2JOYA

Nmr structure of 50s ribosomal protein l14e from sulfolobus solfataricus: northeast structural genomics consortium target ssr105
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
96
structure length
96
Chain Sequence
MPAIEVGRICVKVKGREAGSKCVIVDIIDDNFVLVTGPKDITGVKRRRVNILHLEPTDKKIDIQKGASDEEVKKKLEESNLTEYMKEKIKIRMPTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L14e
publication title NMR Structure of 50S Ribosomal Protein L14e; Northeast Structural Genomics Consortium Target SSR105
rcsb
source organism Sulfolobus solfataricus
molecule tags Structural genomics, unknown function
total genus 18
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2joyA01
2CKKA 3CCJA 3I56T 1S72A 3CC2T 1YBYA 2EIFA 2JNGA 3CCJT 1NJIU 4CRIA 2OTLT 3CD6T 1VQLT 3G4SA 1YIJA 1M90C 3LGLA 1NZ9A 5IT9E 3DB4A 1VQOT 1EIFA 2DO3A 1Q7YU 3CPWA 1YHQT 1NJIC 1XNIA 3OYYA 3CCEA 1QVGA 2QEXT 1VQNA 1W2BA 2JVVA 1Q7YC 3PIPA 1VQNT 1KHIA 1VQ5A 3LH0A 1VQKT 2JOYA 2MWOA 1UEBA 1M90U 1VQ5T 3CMET 1KD1U 3CCSA 1JJ2A 1QVFA 2L3RA 1NPRA 3CCST 1S72T 1SSFA 3G6EA 1VQ8A 3G4ST 1KD1C 1YIJT 1VQ8T 1K8AC 3CCLA 4YTLA 2OTJA 3A5ZB 1YJNA 3CPWS 1N8RU 1YJNT 3ER0A 3CCET 2LQ8A 3CCUA 1QVGS 1VQMA 1NPPA 1W2BS 2G3RA 3CXCA 1K9MU 1VQPA 5DM7R 1N8RC 1KQSA 3CCMA 1VQPT 4ZN1A 1M1GA 1VQ4A 1K73U 1KC8U 1VQ6A 5J3BA 1YI2A 1K8AU 3G71A 1K9MC 1YI2T 2E70A 1JJ2S 1QVFS 3CC7A 3I55A 3CMAA 3J80E 1Q86C 3OW2A 1K73C 3KBGA 3I55T 3CC7T 1XTDA 1Q82U 1KC8C 3CMAT 3G6ET 3CCRA 3TREA 4ZN3A 3CC4A 1YJWA 1RL2A 1X6OA 3CCQA 1VQ7A 2QA4A 2XHCA 5LL6S 5FLXE 3JAME 3CCLT 2OTJT 5J26A 1YITA 3P8BB 3CCVA 2MWPA 5A2QE 1Q82C 3CC2A 1YITT 3CCVT 3CCUT 2KDSA 1BKBA 1VQMT 2OTLA 1VQLA 3CD6A 4RG2A 1Q81U 1Q86U 3DB3A 4X34A 3CXCS 4QQDA 5DLQE 1YJ9A 1M1KU 3J7AF 3LGFA 3CCMT 1VQOA 1KQSS 1VQ9A 2LCLA 1VQ4T 1YJ9T 4TVRA 1YHQA 1VQ6T 1VQ9T 3CPFA 3G71T 2E6ZA 3DLLA 1Q81C 2LVMA 1M1KC 2MI6A 2QEXA 1IZ6A 3PIOA 5IAYA 3OW2S 5HY6A 3CCRT 3CC4T 3J81E 1VQKA 1YJWT 2JUFA 3CCQT 2KVQG 1VQ7T 2QA4T 3CMEA 2IG0A 3I56A 3HKSA
chains in the Genus database with same CATH superfamily
1VQNQ 3HPWA 1FMVA 1S72A 1NBEB 3RKWA 2A08A 3JCMh 3S3OA 2HMAA 2F69A 4N4GA 1K0SA 3EG2A 2FEIA 2DO3A 3OYFA 1NYGA 1FWZA 2KT1A 2R58A 1WQWA 1BI0A 3OW2P 2O01E 1PCXA 1VQNA 2DBKA 2IIMA 2RJDA 3NTIA 3VYHB 1Q86R 1C1AA 3M4YA 3VV0A 5KYUA 1ABOA 3OYBA 2GQIA 2YUOA 4D8DA 1U1TA 1E6HA 1VYTA 3SEMA 4OB1B 1RLPC 1U1SA 2AKKA 2FB7A 2RHZA 4M75C 3REBB 1JRIA 1N8RU 3KUFA 1M3CA 4BY6C 3CC7Q 1PHTA 2O31A 5GANe 4M7AF 2LMJA 1I4K1 4QQ6A 4DEYA 1M1GA 5KYWA 1I1JA 1WXTA 2HQEA 3CCUQ 1TH7A 4XTXA 2VC8A 4CI0C 1AT1B 2DXTA 1QVFS 1WI7A 3CC7A 3J80E 1QKXA 2K5LA 1Q82U 2C06A 2C0OA 2X4JA 3VRYA 2CP5A 4ORZA 1M90R 2K5FA 1VQ7A 1BK2A 3OYHA 3TSZA 1X75C 2DETA 1HXDA 4RTTA 2HQXA 3FJ5A 5A0LA 1WIEA 3META 3QSUA 1Q81U 1K4US 1OZ2A 3V7RA 2DRKA 2BTTA 1TG0A 1R77A 2FL7A 3CC2Q 4OMNA 3LYIA 2JW4A 4F7UA 5HK3A 1NLPC 5IN1A 1BI1A 1B3QA 5KYUB 3SHWA 2KMTA 5LJ3j 1Y57A 3CCRT 1K8AR 8ATCB 4HCCA 4XTYA 3HRTA 3H0IA 1W4SA 3RIRA 1I07A 1HYOA 4J5YA 4E7KA 3X25B 3M0PA 1ZX6A 3G4SA 1I5OB 1YIJA 2GBQA 3OYAA 3QIIA 4F7UE 1AWWA 3CPWA 1CSKA 3JRZA 4Y28E 2DXCA 5GANg 1V1CA 4JJCA 2QEXT 2JVVA 2I0NA 4NL2A 1PKSA 1VQKT 2LNVA 1QW1A 2DZ9A 3QXEB 2HKNA 3CMET 1KD1U 5IHIA 4AFUC 4RTZA 2BZ8A 4R56A 4LD6A 1VUBA 1IHVA 1SSFA 2C0IA 2RA2A 5DY9A 5LJ3f 2HSEB 2DL8A 2LNHB 2EQKA 2MCNA 2D0QB 4HCBA 4PK4A 1Y07A 1MUZA 2XDBA 5FROA 2PUOB 1ZSZA 2Y90A 5DM7R 2VUBA 3SB2A 1PG5B 1KG1A 2RI3A 3HTRA 2DKGA 4A4KA 3QUIA 3GP8A 4QQGA 1K9MC 5IXFA 4J9GA 1H3ZA 3C4SA 5CCAA 4Y92A 1HSQA 5GAMg 3OW2A 