;  1UGQ B;  1WXB A;  1JU5 C;  1GRI A;  4QT7 A;  4DOV A;  4IUP A;  4M7D B;  2HBP A;  2A7Y A;  2BKD N;  1MHN A;  3LYI A;  4FYW B;  1RLP C;  1PG5 B;  1GCP A;  3VS5 A;  1YIT A;  3O5Z A;  4ELZ C;  2DIL A;  5C6S A;  1ACM B;  3VYG A;  2FVU A;  2YUP A;  4JUV A;  2OX7 A;  4M7D F;  1OPK A;  1ZBX A;  3BDU A;  1JRI A;  1P92 A;  2YWW A;  2BZX A;  2J6K A;  1OX9 A;  3ZEH A;  4C92 A;  3H9N A;  4E47 A;  3R6N A;  3X25 B;  2YHT A;  4M75 D;  1OOT A;  2W10 A;  2RJC A;  1M3C A;  5GMK m;  5D6X A;  1YJ9 A;  1WPY A;  1VQO T;  3MEW A;  2GQV A;  5KYU A;  4JJB A;  4IIM A;  4BE2 A;  5I11 A;  3G1J A;  1E7O A;  3FLG A;  1M2O A;  3RER A;  3M9Q A;  1NLO C;  4JLI A;  2OTJ T;  3OYK A;  2COZ A;  2XDD A;  3RNJ A;  1SHG A;  2AK5 A;  1M90 R;  1VQ4 T;  2DK3 A;  1N8R U;  2XDP A;  3L42 A;  1AZG B;  3HFO A;  1VQL A;  1MMG A;  2DYB A;  1XQH A;  1VQM A;  4FCY A;  2D0N A;  3FEO A;  3MEA A;  4IIO A;  1ZX6 A;  3CCQ A;  3MCA B;  4HVU A;  1QCN A;  2X3X D;  3J7A F;  2CYZ B;  2CS7 A;  1QCO A;  1BCM A;  3CCU T;  1BB9 A;  5CR2 A;  3OYA A;  3HRS A;  3QWX X;  4BI4 A;  2VGM A;  3I56 T;  4N4I A;  1M90 C;  4QQ6 A;  4EMK B;  2H3J A;  4AMC A;  1Y96 B;  1SKU B;  1VQ5 A;  1IHW A;  3NGP A;  2A36 A;  1GFC A;  1QVF P;  3I35 A;  1VOM A;  3CCJ T;  4AT1 B;  2NUP A;  3PNW C;  1YN8 A;  5KE3 A;  4OP0 A;  2M1H A;  3DLL A;  1UJY A;  2K3B A;  3VJP A;  1LNX A;  1YCY A;  5IHK A;  2HKN A;  1QCF A;  4FIB A;  4PKC C;  2LT1 A;  2NYS A;  4XAX B;  2VGN A;  1PKS A;  1Y0M A;  2XD0 A;  2O9V A;  2DBM A;  2EJ9 A;  1PHT A;  3OYF A;  3LLR A;  3JCM b;  5DY9 A;  4PJN A;  1QVG A;  2D1X A;  4C8Q D;  2ZGW A;  4E7H A;  1SPK A;  2L8D A;  2E4H A;  2NUZ A;  2JS2 A;  3NFC A;  5IHN A;  4M77 D;  3TCJ A;  4ZN1 A;  3G71 Q;  2KRS A;  2PUK B;  3CCR Q;  1R77 A;  5D7U A;  5CO7 A;  1ZHI A;  2C0T A;  2E70 A;  2HSE B;  5GMK h;  1KC8 U;  2XI9 A;  1NJI R;  3CCE T;  3JCM f;  2NUT A;  1A0N B;  5CKE A;  3V8K A;  1OZ2 A;  4PK4 A;  1WFW A;  1D3B A;  3CPW S;  1PD0 A;  4PFZ A;  4BY6 C;  4KRT A;  3OYJ A;  5KE2 A;  1S72 Q;  4LDU A;  3I5S A;  1E6G A;  1WIE A;  2E3H A;  4QQD A;  5LL6 S;  2JJ9 A;  3CBO A;  2CP2 A;  3QUI A;  3UAT A;  2LTO A;  2EVR A;  3EAE A;  3HFN A;  1OU8 A;  4CRI A;  3CC4 Q;  1NJI C;  4CC4 B;  1I0C A;  1BU1 A;  5A0L A;  2DIQ A;  1NPP A;  4BI3 A;  2KY9 A;  3TEE A;  3P8H A;  2J6F A;  4E7I A;  2RHI A;  2EFI A;  3NMZ C;  2LNV A;  4E7S A;  1IRX A;  2PU9 B;  3OA6 A;  3E9G A;  3JCM Q;  2JVV A;  2GBQ A;  2QQR A;  2O4X B;  1M1G A;  5CQY A;  1W2B S;  1G3Y A;  1VQO A;  4M75 G;  4F16 A;  1QWE A;  5FU6 C;  1UEB A;  1ZUK A;  2OAW A;  1M4Z A;  2OTJ A;  1FMV A;  3QKJ A;  1OUL A;  4C92 C;  1VQ4 A;  2L3S A;  2MF2 A;  4A4G A;  1TWB A;  2JNG A;  4J9C A;  3S6W A;  5KCH A;  4DBR A;  1YIJ Q;  3JCM V;  4B9W A;  2RA2 A;  3MO8 A;  1VYV A;  3H8Z A;  3QBY A;  4M7A E;  1KFZ A;  1FXX A;  4XU2 A;  4BE1 A;  1T3L A;  4C5H A;  1N27 A;  1FMK A;  3CC2 A;  4C0D B;  4FW1 A;  3SEM A;  3CCU A;  4JRK A;  2IG0 A;  4OGC A;  3P8B B;  4LDW A;  1CKB A;  1WZO A;  4AFQ C;  3I56 A;  5KCO A;  3CCV T;  3UPU A;  2DX1 A;  2LVM A;  2PVD B;  4DBQ A;  1G3T A;  1Y07 A;  1RL2 A;  2LP5 A;  2RHU A;  2HBW A;  1UEC A;  4AFS C;  4OB2 B;  4PJO A;  4ZTJ A;  3CME Q;  5AT1 B;  3GF5 A;  1T0H A;  2L89 A;  4M78 A;  4A54 A;  1KSW A;  2IPO B;  5GAM g;  8ATC B;  2FG0 A;  1M27 C;  2KXD A;  