1LVKA 4ZGEB 2PVOB 1IGUA 1VQ9Q 2A37A 4E47A 2YRVA 1YWPA 2V8IA 1IREB 2OTJT 3S6WA 1NJIR 1HJDA 3AHUA 3BW1A 3PTAA 3A8GB 1TU0B 5LJ5j 4M77G 1AVZC 4O5VA 4JDSA 3DB3A 2RQRA 2LZ6B 3X24B 3GPLA 4ZTJA 2V26A 1VQ9A 1OPLA 2DAQA 1FX7A 5I2MA 3C94A 5I2SA 1B7TA 1J3TA 1OU8A 2QQRA 3MP8A 4A63B 2M16A 4ANJA 2E5KA 3OBWA 2HNIA 2ECZA 1W1FA 2M9UA 4E7HA 1AZGB 1KQSP 1TS9A 4WTOB 5KE3A 1VQLT 5GAMd 1MMAA 1OV3A 1VQOT 2CDTA 1NEBA 1D0XA 3EGDB 2OAWA 1RI0A 2E10A 2RJFA 2CUDA 4DBHA 3A1PA 4C5IA 1VQ8Q 1GRIA 5LJ5f 1ZSZC 2YUQA 5IHKA 2E1HA 2JOYA 4IKFA 2F5TX 4KULA 4EPCA 2DFUA 4C5GA 2NUPA 1D0ZA 1OULA 1MHNA 1VQ8A 1UHFA 2IPOB 4HT9A 1KJWA 1GBQA 1M2VA 3CPWS 1X01A 2XDPA 3CCET 2YLCA 5D6YA 2PQWA 1R0BG 3F70A 2DIGA 2G3RA 4JS5A 2ATCB 4JJDA 4KRTA 5GANh 3L2WA 3VRZA 2GFAA 1KC8U 3QHSA 3ULRB 1X2QA 4DEXA 2CP7A 5L8RE 1UECA 3I55A 4FW1A 3CMAT 3H6ZA 2JN0A 1OEBA 2AT1B 3FLGA 4ZN3A 3QO3A 3R6OA 3M58A 3UWNA 2NWMA 2J6OA 5GAOm 3VKIA 5D6XA 2K6DA 4M4ZA 1Q7YR 3OMGA 2QA4Q 1PSFA 2RB6A 2FG0A 4BE0A 4CC7A 4JZ4A 2MI6A 2DYIA 1LOJA 1E7OA 2DA9A 1UJ0A 4ZGJB 4ZNXA 4Z8AA 3OW2S 3QPHA 4PLLA 1UDLA 2EYZA 2P0PA 2IG0A 2CP6A 3HKSA 2COWA 2K9GA 3A98A 1NJIU 1G8XA 2MOXA 1M5Q1 2DJQA 2DL5A 3LGLA 2LX7A 1SHFA 4Y91A 2GFUA 2CH4W 4C92B 4RG8A 2CH4A 4Q5WA 1WXUA 2G6FX 2FRWA 4PJOD 2JTEA 1VQ5T 2P4TA 2GQVA 4J9DA 1OZ3A 2JT4A 1KHCA 3UPUA 1FMWA 4PL6A 4XTUA 2PUKB 5I22A 1XQHA 2RMOA 4E6RA 1N27A 3RR6A 4J8OA 4JUVA 4F7UG 2QK0A 2ZPFB 3P8HA 3RKXA 1QCFA 2EKHA 2ZCFB 3JV3A 3HSBA 2QTXA 1MMNA 1PD0A 1D09B 4M78D 1KQSA 4LN2A 2L0AA 4ZN1A 5J39A 1QWEA 5J3BA 2L89A 3ZL7C 2HSPA 1SG5A 1VQMQ 1GFDA 4E2FB 1G3YA 3D7SB 2RHIA 1VQ4Q 3CCRA 1B34A 1QCOA 4OB2B 2RHYA 3M4GA 3G71Q 2FPDA 3RESA 2NYSA 2CREA 2VKNA 2YUPA 4RG2A 4A4HA 1MNEA 4TVRA 2PVGB 1WQ7A 3RMQA 1R0CB 1ZSGA 2QEXA 3PIOA 4LD9K 1K73R 1VQKA 2MMPA 3C12A 3CMEA 4M75D 4WCIA 4C0GA 2J06A 1N9SA 1RI9A 1BCMA 1UJYA 4JLIA 3GLXA 4X9DA 3L2RA 4O6JA 4CRIA 4C92F 3QDFA 1T0JA 3NTHA 4HKEA 2E6NA 2KT8A 3SWNA 5GAMj 1Q7YU 3JB9J 4Z89A 4AG2C 3NHNA 2J7IA 1O75A 4PJOA 3QZ5B 1D1AA 2DVJA 2MWOA 1UEBA 1H8KA 1AWXA 2JM8A 4ME7A 4M7DE 2LC4A 4A4FA 1B34B 1M3AA 3ZEHA 3VS0A 2OTJA 4C8QD 1X43A 3JCMd 1F1BB 4M78A 3G6EQ 1M1KR 3I35A 2BZXA 1ZLMA 1QLYA 4DOWA 4WF2A 1NYFA 2DYBA 2LJ3A 3C95A 5KYXA 1RAFB 2CZ7B 2H3JA 7AT1B 3E2UA 2E4HA 2BIVA 3HFOA 1YJ9Q 2VXEA 4M78E 4JS4A 3JAME 1OQKA 1UGSB 5J26A 1RADB 2YUNA 3CCVT 2F2WA 2GNCA 4J9EA 1JXOA 5KYYA 2LTOA 2X3XD 1VQLA 2VV5A 1HD3A 4BI3A 1YJ9A 3SWNB 1VQOA 1KQSS 1X6GA 5AT1B 3SWNC 4M7DC 5KCOA 1YNZA 3CCJQ 2QQAA 4FIBA 3CD6Q 4PJOB 3MEVA 1MMGA 3V7CA 4M75A 2A28A 5FU7B 1YJWT 2KVQG 4J9CA 2XKOC 2EJFA 3VS4A 3CCJA 2D9TA 1SKUB 1U3OA 2P84A 1VA7A 3CCSQ 1S72Q 3WVEB 4IUUA 4PFOA 4ZGDB 2RQVA 3CCEA 1U8RA 4M78C 4M77B 3VS2A 3PIPA 1UGPB 3OYMA 3UF4A 4J9IA 4LXCA 3H0HA 1LJOA 3CCSA 2H8HA 4KUIA 3A8MB 1K1ZA 4IURA 4C8QA 1I0CA 4MZPA 3E9GA 2RQTA 2KE9A 2EGCA 1YJNT 4MDXA 2KI7A 4CC4B 2EYYA 2SEMA 2OI3A 1GFCA 1SRMA 1M3BA 2XICA 1N8RC 2CUBA 4N0AC 1BI3A 3TVTA 3L2QA 2RNAA 2KRMA 2E3IA 2LJ1A 2HL5C 4C8QE 1G3TA 3GNFB 5GMKi 3KBGA 2ESWA 3M53A 3A8HB 2WACA 4M75B 3TREA 4EDUA 1MNDA 4BY6B 1QVGP 1NM7A 4LUDA 1Q82C 4QT7A 3JCMJ 2JMCA 4PJOF 1VQ7Q 1WHHA 2HKQB 1M1KU 3LGFA 4BI8B 4XK8E 1JO8A 1WHKA 4R55A 2EWNA 1RAAB 4BACA 1Q81C 3VS3A 2MAMA 2J6KA 3DKMA 4ATOA 5CVIA 1W70A 4FL6A 3CC4T 3H9NA 2FRYA 2HD0A 3NMZC 3CCQT 3HFNA 2XI9A 2EJGA 2DPPB 1WFWA 3I56A 3FB9A 4MDWA 3G7ZA 3INZA 3JB9H 3SD4A 5GMKe 1MV3A 2K3XA 3PFSA 4C8QB 4DBRA 4EMKA 2F5KA 3RMSA 4M77F 2CP2A 4C8QC 1EIFA 5FRNA 1UE9A 2EYXA 3I9QA 2CT3A 1RAHB 3M56A 4HCKA 3G4SQ 3EG3A 1YIJQ 