3JCM h;  1U3O A;  2XDB A;  3A98 A;  4M75 E;  4BDY A;  2MOX A;  1UGS B;  2QA4 Q;  3CC7 Q;  4ANJ A;  1W1F A;  1M90 U;  4RUG A;  3UT1 A;  2QDL A;  1VQK Q;  1K9A A;  3OS2 A;  4TVR A;  1OPL A;  1R0B G;  4AFZ C;  1WQW A;  3EG3 A;  1AEY A;  2LJ1 A;  1SSF A;  2F69 A;  4LDX A;  1U1S A;  8AT1 B;  4ESR A;  5DLQ E;  1SG5 A;  2LRQ A;  2Z0W A;  4CI0 C;  5EC7 A;  1PWT A;  5KH6 A;  4C8Q G;  2FRW A;  3CXC P;  1Q82 R;  4C0Z A;  5IAY A;  3HTR A;  2K57 A;  4N4H A;  3QII A;  1QP2 A;  2W0Z A;  3OB9 A;  2DE0 X;  1ZLM A;  1PKT A;  4M77 G;  1D1C A;  4M7A B;  3CCE A;  4LE9 A;  5GAM f;  2RJF A;  4MZP A;  2B8A A;  3FC3 A;  1T0J A;  4RTY A;  4BI8 B;  2EKH A;  3OYC A;  2QYZ A;  1BCO A;  1YBY A;  3V8L A;  4QQG A;  3BE3 A;  1K0S A;  3CPW P;  1AVZ C;  4P5N A;  3VUB A;  5LJ3 g;  1VYU A;  3TSZ A;  4M7A F;  2D8J A;  1NBE B;  3A8L B;  2YRC A;  1Q82 C;  2GTJ A;  2DF6 A;  4K11 A;  3JB9 I;  3M58 A;  2E5K A;  4C0F A;  1I5O B;  2RF0 A;  5FU7 B;  5GAN e;  2DXU A;  4F04 B;  1UUE A;  3V7R A;  1EZZ B;  2L3Q A;  3OS1 A;  4RG8 A;  3MP8 A;  1VQ8 Q;  3I55 Q;  2RK2 A;  4Q5W A;  2CUB A;  4C5E A;  1EIF A;  5KYY A;  3FRN A;  2XG8 D;  1BI2 A;  3OS5 A;  2YXY A;  2FYK A;  3FJ5 A;  1V1C A;  2R5M A;  4J9I A;  4A53 A;  1UHF A;  4C8Q E;  2I2L A;  4M75 F;  1NJI U;  3OW2 P;  2EQU A;  1UGV A;  1WHL A;  4M77 E;  3CCS A;  1TUG B;  1WXU A;  2KRM A;  1WHK A;  2ABL A;  3NTK A;  1WYX A;  1YHQ Q;  2DO3 A;  1QKX A;  5LJ3 f;  3EG9 B;  3G71 T;  1YJ9 T;  3MET A;  3MHX A;  1X6G A;  3FDR A;  3KFV A;  3CCR T;  1KHI A;  1Q81 R;  2R57 A;  4ZGE B;  2E5Q A;  1QVP A;  3A8O B;  4J5Y A;  4KUL A;  2EGA A;  1XTD A;  2L3R A;  1WHJ A;  2DBK A;  3VS2 A;  4RTW A;  4L59 A;  3EH2 A;  2CP6 A;  4KH0 B;  5C0M A;  2KT1 A;  1N9R A;  4KUD K;  2EWN A;  2J7I A;  3NHN A;  1VQM T;  5GAN 5;  3BDL A;  4PJM A;  3L2V A;  2HL5 C;  2B86 A;  1UJ0 A;  1ZA1 B;  3L2W A;  2MWO A;  3GOX A;  1X75 C;  4J9G A;  4HA8 A;  5IH2 A;  1IZ6 A;  1Q81 C;  4FT2 A;  1WX6 A;  4FM4 B;  1N6A A;  3CC4 T;  4IUR A;  3OYB A;  2E12 A;  3QHS A;  3CCV A;  3WVE B;  4PNO A;  3M59 A;  1AWX A;  4D6W A;  3C94 A;  3F70 A;  1TS9 A;  2DFU A;  2ZPG B;  2MAM A;  2K6D A;  2DTH A;  4BDZ A;  4M7D A;  5GAM h;  4HCC A;  3M5A A;  2CZ0 B;  2F2V A;  3E2U A;  3OY9 A;  1HYO A;  4C8Q B;  3JCM P;  1I07 A;  1NLP C;  5IHI A;  4A4H A;  4M77 B;  4PJO C;  3DKM A;  3RIR A;  1Q86 R;  3OQ5 A;  4C8Q F;  5GAN 3;  2GGR A;  2J05 A;  4M77 F;  3SB2 A;  1BK2 A;  4EMG A;  3H6Z A;  4OVA A;  3ZFJ A;  4C5G A;  3E9F A;  3CXC A;  4M75 C;  4ZGD B;  2DJZ A;  1WI7 A;  3QPH A;  4OB1 B;  2DAQ A;  1TH7 A;  2R5A A;  2KRO A;  1HK9 A;  1PCX A;  3HSB A;  3CMA Q;  2Y90 A;  2HEQ A;  2CSQ A;  2CZ6 B;  2ENM A;  1Q86 C;  2ZPI B;  3PT9 A;  4XU1 A;  3TVT A;  2D8H A;  3ZL7 C;  3OYG A;  4R56 A;  5LJ3 h;  1AZE A;  4LUD A;  5AYF A;  3CME T;  4M7A D;  3MEU A;  1QW1 A;  2DZ9 A;  2YT6 A;  2RQV A;  2QQ9 A;  3GIB A;  3G6E Q;  1YI2 Q;  2QTV A;  2AIR B;  2DYI A;  2QGF B;  5LJ3 d;  2DNU A;  3EG0 A;  5GAN j;  1TUD A;  4J9H A;  1YNZ A;  1K4U S;  4JLG A;  3A8G B;  2K4Y A;  2SEM A;  1YJN Q;  5FWC A;  1Y57 A;  3OYM A;  2DL7 A;  1HD3 A;  1Q82 U;  1JJ2 S;  2X4X A;  3EGD B;  1ZSG A;  4EMK A;  3M57 A;  2QEX Q;  3H0I A;  1RAD B;  2RD1 A;  4DBH A;  4O5V A;  4NS5 A;  1IO6 A;  3CCM Q;  2X4W A;  4M78 D;  2HZY A;  4JS5 A;  3OW2 A;  4BAC