3OMCA 1VIEA 2NUTA 2OX7A 4GLKA 5GAOn 1PWTA 1WA7A 2L3RA 2DM1A 2EYWA 1WJRA 2ENMA 4K11A 1KD1C 4XTWA 2KYMA 3URGA 2E5QA 2RJEA 4YTLA 5GAN4 3EFRA 2QASA 2LQ8A 2EVRA 3JCMb 2EKOA 2KGTA 5KYWB 4FT2A 1VQPT 1GCQC 4M75F 3IQLA 5KH6A 3JB9G 2EPDA 4AFZC 1YI2T 1GBRA 3JSCA 1Q86C 4ZTFA 3GF5A 3EGUA 1S1NA 2QGGA 3CCLT 3OYDA 2DEUA 3M59A 4FT4A 3L1AA 4PJOG 1UGQB 4LDVA 3QYHB 1BKBA 4GBQA 1K76A 1Q86U 4EMKC 1JJ2P 4PKCC 1VQ6T 1SRLA 2GTJA 4F7UB 2KEAA 5GANd 8AT1B 3JCMf 4FM4B 2QQBA 2NUTB 3I5RA 5HY6A 5C0MA 2EYQA 2DK3A 4C5HA 4OMOA 2H3EB 4M78G 2CKKA 2JMAA 1D3BA 2ZPGB 2QQ9A 1BIAA 2AHJB 2L3SA 2QDYB 1M90C 1V76A 3BDLA 5GAN6 3OYYA 4OMQA 2DL4A 2DTHA 2X51A 1QVGA 4XU3A 2QTVA 5GAN5 2MF2A 2KXDA 2DBMA 3LW5E 2RI5A 2D0NA 4FW2A 1M90U 4PFPA 5EC7A 3L2ZA 2EQIA 4D8KA 2KRSA 2CP0A 4PLIA 2DILA 3V8LA 1K8AC 1AHJB 3JCMc 4BE1A 3TU4K 1U5SA 1ZSZB 2R57A 2FYKA 4M75G 1EZZB 3PGGA 4Z88A 3THKA 1YITQ 2K7AA 1K8AU 2AZVA 4BD3A 2YRCA 5GAOr 1R8OB 2ZPBB 1K0XA 4XU0A 4JRQA 3CBMA 1UHCA 4OMFB 2M0OA 2DZCA 1N5ZA 1KC8C 1BIBA 2DNUA 2X4YA 2BE9B 1YJWA 2LT1A 1X6OA 4RCBA 4C0DB 4FU6A 2MPXC 3I55Q 1YITA 4C0DC 2KK4A 2MIOA 4LE9A 1D3BB 1ZUKA 4F7UF 2KDSA 2XG8D 4X1VA 2QGFB 4MZTA 3TSWA 3CCMT 3I5SA 3M0TA 3OB9A 4GLMA 1M4ZA 1PRLC 5KCHA 1G2BA 1Q95G 4C8QG 2J05A 2DF6A 2NLUA 2QAZA 4LUEA 4L59A 1PKTA 1G5VA 1M27C 2ED0A 2IVWA 3EFOA 3QZ9B 3X26B 3M0RA 4BDYA 1QKWA 3OYNA 2BKDN 1QVPA 1YBYA 3EHQA 2CZ0B 2OTLT 2KAFA 4JRKA 2GTOA 4DQ2A 3TCJA 5GMKh 1YHQT 1QP3A 4HA8A 1NJIC 1VIFA 1BU1A 1VQNT 2FZCB 2EBPA 2QQSA 3OYIA 2I2LA 2JJ9A 2VWFA 4AFQC 4IUTA 4D6WA 2NUPB 1JJ2A 2FVUA 2KROA 3NGPA 2JZ2A 3JB9D 1M2VB 3MKDA 1RAGB 4FSSA 2HBWA 4KUDK 2FPFA 4M7DD 2M0YA 3MCAB 4F14A 1RAIB 1QVGS 2O4XA 5LJ3e 2HQHA 2DEQA 1SEMA 2RPNA 3N5BB 4R0KA 2P0KA 2E70A 1H641 4JPBW 2ZPHB 1X69A 3CC7T 2HL3A 1Y96A 3GNGA 3VS7A 3CBPA 3CC4A 2O9VA 4KGZB 3GBQA 3RBBB 4M7AD 3CCQA 1Z9ZA 3QBYA 4B9WA 3EG9A 2LCCA 3DLMA 3CCUT 4KH1B 3BDUA 3CCRQ 3UA6A 3RKYA 3J7AF 1BBZA 4X34A 4XTVA 2E41A 5ECAA 2CZ1B 4EMGA 1PSEA 3MO8A 3P8DA 3QG1A 2WSEE 4HVVA 5GANj 4BUGA 3OA6A 3QWXX 5D7UA 1NG2A 1C6VX 3H41A 4J7IA 1EFNA 2EQMA 3BY7A 2LCSA 3H0FA 3OYGA 1WLPB 2QEXQ 2HAXA 3CC2T 1H92A 1JB0E 1VQKQ 3CMEQ 5GAOl 4J6YA 5DLOA 4JJNK 1U06A 2EJ9A 1Y7XA 1D1CA 2P4RA 5AYFA 4IIOA 3BE3A 5LJ3g 1Q7YC 3M54A 2LX9A 3MHXA 4DBQA 4XAXB 1AOJA 1D1BA 2HDAA 3TQ7P 1KQ1A 1A0NB 3VS5A 2W10A 1NPRA 4MZMA 5LJ5e 4PJLA 4DA4A 2YLBA 4ELYC 4KGXB 1Y96B 1JQQA 5GAOq 1MGQA 4M7DA 3S3MA 2RH2A 3CCLA 2Y4XA 2DD4A 1Y0MA 2K57A 2OAUA 3JCMP 2XU8A 2OTJQ 2DL7A 1VQ6A 2RK1A 2MK5A 1JJ2S 1UGVA 3M9QA 4M7AA 2ROLA 4IUPA 2XK0A 4LNPA 3G1JA 3GIBA 2ROTA 2JS0A 2HZYA 2D8HA 3HL8A 3LX7A 5LL6S 3OS1A 1W2BP 4FYYB 1WYXA 1RUWA 5GJVB 2A3LA 2DMOA 1WGSA 4F17A 4NS5A 2CYZB 3HRUA 3V7SA 2QI2A 1TUDA 2CT4A 2O2OA 5GAMf 1UTIA 3CQTA 1V29B 2KYBA 1N8RR 4M7AE 3U23A 1VQ9T 4N4IA 5CR2A 2RN8A 1UG1A 4PFZA 2K3BA 1W6XA 1SF9A 5CKBA 1VQLQ 4RTWA 1KK7A 1ACMB 2L3QA 5IAYA 1VQOQ 5CKFA 3SDZA 4QVZA 4E7LA 2X4XA 3OYJA 3LWHA 2L5QA 2YWWA 4PJJA 2YRDA 1AWOA 5LJ5g 3CXCP 2DVEA 1AZEA 4N0AA 3MJXA 4J9HA 3TEEA 4M7DB 1NZ9A 1TUGB 2A36A 4QW2A 2RK2A 1XNIA 1P92A 2KNBB 4AMCA 4FSXA 2HEQA 2PVDB 3LLRA 3RDVA 4MMLA 1M8VA 3E9FA 2K5IA 3Q1JA 1MV0B 2KR3A 3CCEQ 1IB8A 1QWFA 2COYA 4B6MA 5A0GA 3OS0A 1E6GA 3FEOA 1M1FA 3CEYA 4M7AC 5IXBA 5CIUA 2WSFE 1VQ8T 1ZUYA 2CZ6B 3OSSC 4M78B 3CMAQ 4LDYA 1PD1A 2SRCA 4OGEA 6AT1B 3FIFA 5KYXB 4A4GA 3CCMA 1K73U 4VUBA 5LJ3h 3GOXA 2QXFA 4OB3B 2K79A 1M9SA 3CMAA 4RTVA 4AT1B 3I55T 2KSSA 4XTZA 3VUBA 1X6BA 4JRPA 1M30A 2BUDA 2VB6A 2Z0WA 3L42A 2X3WD 2RD1A 5KYYB 2L8DA 4F04B 4RTUA 