A;  2YRV A;  3QZ5 B;  2G6F X;  2MK5 A;  2KE9 A;  2DXC A;  3G71 A;  3NTI A;  2H3E B;  3UWN A;  3CCR A;  2ZPE B;  2V26 A;  3VU3 C;  5KYW B;  4QW2 A;  3N5B B;  3O8V A;  4OMP A;  1W70 A;  2F1L A;  3SWN C;  1ZSZ C;  3VKI A;  1PSE A;  5GAN g;  1C1A A;  3FB9 A;  3PFS A;  1G5V A;  2EQJ A;  1B34 B;  3REA B;  3RKW A;  2BIV A;  1UGP B;  4OB3 B;  3E1S A;  4HT8 A;  2V8I A;  4LDV A;  2ATC B;  3QSU A;  2JN0 A;  1QP3 A;  2Y4Y A;  1WJS A;  4DOW A;  1TTH B;  5CK9 A;  3CC2 T;  4AG1 C;  1KQS P;  2E3I A;  3CC4 A;  1KHC A;  1PRM C;  3SD4 A;  1KQ1 A;  1BI1 A;  2QAS A;  1Q7Y R;  4BE0 A;  3FIF A;  1GXI E;  1SF9 A;  5I2M A;  2C0I A;  3M53 A;  1TUC A;  3CCL Q;  3KXT A;  1NPR A;  2QGG A;  3GNG A;  3L2U A;  2CRE A;  3PIP A;  2BZ8 A;  3C0C A;  4OML A;  2CP7 A;  2O01 E;  1Q81 U;  1VIE A;  4LD9 K;  5CQX A;  2ECZ A;  3TU4 K;  4KT0 E;  1B07 A;  4C5I A;  1YJW Q;  5LJ5 e;  5GMK l;  2DMO A;  3T9N A;  1YWO A;  2O88 A;  1HXD A;  2CP0 A;  3LGF A;  2AZV A;  2XMF A;  2E6N A;  1Q7Y C;  1H3Z A;  1YIT Q;  2JMA A;  5EG2 A;  2DPP B;  5D6W A;  4M7D C;  1W6X A;  2RHY A;  2M16 A;  5KYU B;  3QXE B;  2KK4 A;  2FB7 A;  2X9H A;  3THK A;  2HCK A;  1VQ7 Q;  3IQL A;  2JM9 A;  3OSV A;  1LCK A;  1X2K A;  2PQW A;  4D8D A;  1KJW A;  4KUI A;  2JUF A;  1BBZ A;  2IIM A;  2KXC A;  4A63 B;  3RUX A;  2ESW A;  3BY7 A;  4XTV A;  2JTM A;  2LCC A;  1WA7 A;  4IUU A;  1FMW A;  4DEY A;  4OF1 A;  2K7A A;  4XU3 A;  2SRC A;  2EJG A;  5GAO m;  1SRM A;  4NL3 A;  5KYX A;  3HL8 A;  3GNF B;  3CME A;  1E6H A;  1MGQ A;  2DL5 A;  1ABQ A;  3QJ6 A;  4Y91 A;  1Q86 U;  3OYI A;  4M7A G;  2CSI A;  3LH0 A;  1VQL Q;  2RJD A;  1WGS A;  3INZ A;  2QA4 A;  2RHX A;  4RTU A;  2ZAE A;  1VQ9 Q;  4Y92 A;  2NUP B;  2EYY A;  1G83 A;  5GAO q;  1IGQ A;  2JMC A;  2LX7 A;  3TQ7 P;  4JRQ A;  4R0K A;  4RTT A;  1JJ2 P;  2MWP A;  3FJP A;  2D0Q B;  3M56 A;  4E6R A;  2AKK A;  3OSS C;  3CCS T;  2NLU A;  3WXM B;  5FRN A;  4M78 G;  1VQ5 Q;  2CP5 A;  2RI2 A;  4PJL A;  2FHD A;  3MP6 A;  4RTX A;  4EMK C;  3VRZ A;  2VAS A;  3VS3 A;  3OBW A;  3OYH A;  3CMA T;  3M54 A;  1M2V A;  1VQP Q;  4LDY A;  2VWF A;  4OMO A;  1WHG A;  5FLX E;  2F2X A;  2MIO A;  1RAH B;  2MCN A;  4EMH A;  4MZT A;  1UHC A;  3M0T A;  3EFO A;  4J83 A;  1M3B A;  3J81 E;  3QDR B;  2NUT B;  2QQA A;  2DRK A;  1BKB A;  1K76 A;  4EDU A;  1BYM A;  1D3B B;  2BZY A;  4YTL A;  4KBM B;  4PFP A;  5GAN d;  2LC4 A;  2EW3 A;  3NPF A;  1MV3 A;  3A8M B;  2DM1 A;  2VB6 A;  1KQS A;  2YRD A;  5I22 A;  3HP9 A;  1V29 B;  2KYM A;  1WJR A;  4JPB W;  4JRP A;  3A8H B;  4ZTF A;  1UTI A;  4ATO A;  1VQ8 A;  2EJF A;  3PE0 A;  2QDY B;  1QVF A;  5CAI A;  1NEG A;  2KNB B;  4M78 E;  2IVW A;  4XU0 A;  4IKF A;  3HKS A;  2RQW A;  2V1R A;  2K3X A;  1CKA A;  2MMP A;  3QDF A;  3PMI A;  1YHQ A;  2DJQ A;  1I8F A;  5GMK e;  2RH2 A;  4M75 A;  4F7U G;  5LJ5 j;  2DLP A;  1X6O A;  3QWY A;  2COY A;  2RB6 A;  1VIF A;  4ORZ A;  4JS4 A;  4A4K A;  2DL4 A;  4ZGJ B;  3QG1 A;  1SHF A;  4Z89 A;  3JCM J;  2O31 A;  2VXE A;  1D0Z A;  2GQI A;  2C06 A;  2X3W D;  1HSQ A;  2HDA A;  5J26 A;  3X24 B;  4LN2 A;  1QMC A;  1QVG S;  3EFS A;  2VKN A;  4C92 D;  5FRO A;  4PFO A;  2P84 A;  3V7S A;  1Q7Y U;  4KGX B;  1NYF A;  2WSE E;  5CKB A;  3EG9 A;  2GNC A;  2DKG A;  4NOY A;  1V76 A;  2OJ2 A;  4X9C A;  4ZN3 A;  2M0Y A;  2O9S A;  1VQO Q;  1BI0 A;  3OYE A;  2ZCF B;  3VS7 A;  3VV0 A;  2BE7 D;  2M0O A;  2FRY A;  2VUB A;  3C4S A;  2FPD A;  3ER0 A;  3QYH B;  1GL5 A;  2OTJ Q;  7AT1 B;  3CCL T;  2EQI A;  3PTA A;  2MPX C;  3LW5 E;  2EYQ A;  4OMQ A;  2A37 A;  4F7U E;  3CD6 Q;  4M78 B;  1RAI B;  3EGX A;  1X6B A;  4J9B A;  4J9F A;  3UDC A;  1EFN A;  4MDX A;  3M0U A;  1GFD A;  4A4E A;  3BFM A;  2E1H A;  1RAC B;  2E6Z A;  1GCQ C;  2LT4 A;  1VYT A;  3DLM A;  1AT1 B;  4X34 A;  2EYW A;  4HCZ A;  2CT3 A;  1ABO A;  1I1J A;  2L3P A;  3SWN A;  1ZSZ A;  2E41 A;  2BE9 B;  2Y4X A;  3CBP A;  4X9D A;  4M78 F;  4HT9 A;  3HPW A;  3G4S Q;  3WVD B;  3U23 A;  3I56 Q;  4RTV A;  1Q95 G;  3SFM A;  3JRZ A;  3M0Q A;  4II1 A;  1FWZ A;  2LX9 A;  4C0D C;  3RDV A;  1M1F A;  3VS4 A;  1VQ7 T;  1IRE B;  4BB7 A;  1NG2 A;  2LJ0 A;  2YLB A;  2XIC A;  2EGE A;  3CCJ Q;  2VXF A;  2RQR A;  3NTH A;  1W2B P;  3LX7 A;  2DEQ A;  3MKD A;  3CMA A;  4XTZ A;  2AHJ B;  3PMT A;  5I2S A;  3JB9 J;  3LGL A;  6AT1 B;  3URG A;  3EGU A;  2XKO C;  4DQ2 A;  3V7C A;  2XK0 A;  1UB4 A;  2P0P A;  5KYN A;  2ED0 A;  1S72 T;  3DB3 A;  4J7F A;  1TXQ A;  2QAZ A;  2X4J A;  1JB0 E;  1OI1 A;  5HY6 A;  1OYX A;  2CT4 A;  3JCM e;  2MI6 A;  5GAN 4;  2DET A;  2PZ1 A;  2CH4 W;  3RKX A;  3X20 B;  1LOJ A;  1K8A R;  2X35 A;  1RI0 A;  4F7U B;  4R55 A;  4B6M A;  1YCS B;  4RKU E;  2KGT A;  3L1A A;  2AT1 B;  1VQN Q;  1YJN A;  3VS1 A;  2M9U A;  3CCE Q;  2COW A;  2D9T A;  2RPN A;  1VUB A;  3JSC A;  4FT4 A;  3Q1J A;  2QEX A;  2RJE A;  2RI5 A;  5GAN 7;  4L6V 5;  2V1Q A;  4FW2 A;  1LPL A;  2RMO A;  4F7U F;  5KYY B;  4M7A C;  4PLI A;  2DL3 A;  4M4Z A;  1MNE A;  3ULR B;  3H0H A;  3TSW A;  3KBG A;  2EQK A;  3MJX A;  3M4Y A;  4HVW A;  2DRM A;  1K8A C;  5CKD A;  2HQH A;  1X69 A;  2DIG A;  2YSQ A;  3EG1 A;  5GMK j;  3HRT A;  2DXB A;  2K2M A;  4E7J A;  2FEI A;  1UDL A;  5CKH A;  2HSP A;  1R0C B;  4JJD A;  4E2F B;  1LJO A;  1UFF A;  1VQP T;  2F5K A;  2J06 A;  3EFR A;  5FU7 C;  4JDS A;  3I5R A;  1J3T A;  4NL2 A;  2EIF A;  1YIJ T;  4GLM A;  4XTX A;  4FSS A;  5D6Y A;  3MPU B;  1G3S A;  3JB9 D;  3QJY A;  4XTW A;  4C92 G;  5KYW A;  2QXF A;  4KH1 B;  1JQQ A;  4XK8 E;  1H64 1;  3L2R A;  3QYG B;  3CPW A;  3PGG A;  2M51 A;  4F17 A;  4PLL A;  2P0Q A;  3CCL A;  4DA4 A;  4WTO B;  4RCC A;  1QQJ A;  5LJ5 d;  2KMT A;  5L23 A;  1WHM A;  2MYS A;  5J39 A;  4E7L A;  2QA4 T;  3CC7 T;  1M8V A;  1H8K A;  2HNI A;  1NYG A;  2F5T X;  2QQS A;  1YJW A;  1VQK T;  3S3O A;  1WQ7 A;  5GAO p;  4OGE A;  4WCI A;  1X2Q A;  4HVV A;  3EG2 A;  1UG1 A;  1DJ7 B;  3VUZ A;  3AHU A;  1Y96 A;  4PJO D;  5GAN 8;  3QZ9 B;  2KDS A;  2HL3 A;  3OS0 A;  3CCV Q;  3H0F A;  5GJV B;  2HD0 A;  2ZPF B;  3QO3 A;  1VQ6 Q;  1O9S A;  3OBY A;  1VQ7 A;  4JJC A;  4C92 E;  1YP5 A;  1M1K R;  1AWJ A;  3REB B;  3MEV A;  3OYD A;  1UE9 A;  2ED1 A;  2H8H A;  4BY6 B;  2XID A;  1ZUY A;  1W2B A;  1SEM A;  1M30 A;  5CVI A;  1B3Q A;  3M0S A;  2LCS A;  4IUT A;  2LZ6 B;  4CC3 A;  5CKF A;  2LQ8 A;  1QLY A;  4Z02 A;  1D09 B;  5IT9 E;  1OZ3 A;  1AD5 A;  1W4S A;  4L5G A;  4RCB A;  4C8Q C;  2DXT A;  4BD3 A;  1S72 A;  1I4K 1;  5HK0 A;  3M55 A;  2K79 A;  4AG2 C;  1M1K C;  4M77 C;  5GAM e;  4XQ3 A;  2OTL Q;  3M0P A;  1RAE B;  2DVE A;  3VYH B;  1ZQ1 A;  3OMC A;  4RMO A;  3RES A;  1G3W A;  2GFU A;  3CD6 T;  1XOV A;  3CEY A;  2DL8 A;  1S1N