2A7YA 3JCMQ 2OTLA 3OQ5A 3HHTB 2W0ZA 3H8ZA 1YHQA 3E19A 1SPKA 3EFSA 3R6NA 1M1KC 3JB9F 3OY9A 1TTHB 1IZ6A 2K4YA 3JCMW 3M0SA 3MEWA 3QJYA 1PRMC 4X9CA 4PJNA 4RTXA 4M7DF 2KRNA 4KGVB 2QA4T 3RUXA 3X20B 3O8VA 5FRMA 2EIFA 1GCQA 1WHGA 4OB0B 1VQ5Q 2FHDA 1OPKA 2HCKA 1VYVA 3AT1B 3I56Q 4KBMB 2D1XA 1K9MR 5I21A 1W2BA 2X35A 2DL3A 1TXQA 1UFFA 4JRIA 1VQ5A 3LH0A 3A8LB 3OYEA 3REAB 2EAYA 2DTOA 3VJPA 4M78F 2WSCE 4J6XA 1RABB 3OS2A 5LJ5h 3NPFA 4C0FA 2DXBA 2F2VA 2K2MA 2YSQA 5FU6B 1M2OA 3CCUA 5FU6C 5C6SA 1NPPA 3CXCA 3OS5A 2V1QA 3X28B 4C5EA 4HCZA 1T3SA 1K9AA 4OMLA 5KE2A 2XD0A 1PC0A 2ED1A 4E7ZA 2RQUA 1XTDA 4CC3A 5GAMe 1LNXA 2A0FB 2AK5A 2M51A 3WVDB 1ZBJA 3CC2A 3UDCA 4JJBA 2CS7A 2RI2A 1TSFA 1VQMT 2V1RA 1WXBA 1X27A 4OP0A 2E3HA 2LCLA 1VQ4T 3CPFA 2XDDA 1DJ7B 3G71T 1IO6A 4DOVA 4M7DG 4FYVB 4IIMA 2PTKA 2GF7A 4IUQA 3BFMA 1KC8R 2JUFA 1JU5C 1N9RA 3QYGB 2RM4A 1KFZA 3EG0A 1HK9A 1ZUUA 2D8JA 4RCCA 1ZA1B 4EMKB 4RKUE 1JEGA 4B9XA 2PU9B 4LDWA 1N6AA 3NFCA 1YN8A 1UB4A 4M7AG 4E7JA 3EGDA 2LRQA 2FPEA 2ZPIB 4C8QF 4QKUA 2B86A 2RO0A 3KXTA 1WPYA 4V2SA 4C92D 1UGRB 1LCKA 1ZBXA 4J9BA 2O88A 1PM3A 3FDRA 2V8JA 2CSQA 1BB9A 4UC4A 3EAEA 4J6WA 1WJQA 2JTFA 4XU1A 2R5AA 4FYWB 2RQWA 1W2BS 1K9MU 1QP2A 5CO7A 1Z9QA 1YCYA 1WNLA 4J83A 3CCVQ 9ATCB 4A54A 2HBPA 1FXXA 2AKLA 2J6FA 2RJCA 3G6ET 2RHUA 4Z02A 5GAN7 1D0YA 1YP5A 1OOTA 3LWIA 3EHRA 3CCVA 4DBFA 5A2QE 3S3NA 1WJSA 5I11A 1YJWQ 4P5NA 3CXCS 2DJZA 2ZPEB 1OU9A 1WHJA 2F2XA 4RMOA 1YJ9T 4CC2A 1O9SA 2E6ZA 2F1LA 2LVMA 2RHXA 3EGXA 3EH1A 3QDRB 1BCOA 2GCXA 4BDZA 4EMHA 4OMPA 4NL3A 3JCMX 3SFMA 4JLGA 3HRSA 2BE7D 3CCJT 2JM9A 5CAIA 1OX9A 3PNWC 3CD6T 1CKBA 2ZGWA 1QMCA 1YWOA 4BB7A 5L23A 2DE0X 3HP9A 1B07A 4BI4A 1FYNA 1FMKA 2JXBA 2VYTA 2C0TA 4C92A 1OI1A 1KHIA 4J9FA 3VS1A 4GY5A 3UATA 3PMTA 1YJNQ 3NTKA 2YT6A 3O5ZA 3WXMB 3CCST 1S72T 2M02A 5GAN2 1KSWA 2YXYA 4HVWA 1YJNA 4C92E 3ER0A 2K3YA 1T0HA 3ASKA 3CBOA 4OF1A 2X9HA 2JTMA 1I8FA 1Y71A 4XU2A 1RAEB 3E1SA 3JCMV 3ME9A 3EGXB 2EGAA 4L6V5 1GXIE 3L2UA 3QJ6A 1YCSB 2ZAEA 4KT0E 3MPUB 1LPLA 4ELZC 2QA4A 4A53A 2XHCA 5FLXE 4F16A 2QDLA 5GAMh 5GJWB 4EIKA 5CQYA 5HK0A 3ZBDA 2LQWA 2VXFA 3CC4Q 3CCQQ 3FC3A 2E12A 4QQDA 2DRMA 4LDUA 1QVFP 3QKJA 1C0MA 3JB9I 4A4EA 3MP1A 3DLLA 2DD5A 2B8AA 1ZHIA 1GL5A 1IHWA 1VYUA 3UT1A 4C92C 5GAOp 1PNJA 3EFOB 3PVQA 1VQ7T 2R5MA 3JCMe 1OYXA 3I56T 5HKCA 1WDXA 1XJWB 2DERA 3RERA 3VUZA 1XOVA 3DB4A 3RNJA 4ESRA 3OBYA 5IHNA 3MP6A 1KQ2A 1NE8A 1H3HA 2DIQA 2QG9B 5CQXA 2VGMA 5HCKA 2CGHA 1JBMA 2DTIA 2CSIA 2LQNA 5CKHA 1QCNA 3EH2A 1WHLA 4M77D 2Y4YA 1VQPQ 1AD5A 3G4ST 1M8MA 1YIJT 2K2VA 1YI2Q 2L3PA 5GAN8 4N4HA 2MYSA 2GGRA 2LT4A 2O4XB 2VASA 3C0CA 5GMKm 2XMFA 4BE2A 1VQMA 1VQPA 1WZOA 3CCLQ 5GMKj 2KBTA 3PT9A 4XQ3A 4OGCA 2VVKA 5IH2A 1VQ4A 3PVLA 3V8JA 1G3WA 1YI2A 1CKAA 5FWCA 1VOMA 4MMKA 3G71A 5EG2A 2JS2A 3OSVA 4FYXB 2DX1A 5GANf 4QVDA 1WHMA 1QQJA 2E65A 2KY9A 1VQ6Q 3EG9B 2YDLA 4IUVA 1X2KA 1I81A 3A8OB 3JCMg 2PNIA 2PZ1A 2D6FA 4AG1C 5CKEA 5FWBA 4KH0B 1YFNA 2M1HA 3VU3C 1IXDA 2KQWA 2P0QA 4QVCA 4II1A 2ZZDA 5KYNA 3T9NA 2YHTA 2COZA 3M57A 3QWYA 1MMDA 2EQJA 2V8KA 4HXJA 1ZA2B 1ARKA 4AFSC 5LJ3d 2BZYA 1BYMA 5A0DA 1RACB 3ZFJA 3VS6A 3J81E 5GAN3 2KXCA 3OYLA 4PJMA 1JXMA 2EQUA 3M0QA 5FW9A 3OYCA 4L5GA 1TUCA 2JNGA 1TWBA 2VGNA 3OYKA 2FO0A 1NLOC 4E7SA 4J7FA 5IT9E 4HVUA 5D6WA 3V8KA 2EFIA 1G3SA 4JZ3A 1I5LA 2RF0A 4PJOE 3UA7A 3FJPA 2LP5A 2O9SA 4M77A 2X4WA 2AZSA 2DLPA 1QVFA 3M0UA 2XIDA 1Q82R 2AIRB 3MEUA 4RTYA 3VYGA 1GCPA 4RUGA 3G6EA 2DXUA 1IGQA 2EGEA 3A5ZB 3KFVA 2OJ2A 4M77E 2ABLA 1Q81R 4LDXA 4FCYA 1IRXA 2EW3A 2FZKB 1UUEA 2E64A 2LQKA 5CKDA 3PE0A 3FRNA 3M5AA 1NEGA 3MEAA 2CP3A 4M7AB 1SSHA 5GMKl 1RLQC 5M9OA 2L2PA 3CCMQ 1K73C 1ZQ1A 3CPWP 4OVAA 4OMMA 4PJOC 1RL2A 2QYZA 1WX6A 3P8BB 5FU7C 2MWPA 1AEYA 1G83A 4C0ZA 5LJ5d 4C92G 1TOVA 3L2VA 2NUZA 1YITT 1AWJA 3EG1A 3M55A 3CD6A 4HT8A 1EX4A 5DLQE 1OX8A 1KIKA 2OTLQ 2FZGB 2LDMA 5CK9A 4M75E 1BI2A 3PMIA 3LH5A 1YHQQ 4E7IA 1KD1R 1SHGA 4M77C 1ABQA 2LJ0A 4PNOA 4NOYA 1T3LA