A;  3ZBD A;  4BUG A;  3M0R A;  1VQ9 A;  1VQ8 T;  2L5Q A;  3I55 T;  2VC8 A;  4N4G A;  3JCM c;  2KRN A;  3E19 A;  2EAY A;  1GBQ A;  4O6J A;  1X43 A;  2KQW A;  5FRM A;  4Y28 E;  2DD5 A;  3ASK A;  1K9M R;  4KGV B;  3PVQ A;  2FZG B;  5GAN f;  1IXD A;  4HCK A;  3G4S T;  5FU6 B;  2QI2 A;  1T3S A;  4MZM A;  4LXC A;  3GP8 A;  2WSF E;  1ARK A;  3LH5 A;  1TU0 B;  1K0X A;  2QTX A;  5DM7 R;  4C92 B;  1SRL A;  4CC2 A;  3MP1 A;  4LNP A;  3GPL A;  1YHQ T;  2EQM A;  3LWH A;  3JCM g;  2HKQ B;  3RMS A;  2YDL A;  2JS0 A;  4JZ4 A;  3BW1 A;  1VQP A;  3D7S B;  2XHC A;  1N9S A;  2KVQ G;  2YUQ A;  1K9M C;  4C92 F;  2EBP A;  4F14 A;  5LJ3 e;  1K8A U;  1JXM A;  2E65 A;  1JEG A;  1YIJ A;  1C0M A;  2O4X A;  3L2Q A;  9ATC B;  2KT8 A;  3UA6 A;  4PJJ A;  2VV5 A;  3CXC S;  1JBM A;  2KEA A;  2P0K A;  3JB9 G;  2BUD A;  3RBB B;  5GAO n;  2LJ3 A;  1YJ9 Q;  3EH1 A;  1I5L A;  3A1P A;  1NEB A;  3RKY A;  1GCQ A;  3CPF A;  4J6W A;  1VQN T;  2AZS A;  3L2Z A;  1ZBJ A;  2FZC B;  5FW9 A;  2ROT A;  2KR3 A;  5L8R E;  1K1Z A;  1C6V X;  5GAN 2;  3R6O A;  4RG2 A;  1UGR B;  3S3N A;  4QVC A;  4LUE A;  2O2O A;  4MML A;  2EYX A;  5GMK i;  3CC7 A;  1VQM Q;  2CH4 A;  2GFA A;  5IN1 A;  1VQK A;  1TSF A;  4B9X A;  4XTY A;  4EIK A;  2PVG B;  3CCQ Q;  1RUW A;  2DA9 A;  2WSC E;  4HKE A;  1WXT A;  1QKW A;  2K5I A;  1Y71 A;  2CP3 A;  4N0A C;  1ZA2 B;  2RHZ A;  2A3L A;  2LCL A;  1KD1 R;  3I9Q A;  2A08 A;  1CSK A;  4FL6 A;  2JTE A;  2YUO A;  4Z88 A;  4M7D D;  4PJO G;  2NWM A;  2LQW A;  1BIB A;  2M02 A;  4C0G A;  4OB0 B;  3OW2 S;  2KBT A;  1Y7X A;  2ZPH B;  2GF7 A;  4HXJ A;  1N5Z A;  5J3B A;  4E7Z A;  4JRI A;  3VS6 A;  4DEX A;  2JM8 A;  1WHH A;  1JXO A;  2RO0 A;  4J6Y A;  1OV3 A;  1MV0 B;  4IUV A;  5GAN h;  2K2V A;  5HCK A;  4OMM A;  2OAU A;  2F2W A;  1KD1 C;  2DVJ A;  5GAO l;  4GY5 A;  1NZ9 A;  5GJW B;  1TG0 A;  4WF2 A;  2D6F A;  2JOY A;  2LQK A;  2K3Y A;  4X1V A;  2ZPB B;  2EKO A;  1TOV A;  5ECA A;  1KG1 A;  1K73 R;  4ELY C;  1PRL C;  4V2S A;  5GAM j;  3G6E T;  5GAN 6;  1WJQ A;  5IXF A;  5KYX B;  5DLO A;  1YI2 T;  3EHR A;  3GLX A;  3HRU A;  4M7A A;  2CZ7 B;  4GBQ A;  3CD6 A;  3G7Z A;  5M9O A;  5FWB A;  2L2P A;  1X01 A;  4J8O A;  3OYN A;  1WLP B;  2DZC A;  3I55 A;  2JW4 A;  1YJN T;  4IUQ A;  5A0D A;  4A4F A;  3OYL A;  1M1K U;  3CBM A;  4XTU A;  2YLC A;  3X26 B;  2QEX T;  4PJO E;  2EYZ A;  1U5S A;  2GCX A;  1QWF A;  3G4S A;  3CCM T;  1F1B B;  2FPF A;  3A5Z B;  4J9D A;  1K73 C;  2J6O A;  2PTK A;  1VQ6 T;  2V8K A;  1AWO A;  3GBQ A;  4JJN K;  4MDW A;  1O75 A;  5A2Q E;  3CCJ A;  2C0O A;  2G3R A;  3UF4 A;  2RM4 A;  3JAM E;  1EX4 A;  1M5Q 1;  2PUO B;  5I21 A;  1AHJ B;  1RLQ C;  2R58 A;  3VRY A;  2LMJ A;  2HQX A;  3AT1 B;  3UA7 A;  1B7T A;  1X27 A;  1RI9 A;  2HQE A;  3JCM d;  1M2V B;  4RTZ A;  4GLK A;  3JB9 F;  1RAA B;  5LJ3 j;  2LNH B; 
#chains in the Genus database with same CATH homology