chains in the Genus database with same CATH topology
4BDYA 4C0GA 3OYNA 1HK9A 3HPWA 1N9SA 1QVPA 2BKDN 3GLXA 4JLIA 1YBYA 4RCCA 4X9DA 3RKWA 4EMKB 2CZ0B 4RKUE 3L2RA 4O6JA 4CRIA 4C92F 2OTLT 3JCMh 3S3OA 2KAFA 4JRKA 4B9XA 2F69A 2PU9B 3NTHA 4LDWA 4N4GA 4HKEA 2E6NA 3SWNA 5GAMj 1Q7YU 1N6AA 2DO3A 3NFCA 3OYFA 4DQ2A 1FWZA 2R58A 3TCJA 5GMKh 3JB9J 1YHQT 1QP3A 4HA8A 1UB4A 1NJIC 1WQWA 1BI0A 4M7AG 2O01E 4E7JA 1O75A 2LRQA 1VIFA 3CMAT 1VQNA 4PJOA 3VYHB 2RJDA 3NTIA 1VQNT 3M4YA 3VV0A 2ZPIB 2QQSA 3QZ5B 4C8QF 2I2LA 3OYIA 2RO0A 3KXTA 2MWOA 3OYBA 1UEBA 1WPYA 4V2SA 4C92D 1UGRB 4IUTA 1U1TA 4D6WA 1ZBXA 1JJ2A 2FVUA 4ME7A 4M7DE 3FDRA 2LC4A 4A4FA 2V8JA 3JB9D 2JZ2A 4OB1B 1B34B 1U1SA 3ZEHA 2FB7A 4UC4A 2RHZA 4M75C 4KUDK 1JRIA 3EAEA 2OTJA 1N8RU 3KUFA 4J6WA 4C8QD 4M7DD 3JCMd 4BY6C 3MCAB 1WJQA 2JTFA 4XU1A 4M78A 5GANe 2R5AA 4M7AF 1QVGS 2O4XA 1W2BS 5LJ3e 1K9MU 1I4K1 4QQ6A 1QP2A 5CO7A 4DOWA 4WF2A 1YCYA 1M1GA 3C95A 1WNLA 2DEQA 4J83A 2HQEA 2CZ7B 2H3JA 1TH7A 3N5BB 4XTXA 2VC8A 4A54A 4CI0C 2P0KA 2DXTA 2E70A 1QVFS 2HBPA 2BIVA 3CC7A 1H641 3J80E 1FXXA 2ZPHB 3HFOA 3CC7T 2K5LA 2RJCA 1Y96A 3GNGA 1Q82U 3G6ET 2C06A 2VXEA 3CBPA 2RHUA 2X4JA 4Z02A 5GAN7 3CC4A 2K5FA 3CCQA 4M7AD 4M78E 3QBYA 1VQ7A 3RERA 4B9WA 3OYHA 3JAME 4JS4A 3LWIA 1UGSB 5J26A 3CCVA 1X75C 5A2QE 2LCCA 3S3NA 3DLMA 3CCVT 3CCUT 1HXDA 3BDUA 2HQXA 5A0LA 1WJSA 2LTOA 1VQLA 2VV5A 3META 4P5NA 3RKYA 3QSUA 1Q81U 3J7AF 4X34A 4XTVA 1OZ2A 2DJZA 2ZPEB 3V7RA 4BI3A 3CXCS 3SWNB 1YJ9A 2E41A 4EMGA 2CZ1B 1VQOA 4RMOA 1KQSS 1PSEA 1YJ9T 3SWNC 4M7DC 5KCOA 2FL7A 3MO8A 1O9SA 2QQAA 3P8DA 2E6ZA 3LYIA 3QG1A 2WSEE 4FIBA 2LVMA 4F7UA 5HK3A 4PJOB 2RHXA 3MEVA 5GANj 4BUGA 3OA6A 5IN1A 1BI1A 3V7CA 4J7IA 2KMTA 4M75A 2EQMA 3BY7A 5LJ3j 3QDRB 3CCRT 2GCXA 5FU7B 1YJWT 2KVQG 4BDZA 4EMHA 3OYGA 2XKOC 2HAXA 2EJFA 4NL3A 3JCMX 3SFMA 4HCCA 4XTYA 3HRTA 1W4SA 3CCJA 3RIRA 3CC2T 4JLGA 3HRSA 2D9TA 4J5YA 3X25B 3CCJT 5CAIA 1JB0E 4E7KA 3PNWC 3CD6T 2ZGWA 3G4SA 1YIJA 4BB7A 1S72A 3OYAA 3QIIA 4J6YA 4F7UE 5DLOA 5GAOl 3CPWA 3HP9A 4JJNK 3WVEB 4IUUA 3JRZA 4ZGDB 2EJ9A 1Y7XA 4Y28E 3CCEA 2DXCA 5AYFA 5GANg 4BI4A 2QEXT 1U8RA 4M78C 2JVVA 2VYTA 4M77B 5LJ3g 1Q7YC 4C92A 3PIPA 3M54A 2LX9A 1OI1A 3MHXA 4XAXB 1KHIA 4GY5A 1UGPB 4NL2A 3OYMA 1KQ1A 1VQKT 2LNVA 3PMTA 1QW1A 2DZ9A 3QXEB 3NTKA 1LJOA 3CMET 1KD1U 3CCSA 1NPRA 3WXMB 4MZMA 5LJ5e 3CCST 4KUIA 4R56A 2YLBA 4DA4A 4LD6A 4ELYC 1S72T 3A8MB 1Y96B 5GAOq 1VUBA 4IURA 1SSFA 1MGQA 5GAN2 4C8QA 4M7DA 2RA2A 5DY9A 3S3MA 5LJ3f 2RH2A 4MZPA 3CCLA 2Y4XA 2EQKA 2DD4A 3E9GA 1YJNA 4C92E 2D0QB 2K57A 1YJNT 3ER0A 4HCBA 2K3YA 4MDXA 2OAUA 3JCMP 1Y07A 3ASKA 2XU8A 2XDBA 5FROA 3CBOA 4OF1A 2PUOB 2Y90A 5DM7R 2XICA 2VUBA 2JTMA 1N8RC 1I8FA 3SB2A 4N0AC 1BI3A 1Y71A 4XU2A 3L2QA 1VQ6A 1KG1A 2RI3A 2RK1A 2DKGA 4A4KA 3QUIA 3GP8A 3E1SA 4QQGA 1K9MC 4C8QE 3JCMV 1G3TA 3GNFB 3ME9A 5GMKi 1JJ2S 1H3ZA 3C4SA 3M9QA 5CCAA 4L6V5 4M7AA 1GXIE 5GAMg 3OW2A 3KBGA 3M53A 3A8HB 4IUPA 3L2UA 2WACA 4ZGEB 4M75B 3QJ6A 2PVOB 2XK0A 3TREA 4KT0E 4EDUA 4E47A 2YRVA 4BY6B 2V8IA 2QA4A 4ELZC 3GIBA 4A53A 2XHCA 1IREB 3LX7A 5LL6S 3HL8A 5FLXE 5GAMh 3OS1A 2OTJT 3S6WA 1Q82C 3AHUA 2A3LA 3BW1A 3PTAA 1WGSA 3A8GB 5CQYA 5HK0A 3ZBDA 2VXFA 5LJ5j 4M77G 4NS5A 3JCMJ 4O5VA 2CYZB 3HRUA 3V7SA 2QI2A 4JDSA 4PJOF 3FC3A 2E12A 3DB3A 3X24B 4QQDA 3GPLA 4ZTJA 1M1KU 3LGFA 4LDUA 4BI8B 3QKJA 5GAMf 1VQ9A 4XK8E 1V29B 3JB9I 4M7AE 4A4EA 1VQ9T 4R55A 2EWNA 3MP1A 4N4IA 2DAQA 5CR2A 4BACA 1FX7A 5I2MA 3DLLA 3C94A 2DD5A 5I2SA 1Q81C 2B8AA 5CKBA 1ZHIA 2MAMA 3DKMA 2QQRA 3UT1A 5CKFA 3SDZA 5IAYA 4QVZA 5CVIA 4ATOA 4C92C 4E7LA 3MP8A 4FL6A 5GAOp 2M16A 3CC4T 2X4XA 3OYJA 2HD0A 3LWHA 3CCQT 2L5QA 3HFNA 2XI9A 1VQ7T 2EJGA 3OBWA 2R5MA 2HNIA 2DPPB 3I56A 3JCMe 2M9UA 5LJ5g 1OYXA 3FB9A 4MDWA 3I56T 3G7ZA 5HKCA 4E7HA 3INZA 3JB9H 2DVEA 3SD4A 4N0AA 3VUZA 5KE3A 2K3XA 3PFSA 4C8QB 5GMKe 1VQLT 3TEEA 2F5KA 4EMKA 3RMSA 5GAMd 4M7DB 4M77F 1NZ9A 4C8QC 1XOVA 3DB4A 1VQOT 1EIFA 5FRNA 3OBYA 4QW2A 2RK2A 3MP6A 1KQ2A 1NE8A 1XNIA 2DIQA 1P92A 5CQXA 4FSXA 1RI0A 2E10A 2PVDB 2RJFA 3LLRA 3M56A 2VGMA 2CGHA 4MMLA 4C5IA 3OMCA 1JBMA 1M8VA 5LJ5f 1VIEA 3E9FA 2DTIA 2K5IA 5CKHA 3Q1JA 2E1HA 2JOYA 4GLKA 5GAOn 4IKFA 2F5TX 4KULA 4M77D 4EPCA 2Y4YA 2L3RA 5A0GA 1WJRA 3OS0A 4C5GA 3FEOA 1M1FA 3CEYA 4M7AC 1MHNA 1VQ8A 3G4ST 4XTWA 1KD1C 5CIUA 1YIJT 2WSFE 1VQ8T 3URGA 2K2VA 2CZ6B 2E5QA 2RJEA 3OSSC 4HT9A 4YTLA 5GAN8 3EFRA 5GAN4 3CPWS 4N4HA 4M78B 1X01A 2XDPA 3CCET 2LT4A 2O4XB 2YLCA 2LQ8A 5D6YA 4LDYA 2PQWA 5GMKm 3F70A 4BE2A 3JCMb 1VQMA 2DIGA 2G3RA 2EKOA 4OGEA 4JS5A 1VQPA 3FIFA 4A4GA 5GANh 5GMKj 4FT2A 3PT9A 4XQ3A 3L2WA 3CCMA 1VQPT 4OGCA 4M75F 1VQ4A 2GFAA 4VUBA 5LJ3h 3V8JA 1G3WA 3QHSA 5KH6A 3GOXA 1YI2A 1KC8U 5L8RE 2QXFA 4MMKA 4OB3B 3G71A 3JB9G 1YI2T 5EG2A 1M9SA 3OSVA 3I55A 3CMAA 3JSCA 1Q86C 4ZTFA 5GANf 4QVDA 3I55T 2KSSA 4XTZA 3GF5A 2E65A 2KY9A 2JN0A 3H6ZA 3VUBA 3FLGA 4ZN3A 3QO3A 3R6OA 4JRPA 2BUDA 3M58A 3UWNA 4IUVA 3L42A 3CCLT 1I81A 3OYDA 3A8OB 3JCMg 3M59A 4FT4A 2RD1A 3L1AA 4PJOG 2D6FA 1UGQB 4LDVA 5GAOm 3QYHB 5CKEA 2L8DA 3VKIA 5D6XA 2A7YA 2M1HA 1BKBA 3VU3C 3JCMQ 2OTLA 2KQWA 2P0QA 3OMGA 3OQ5A 4QVCA 4II1A 1Q86U 2ZZDA 3HHTB 1PSFA 4EMKC 2RB6A 3T9NA 4PKCC 3H8ZA 1YHQA 1VQ6T 4BE0A 2YHTA 3E19A 4F7UB 3M57A 3EFSA 2EQJA 2V8KA 2MI6A 5GANd 1M1KC 3OY9A 1LOJA 1IZ6A 2K4YA 3JB9F 3JCMW 3JCMf 5LJ3d 4ZGJB 3MEWA 2QQBA 4FM4B 3OW2S 3QJYA 3QPHA 4X9CA 5HY6A 1BYMA 5A0DA 5C0MA 3ZFJA 3J81E 4PLLA 5GAN3 4M7DF 2P0PA 2EYQA 2DK3A 2QA4T 3RUXA 3X20B 4C5HA 2IG0A 4M78G 3OYLA 3HKSA 3O8VA 2CKKA 2EQUA 5FRMA 3OYCA 1D3BA 2EIFA 2JNGA 2VGNA 2ZPGB 4L5GA 3OYKA 1NJIU 4J7FA 2QQ9A 1BIAA 2AHJB 4OB0B 2FHDA 1M5Q1 2QDYB 1M90C 3LGLA 5IT9E 5D6WA 3BDLA 3V8KA 2EFIA 5GAN6 1G3SA 4Y91A 3OYYA 1I5LA 4PJOE 4KBMB 2GFUA 2DTHA 4C92B 1QVGA 4RG8A 4XU3A 3FJPA 5I21A 1W2BA 2X35A 4Q5WA 5GAN5 4JRIA 2MF2A 4M77A 1VQ5A 2X4WA 3LH0A 3LW5E 4PJOD 3A8LB 2RI5A 1M90U 1VQ5T 3OYEA 2P4TA 2EAYA 2GQVA 1QVFA 1OZ3A 2DTOA 2XIDA 3L2ZA 3VJPA 3MEUA 4M78F 3VYGA 1KHCA 3UPUA 2WSCE 4J6XA 4PL6A 3G6EA 2DXUA 4XTUA 2PUKB 3OS2A 5LJ5h 1XQHA 4PLIA 1N27A 3V8LA 1K8AC 4C0FA 2DXBA 1AHJB 3A5ZB 3JCMc 4BE1A 3TU4K 4J8OA 4JUVA 5FU6B 4F7UG 2ZPFB 3P8HA 4M77E 3CCUA 5FU6C 3RKXA 5C6SA 2R57A 4LDXA 2ZCFB 2FYKA 4M75G 1NPPA 3CXCA 3HSBA 2QTXA 3PGGA 3OS5A 2E64A 4M78D 3X28B 4C5EA 2LQKA 5CKDA 1KQSA 4ZN1A 5J39A 3FRNA 3M5AA 4HCZA 5J3BA 2L89A 1K8AU 3MEAA 4BD3A 4M7AB 1R8OB 2ZPBB 5KE2A 5GMKl 4XU0A 4JRQA 5GAOr 2XD0A 3CBMA 4OMFB 5M9OA 1G3YA 1K73C 2M0OA 2DZCA 2RHIA 1XTDA 1KC8C 1ZQ1A 1BIBA 5GAMe 4OVAA 1B34A 3CCRA 2X4YA 1LNXA 4PJOC 4OB2B 1YJWA 2LT1A 1RL2A 1X6OA 2RHYA 3M4GA 3RESA 4RCBA 4C0DB 4FU6A 1YITA 3P8BB 5FU7C 2MWPA 4C0DC 3WVDB 2KK4A 4C0ZA 5LJ5d 1D3BB 4C92G 