 4QW2 A;  3QUI A;  3N5B B;  3O8V A;  2LTO A;  1VUB A;  4UC4 A;  2DTI A;  3JSC A;  3EAE A;  4FT4 A;  3HFN A;  3Q1J A;  3SWN C;  3M4G A;  2QEX A;  2RJE A;  2RI5 A;  4CRI A;  3JCM X;  5GAN 7;  4L6V 5;  1PSE A;  3VKI A;  5GAN g;  2OTL T;  2CZ1 B;  3FB9 A;  3PFS A;  1NJI C;  4F7U F;  3CBO A;  1G5V A;  4M7A C;  4PLI A;  2EQJ A;  1B34 B;  1K9M U;  3RKW A;  5A0L A;  4V2S A;  1M9S A;  2BIV A;  3KBG A;  4VUB A;  5LJ5 g;  1UGP B;  2DIQ A;  2EQK A;  4OB3 B;  3M4Y A;  3E1S A;  3V8J A;  4HT8 A;  1NPP A;  2V8I A;  3P8D A;  4BI3 A;  4LDV A;  1K8A C;  5CKD A;  1VQN A;  2X4Y A;  2KY9 A;  3TEE A;  3QSU A;  3P8H A;  2DIG A;  2JN0 A;  4E7I A;  1QP3 A;  2Y4Y A;  5GMK j;  3HRT A;  1WJS A;  2RHI A;  2EFI A;  4DOW A;  4J7I A;  2DXB A;  5CK9 A;  3CC2 T;  4E7J A;  2LDM A;  2LNV A;  5CKH A;  3CC4 A;  2PU9 B;  3OA6 A;  1VQP T;  1LJO A;  1KHC A;  3E9G A;  2F5K A;  2JVV A;  3EFR A;  3JCM Q;  4PJO B;  2QQR A;  2O4X B;  5FU7 C;  3SD4 A;  1KQ1 A;  1BI1 A;  1M1G A;  5CQY A;  5A0G A;  1W2B S;  4BE0 A;  4JDS A;  3FIF A;  1GXI E;  1G3Y A;  1VQO A;  1XNI A;  4M75 G;  5I2M A;  2DTO A;  4NL2 A;  3M53 A;  1YJW T;  2EIF A;  5FU6 C;  1YIJ T;  4XTX A;  5D6Y A;  3KXT A;  1NPR A;  1G3S A;  3GNG A;  3JB9 D;  1UEB A;  4F7U A;  3L2U A;  3QJY A;  3PIP A;  3SDZ A;  1M4Z A;  4XTW A;  4C92 G;  2OTJ A;  3OYY A;  2O01 E;  3QKJ A;  4QVD A;  3JCM W;  1Q81 U;  1VIE A;  4ME7 A;  5CQX A;  4PJO F;  4C92 C;  1VQ4 A;  1YIT T;  4LD9 K;  2QXF A;  2MF2 A;  4A4G A;  3TU4 K;  4M75 B;  1JJ2 A;  2JNG A;  2KSS A;  3C12 A;  4KT0 E;  4XK8 E;  1H64 1;  3S6W A;  3S3M A;  4C5I A;  3L2R A;  5KCH A;  5LJ5 e;  5LJ5 f;  5GMK l;  3JCM V;  3T9N A;  3QYG B;  4B9W A;  2RA2 A;  4C8Q A;  3CPW A;  3ME9 A;  1PSF A;  1HXD A;  3PGG A;  3MO8 A;  1BIA A;  3LGF A;  3H8Z A;  3QBY A;  4PLL A;  2PVO B;  4M7A E;  2E6N A;  1Q7Y C;  1FXX A;  4XU2 A;  2P0Q A;  4BE1 A;  5HK3 A;  3CCL A;  2KAF A;  4DA4 A;  1H3Z A;  4M7D G;  4C5H A;  5EG2 A;  1N27 A;  4M77 A;  3CC2 A;  4C0D B;  4OMF B;  2DPP B;  3CCU A;  4JRK A;  2QQB A;  5D6W A;  4M7D C;  2RHY A;  4RCC A;  2M16 A;  2IG0 A;  2CGH A;  3DB4 A;  3QXE B;  4OGC A;  4PL6 A;  3P8B B;  5LJ5 d;  4LDW A;  2KMT A;  2KK4 A;  2FB7 A;  5J39 A;  3I56 A;  5KCO A;  3CCV T;  3UPU A;  4E7L A;  2QA4 T;  1N8R C;  3CC7 T;  3JB9 F;  1M8V A;  2LVM A;  2PVD B;  3OSV A;  1G3T A;  1Y07 A;  2HNI A;  1RL2 A;  2F5T X;  2QQS A;  2RHU A;  2PQW A;  1YJW A;  1VQK T;  3S3O A;  4OB2 B;  4PJO A;  4ZTJ A;  1WQ7 A;  3GF5 A;  3X28 B;  2L89 A;  2JTF A;  2JUF A;  3KUF A;  4KUI A;  4M78 A;  4OGE A;  4A54 A;  5GAO p;  5CCA A;  2JZ2 A;  3RUX A;  3BY7 A;  5GAM g;  4XTV A;  4FU6 A;  2JTM A;  3JCM h;  1DJ7 B;  2LCC A;  4IUU A;  3VUZ A;  3AHU A;  1Y96 A;  3G6E A;  1YI2 A;  4M75 E;  5GAN 8;  2XDB A;  2WAC A;  3QZ9 B;  4PJO D;  4OF1 A;  2KDS A;  4BDY A;  3OS0 A;  2VYT A;  1UGS B;  1R8O B;  2HD0 A;  2ZPF B;  4XU3 A;  3UT1 A;  3QO3 A;  1M90 U;  1O9S A;  2EJG A;  3OBY A;  5GAO m;  1KD1 U;  1VQ7 A;  1VQL T;  4C92 E;  4NL3 A;  3OS2 A;  4MMK A;  1KQ2 A;  4TVR A;  3MEV A;  3HL8 A;  1VQ9 T;  1KQS S;  3OYD A;  1U1T A;  3CCQ T;  3GNF B;  3CME A;  4BY6 B;  2XID A;  1MGQ A;  1W2B A;  1WQW A;  5CVI A;  2K5F A;  1SSF A;  2F69 A;  4E7K A;  3QJ6 A;  4Y91 A;  1Q86 U;  3TRE A;  4IUT A;  2RI3 A;  4LDX A;  3OYI A;  4M7A G;  1U1S A;  3HHT B;  3CCM A;  5CKF A;  2LQ8 A;  3LH0 A;  2RJD A;  1WGS A;  2LRQ A;  3INZ A;  5DLQ E;  4CI0 C;  2QA4 A;  2RHX A;  4Z02 A;  5KH6 A;  5IT9 E;  4C8Q G;  1OZ3 A;  4M7D E;  1VQ6 A;  1W4S A;  4C0Z A;  4L5G A;  5IAY A;  3SWN B;  2RK1 A;  4RCB A;  4C8Q C;  1QVF S;  2DXT A;  2K57 A;  4N4H A;  5GAO r;  3QII A;  1QP2 A;  4BD3 A;  5GAO q;  3LWI A;  1S72 A;  1I4K 1;  3OB9 A;  5HK0 A;  1BI3 A;  2K5L A;  3M55 A;  1VQ5 T;  4M77 G;  4JRQ A;  4M7A B;  3CCE A;  4M77 C;  1M1K C;  5GAM e;  5GAM f;  2RJF A;  4MZP A;  4XQ3 A;  2B8A A;  3RMQ A;  5HKC A;  2CKK A;  3FC3 A;  2DVE A;  4BI8 B;  2MWP A;  3FJP A;  3VYH B;  2D0Q B;  3M56 A;  1ZQ1 A;  3OMC A;  4J6X A;  3OYC A;  4RMO A;  3RES A;  1K73 U;  4FSX A;  2P4T A;  1YBY A;  3V8L A;  1G3W A;  2GFU A;  3CD6 T;  1XOV A;  3CEY A;  3OSS C;  4QQG A;  3CCS T;  4HCB A;  4QVZ A;  2NLU A;  3WXM B;  4BUG A;  3ZBD A;  4P5N A;  3JB9 H;  3VUB A;  5LJ3 g;  2E10 A;  5FRN A;  4M78 G;  1NE8 A;  5GAM d;  1VQ9 A;  1I81 A;  2L5Q A;  1VQ8 T;  3I55 T;  2RI2 A;  4M7A F;  2VC8 A;  4M78 C;  4N4G A;  3JCM c;  2FHD A;  3E19 A;  3A8L B;  2EAY A;  3MP6 A;  4O6J A;  1Q82 C;  1KC8 C;  2KQW A;  4EMK C;  4Y28 E;  3JB9 I;  1WNL A;  3M58 A;  4C0F A;  5FRM A;  5FU7 B;  3OBW A;  2DD5 A;  3OYH A;  3CMA T;  3ASK A;  4LD6 A;  1FX7 A;  3M54 A;  4LDY A;  2OTL A;  3C95 A;  5GAN e;  2DXU A;  5GAN f;  5FLX E;  2FL7 A;  3V7R A;  2ZZD A;  5FU6 B;  3G4S T;  2QI2 A;  4EMH A;  3OS1 A;  4MZT A;  4MZM A;  4RG8 A;  3OMG A;  3MP8 A;  3GP8 A;  2WSF E;  4J83 A;  3J81 E;  2RK2 A;  3QDR B;  5CIU A;  2QQA A;  4Q5W A;  2QTX A;  5LJ5 h;  1BKB A;  4EDU A;  5DM7 R;  2DD4 A;  4C92 B;  1BYM A;  4C5E A;  3MP1 A;  1EIF A;  2V8J A;  1D3B B;  3GPL A;  1YHQ T;  2EQM A;  3FRN A;  1B34 A;  4EPC A;  2XG8 D;  3LWH A;  1BI2 A;  3OS5 A;  4YTL A;  4KBM B;  3JCM g;  2FYK A;  2LC4 A;  5GAN d;  3J80 E;  2HAX A;  3RMS A;  2R5M A;  2E64 A;  3A8M B;  4A53 A;  4C8Q E;  2XU8 A;  4N0A A;  2I2L A;  3BW1 A;  4M75 F;  1NJI U;  2EQU A;  1KQS A;  1VQP A;  3PIO A;  2XHC A;  1N9S A;  2KVQ G;  1U8R A;  1UGQ B;  4M77 E;  3CCS A;  3HP9 A;  1V29 B;  1WJR A;  4JRP A;  1K9M C;  4C92 F;  3A8H B;  3NTK A;  4ZTF A;  5LJ3 e;  2DO3 A;  5LJ3 f;  1K8A U;  2E65 A;  3G71 T;  1YJ9 T;  1VQ8 A;  3MET A;  4IUP A;  3MHX A;  4DOV A;  4ATO A;  4M7D B;  1YIJ A;  2HBP A;  3FDR A;  2A7Y A;  2BKD N;  3CCR T;  1KHI A;  2O4X A;  1MHN A;  2R57 A;  2EJF A;  3LYI A;  3L2Q A;  4ZGE B;  2E5Q A;  1QVP A;  4M7A D;  3A8O B;  4J5Y A;  2QDY B;  4KUL A;  1XTD A;  2VV5 A;  2L3R A;  5CAI A;  1QVF A;  1YIT A;  3CXC S;  1JBM A;  2P0K A;  4L59 A;  4ELZ C;  5C6S A;  4M78 E;  3JB9 G;  2BUD A;  2IVW A;  3VYG A;  2FVU A;  4JUV A;  4XU0 A;  4IKF A;  5C0M A;  3HKS A;  5GAO n;  4M7D F;  2K3X A;  2MMP A;  1I5L A;  3PMI A;  1N9R A;  4KUD K;  2EWN A;  1VQM T;  1ZBX A;  1YHQ A;  1I8F A;  3RKY A;  5GMK e;  2RH2 A;  3BDU A;  3BDL A;  3CPF A;  1JRI A;  4J6W A;  4M75 A;  4F7U G;  5LJ5 j;  3L2V A;  1VQN T;  1P92 A;  1X6O A;  3L2W A;  2MWO A;  3L2Z A;  2RB6 A;  1VIF A;  4JS4 A;  3GOX A;  3ZEH A;  1X75 C;  4HA8 A;  4C92 A;  4E47 A;  5L8R E;  4A4K A;  1IZ6 A;  3X25 B;  1Q81 C;  2YHT A;  4FT2 A;  4FM4 B;  4ZGJ B;  1N6A A;  4M75 D;  3QG1 A;  5GAN 2;  3CC4 T;  3R6O A;  3JCM J;  4RG2 A;  2VXE A;  4IUR A;  3OYB A;  1UGR B;  2E12 A;  3S3N A;  4QVC A;  2C06 A;  2RJC A;  3QHS A;  3CCV A;  5GMK m;  5J26 A;  4MML A;  3X24 B;  3WVE B;  5GMK i;  5D6X A;  2GFA A;  3M59 A;  4PNO A;  3CC7 A;  1YJ9 A;  1QVG S;  3EFS A;  4C92 D;  1WPY A;  5IN1 A;  1VQO T;  4B9X A;  3MEW A;  2GQV A;  4XTY A;  3C94 A;  5FRO A;  4D6W A;  1VQK A;  2PVG B;  3F70 A;  4BE2 A;  2WSC E;  4HKE A;  1Q7Y U;  3V7S A;  2K5I A;  2ZPG B;  2WSE E;  1Y71 A;  2MAM A;  3FLG A;  2DTH A;  3RER A;  