3UDCA 3L2VA 4F7UF 1YITT 3CC2A 3M55A 2CS7A 2RI2A 2KDSA 1VQMT 3CD6A 4RG2A 4HT8A 4OP0A 2XG8D 5DLQE 4MZTA 4A4HA 3CCMT 2LCLA 1VQ4T 3OB9A 4TVRA 2PVGB 1WQ7A 3CPFA 1M4ZA 1DJ7B 3RMQA 2XDDA 3G71T 5KCHA 2QEXA 4DOVA 2LDMA 3PIOA 5CK9A 4M75E 4C8QG 4LD9K 4M7DG 1BI2A 3PMIA 2NLUA 2GF7A 4E7IA 4IUQA 3BFMA 4L59A 4M77C 2JUFA 1K73U 2MMPA 3C12A 1VQKA 1N9RA 1G5VA 2IVWA 3QYGB 3CMEA 3QZ9B 3X26B 2RM4A 4PNOA 4NOYA 4M75D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CKK A;  3CCJ A;  3I56 T;  1S72 A;  3CC2 T;  1YBY A;  2EIF A;  2JNG A;  3CCJ T;  1NJI U;  4CRI A;  2OTL T;  3CD6 T;  1VQL T;  3G4S A;  1YIJ A;  1M90 C;  3LGL A;  1NZ9 A;  5IT9 E;  3DB4 A;  1VQO T;  1EIF A;  2DO3 A;  1Q7Y U;  3CPW A;  1YHQ T;  1NJI C;  1XNI A;  3OYY A;  3CCE A;  1QVG A;  2QEX T;  1VQN A;  1W2B A;  2JVV A;  1Q7Y C;  3PIP A;  1VQN T;  1KHI A;  1VQ5 A;  3LH0 A;  1VQK T;  2JOY A;  2MWO A;  1UEB A;  1M90 U;  1VQ5 T;  3CME T;  1KD1 U;  3CCS A;  1JJ2 A;  1QVF A;  2L3R A;  1NPR A;  3CCS T;  1S72 T;  1SSF A;  3G6E A;  1VQ8 A;  3G4S T;  1KD1 C;  1YIJ T;  1VQ8 T;  1K8A C;  3CCL A;  4YTL A;  2OTJ A;  3A5Z B;  1YJN A;  3CPW S;  1N8R U;  1YJN T;  3ER0 A;  3CCE T;  2LQ8 A;  3CCU A;  1QVG S;  1VQM A;  1NPP A;  1W2B S;  2G3R A;  3CXC A;  1K9M U;  1VQP A;  5DM7 R;  1N8R C;  1KQS A;  3CCM A;  1VQP T;  4ZN1 A;  1M1G A;  1VQ4 A;  1K73 U;  1KC8 U;  1VQ6 A;  5J3B A;  1YI2 A;  1K8A U;  3G71 A;  1K9M C;  1YI2 T;  2E70 A;  1JJ2 S;  1QVF S;  3CC7 A;  3I55 A;  3CMA A;  3J80 E;  1Q86 C;  3OW2 A;  1K73 C;  3KBG A;  3I55 T;  3CC7 T;  1XTD A;  1Q82 U;  1KC8 C;  3CMA T;  3G6E T;  3CCR A;  3TRE A;  4ZN3 A;  3CC4 A;  1YJW A;  1RL2 A;  1X6O A;  3CCQ A;  1VQ7 A;  2QA4 A;  2XHC A;  5LL6 S;  5FLX E;  3JAM E;  3CCL T;  2OTJ T;  5J26 A;  1YIT A;  3P8B B;  3CCV A;  2MWP A;  5A2Q E;  1Q82 C;  3CC2 A;  1YIT T;  3CCV T;  3CCU T;  2KDS A;  1BKB A;  1VQM T;  2OTL A;  1VQL A;  3CD6 A;  4RG2 A;  1Q81 U;  1Q86 U;  3DB3 A;  4X34 A;  3CXC S;  4QQD A;  5DLQ E;  1YJ9 A;  1M1K U;  3J7A F;  3LGF A;  3CCM T;  1VQO A;  1KQS S;  1VQ9 A;  2LCL A;  1VQ4 T;  1YJ9 T;  4TVR A;  1YHQ A;  1VQ6 T;  1VQ9 T;  3CPF A;  3G71 T;  2E6Z A;  3DLL A;  1Q81 C;  2LVM A;  1M1K C;  2MI6 A;  2QEX A;  1IZ6 A;  3PIO A;  5IAY A;  3OW2 S;  5HY6 A;  3CCR T;  3CC4 T;  3J81 E;  1VQK A;  1YJW T;  2JUF A;  3CCQ T;  2KVQ G;  1VQ7 T;  2QA4 T;  3CME A;  2IG0 A;  3I56 A;  3HKS A; 
#chains in the Genus database with same CATH topology
 1VQN Q;  3HPW A;  1FMV A;  1S72 A;  1NBE B;  3RKW A;  2A08 A;  3JCM h;  3S3O A;  2HMA A;  2F69 A;  4N4G A;  1K0S A;  3EG2 A;  2FEI A;  2DO3 A;  3OYF A;  1NYG A;  1FWZ A;  2KT1 A;  2R58 A;  1WQW A;  1BI0 A;  3OW2 P;  2O01 E;  1PCX A;  1VQN A;  2DBK A;  2IIM A;  2RJD A;  3NTI A;  3VYH B;  1Q86 R;  1C1A A;  3M4Y A;  3VV0 A;  5KYU A;  1ABO A;  3OYB A;  2GQI A;  2YUO A;  4D8D A;  1U1T A;  1E6H A;  1VYT A;  3SEM A;  4OB1 B;  1RLP C;  1U1S A;  2AKK A;  2FB7 A;  2RHZ A;  4M75 C;  3REB B;  1JRI A;  1N8R U;  3KUF A;  1M3C A;  4BY6 C;  3CC7 Q;  1PHT A;  2O31 A;  5GAN e;  4M7A F;  2LMJ A;  1I4K 1;  4QQ6 A;  4DEY A;  1M1G A;  5KYW A;  1I1J A;  1WXT A;  2HQE A;  3CCU Q;  1TH7 A;  4XTX A;  2VC8 A;  4CI0 C;  1AT1 B;  2DXT A;  1QVF S;  1WI7 A;  3CC7 A;  3J80 E;  1QKX A;  2K5L A;  1Q82 U;  2C06 A;  2C0O A;  2X4J A;  3VRY A;  2CP5 A;  4ORZ A;  1M90 R;  2K5F A;  1VQ7 A;  1BK2 A;  3OYH A;  3TSZ A;  1X75 C;  2DET A;  1HXD A;  4RTT A;  2HQX A;  3FJ5 A;  5A0L A;  1WIE A;  3MET A;  3QSU