3M9Q A;  4JLI A;  5CKB A;  2OTJ T;  3OYK A;  2XDD A;  4BDZ A;  4M7D A;  4N0A C;  5GAM h;  4HCC A;  3M5A A;  2CZ0 B;  2RHZ A;  3OY9 A;  2A3L A;  1VQ4 T;  2DKG A;  2DK3 A;  2LCL A;  4C8Q B;  4NOY A;  4X9C A;  4FL6 A;  3JCM P;  1N8R U;  4ZN3 A;  1BI0 A;  2XDP A;  3L42 A;  3OYE A;  2ZCF B;  3HFO A;  4A4H A;  1VQL A;  4M77 B;  4M7D D;  3VV0 A;  4PJO G;  1XQH A;  1VQM A;  2M0O A;  2VUB A;  3ER0 A;  3C4S A;  1BIB A;  3QYH B;  4C0G A;  4PJO C;  3FEO A;  3MEA A;  3DKM A;  4OB0 B;  1Y7X A;  3RIR A;  2ZPH B;  3CCQ A;  3OW2 S;  2GF7 A;  5J3B A;  3MCA B;  3CCL T;  3J7A F;  3OQ5 A;  4JRI A;  2CYZ B;  2CS7 A;  4C8Q F;  5GAN 5;  3CCU T;  3PTA A;  3LW5 E;  5GAN 3;  2EYQ A;  2RO0 A;  4J6Y A;  5CR2 A;  3OYA A;  4IUV A;  3HRS A;  4F7U E;  5GAN h;  4M77 F;  2K2V A;  4M78 B;  3SB2 A;  4BI4 A;  4EMG A;  3UDC A;  2VGM A;  2OAU A;  3H6Z A;  4OVA A;  3ZFJ A;  4A4E A;  3I56 T;  4MDX A;  3BFM A;  4N4I A;  4C5G A;  1M90 C;  4QQ6 A;  4EMK B;  2E1H A;  1KD1 C;  5GAO l;  3E9F A;  3CXC A;  2E6Z A;  2H3J A;  4M75 C;  2LT4 A;  3DLM A;  4GY5 A;  1NZ9 A;  1Y96 B;  4X34 A;  4ZGD B;  1VQ5 A;  2DJZ A;  3QPH A;  4OB1 B;  4WF2 A;  2D6F A;  4HCZ A;  2JOY A;  2DAQ A;  1TH7 A;  2LQK A;  2R5A A;  2K3Y A;  1HK9 A;  2ZPB B;  3HSB A;  2EKO A;  2Y90 A;  3CCJ T;  1KG1 A;  3SWN A;  3PNW C;  5KE3 A;  2E41 A;  2Y4X A;  2CZ6 B;  3CBP A;  4ELY C;  4OP0 A;  2M1H A;  4X9D A;  3DLL A;  4M78 F;  5GAM j;  3HPW A;  1WJQ A;  5GAN 6;  5DLO A;  3G6E T;  1YI2 T;  1Q86 C;  4HT9 A;  3WVD B;  3VJP A;  2ZPI B;  1LNX A;  1YCY A;  3JRZ A;  3GLX A;  3HRU A;  3SFM A;  2CZ7 B;  4II1 A;  4M7A A;  1FWZ A;  2LX9 A;  4C0D C;  3CD6 A;  3G7Z A;  1M1F A;  3PT9 A;  5M9O A;  4FIB A;  4XU1 A;  1VQ7 T;  1IRE B;  1X01 A;  4J8O A;  2LT1 A;  4PKC C;  3OYN A;  4XAX B;  4BB7 A;  3OYG A;  4R56 A;  2DZC A;  2YLB A;  2VGN A;  5LJ3 h;  3I55 A;  2XD0 A;  2XIC A;  1YJN T;  4IUQ A;  5A0D A;  4A4F A;  1M1K U;  2VXF A;  2EJ9 A;  5AYF A;  3OYL A;  3NTH A;  3CME T;  3MEU A;  1QW1 A;  3CBM A;  3LLR A;  3LX7 A;  2DZ9 A;  4XTU A;  3JCM b;  3OYF A;  5DY9 A;  1QVG A;  2QQ9 A;  2DEQ A;  3GIB A;  3CMA A;  2YLC A;  4XTZ A;  2AHJ B;  3X26 B;  2ZGW A;  4C8Q D;  2QEX T;  4PJO E;  4E7H A;  3PMT A;  5I2S A;  3JB9 J;  3LGL A;  2GCX A;  2L8D A;  3G4S A;  5LJ3 d;  3URG A;  3CCM T;  3NFC A;  2XKO C;  4M77 D;  3TCJ A;  3A5Z B;  4ZN1 A;  5GAN j;  4DQ2 A;  1K73 C;  4JLG A;  3V7C A;  3A8G B;  2XK0 A;  1UB4 A;  1VQ6 T;  3VU3 C;  2K4Y A;  2P0P A;  2PUK B;  2V8K A;  3OYM A;  1S72 T;  5CO7 A;  4JJN K;  1ZHI A;  1Q82 U;  2E70 A;  3DB3 A;  4MDW A;  1O75 A;  5GMK h;  1KC8 U;  1JJ2 S;  2XI9 A;  2X4J A;  2X4X A;  4J7F A;  5A2Q E;  3CCJ A;  4EMK A;  1JB0 E;  1OI1 A;  2G3R A;  1OYX A;  3M57 A;  5HY6 A;  3JCM f;  3JCM e;  3CCE T;  2RM4 A;  2RD1 A;  5CKE A;  1OZ2 A;  2MI6 A;  3V8K A;  5GAN 4;  4O5V A;  4NS5 A;  1D3B A;  3CPW S;  2X4W A;  3JAM E;  1M5Q 1;  4M78 D;  2PUO B;  4JS5 A;  3OW2 A;  4BY6 C;  3RKX A;  3X20 B;  5I21 A;  1LOJ A;  3OYJ A;  2YRV A;  4BAC A;  1AHJ B;  2X35 A;  2R58 A;  1RI0 A;  3QZ5 B;  4F7U B;  2HQX A;  5KE2 A;  4R55 A;  2DXC A;  4RKU E;  4LDU A;  3L1A A;  3G71 A;  2HQE A;  3NTI A;  3JCM d;  4QQD A;  1YJN A;  2M9U A;  5LL6 S;  4GLK A;  3UWN A;  3CCR A;  2ZPE B;  5LJ3 j;  2D9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...