A;  1Q81 U;  1K4U S;  1OZ2 A;  3V7R A;  2DRK A;  2BTT A;  1TG0 A;  1R77 A;  2FL7 A;  3CC2 Q;  4OMN A;  3LYI A;  2JW4 A;  4F7U A;  5HK3 A;  1NLP C;  5IN1 A;  1BI1 A;  1B3Q A;  5KYU B;  3SHW A;  2KMT A;  5LJ3 j;  1Y57 A;  3CCR T;  1K8A R;  8ATC B;  4HCC A;  4XTY A;  3HRT A;  3H0I A;  1W4S A;  3RIR A;  1I07 A;  1HYO A;  4J5Y A;  4E7K A;  3X25 B;  3M0P A;  1ZX6 A;  3G4S A;  1I5O B;  1YIJ A;  2GBQ A;  3OYA A;  3QII A;  4F7U E;  1AWW A;  3CPW A;  1CSK A;  3JRZ A;  4Y28 E;  2DXC A;  5GAN g;  1V1C A;  4JJC A;  2QEX T;  2JVV A;  2I0N A;  4NL2 A;  1PKS A;  1VQK T;  2LNV A;  1QW1 A;  2DZ9 A;  3QXE B;  2HKN A;  3CME T;  1KD1 U;  5IHI A;  4AFU C;  4RTZ A;  2BZ8 A;  4R56 A;  4LD6 A;  1VUB A;  1IHV A;  1SSF A;  2C0I A;  2RA2 A;  5DY9 A;  5LJ3 f;  2HSE B;  2DL8 A;  2LNH B;  2EQK A;  2MCN A;  2D0Q B;  4HCB A;  4PK4 A;  1Y07 A;  1MUZ A;  2XDB A;  5FRO A;  2PUO B;  1ZSZ A;  2Y90 A;  5DM7 R;  2VUB A;  3SB2 A;  1PG5 B;  1KG1 A;  2RI3 A;  3HTR A;  2DKG A;  4A4K A;  3QUI A;  3GP8 A;  4QQG A;  1K9M C;  5IXF A;  4J9G A;  1H3Z A;  3C4S A;  5CCA A;  4Y92 A;  1HSQ A;  5GAM g;  3OW2 A;  1LVK A;  4ZGE B;  2PVO B;  1IGU A;  1VQ9 Q;  2A37 A;  4E47 A;  2YRV A;  1YWP A;  2V8I A;  1IRE B;  2OTJ T;  3S6W A;  1NJI R;  1HJD A;  3AHU A;  3BW1 A;  3PTA A;  3A8G B;  1TU0 B;  5LJ5 j;  4M77 G;  1AVZ C;  4O5V A;  4JDS A;  3DB3 A;  2RQR A;  2LZ6 B;  3X24 B;  3GPL A;  4ZTJ A;  2V26 A;  1VQ9 A;  1OPL A;  2DAQ A;  1FX7 A;  5I2M A;  3C94 A;  5I2S A;  1B7T A;  1J3T A;  1OU8 A;  2QQR A;  3MP8 A;  4A63 B;  2M16 A;  4ANJ A;  2E5K A;  3OBW A;  2HNI A;  2ECZ A;  1W1F A;  2M9U A;  4E7H A;  1AZG B;  1KQS P;  1TS9 A;  4WTO B;  5KE3 A;  1VQL T;  5GAM d;  1MMA A;  1OV3 A;  1VQO T;  2CDT A;  1NEB A;  1D0X A;  3EGD B;  2OAW A;  1RI0 A;  2E10 A;  2RJF A;  2CUD A;  4DBH A;  3A1P A;  4C5I A;  1VQ8 Q;  1GRI A;  5LJ5 f;  1ZSZ C;  2YUQ A;  5IHK A;  2E1H A;  2JOY A;  4IKF A;  2F5T X;  4KUL A;  4EPC A;  2DFU A;  4C5G A;  2NUP A;  1D0Z A;  1OUL A;  1MHN A;  1VQ8 A;  1UHF A;  2IPO B;  4HT9 A;  1KJW A;  1GBQ A;  1M2V A;  3CPW S;  1X01 A;  2XDP A;  3CCE T;  2YLC A;  5D6Y A;  2PQW A;  1R0B G;  3F70 A;  2DIG A;  2G3R A;  4JS5 A;  2ATC B;  4JJD A;  4KRT A;  5GAN h;  3L2W A;  3VRZ A;  2GFA A;  1KC8 U;  3QHS A;  3ULR B;  1X2Q A;  4DEX A;  2CP7 A;  5L8R E;  1UEC A;  3I55 A;  4FW1 A;  3CMA T;  3H6Z A;  2JN0 A;  1OEB A;  2AT1 B;  3FLG A;  4ZN3 A;  3QO3 A;  3R6O A;  3M58 A;  3UWN A;  2NWM A;  2J6O A;  5GAO m;  3VKI A;  5D6X A;  2K6D A;  4M4Z A;  1Q7Y R;  3OMG A;  2QA4 Q;  1PSF A;  2RB6 A;  2FG0 A;  4BE0 A;  4CC7 A;  4JZ4 A;  2MI6 A;  2DYI A;  1LOJ A;  1E7O A;  2DA9 A;  1UJ0 A;  4ZGJ B;  4ZNX A;  4Z8A A;  3OW2 S;  3QPH A;  4PLL A;  1UDL A;  2EYZ A;  2P0P A;  2IG0 A;  2CP6 A;  3HKS A;  2COW A;  2K9G A;  3A98 A;  1NJI U;  1G8X A;  2MOX A;  1M5Q 1;  2DJQ A;  2DL5 A;  3LGL A;  2LX7 A;  1SHF A;  4Y91 A;  2GFU A;  2CH4 W;  4C92 B;  4RG8 A;  2CH4 A;  4Q5W A;  1WXU A;  2G6F X;  2FRW A;  4PJO D;  2JTE A;  1VQ5 T;  2P4T A;  2GQV A;  4J9D A;  1OZ3 A;  2JT4 A;  1KHC A;  3UPU A;  1FMW A;  4PL6 A;  4XTU A;  2PUK B;  5I22 A;  1XQH A;  2RMO A;  4E6R A;  1N27 A;  3RR6 A;  4J8O A;  4JUV A;  4F7U G;  2QK0 A;  2ZPF B;  3P8H A;  3RKX A;  1QCF A;  2EKH A;  2ZCF B;  3JV3 A;  3HSB A;  2QTX A;  1MMN A;  1PD0 A;  1D09 B;  4M78 D;  1KQS A;  4LN2 A;  2L0A A;  4ZN1 A;  5J39 A;  1QWE A;  5J3B A;  2L89 A;  3ZL7 C;  2HSP A;  1SG5 A;  1VQM Q;  1GFD A;  4E2F B;  1G3Y A;  3D7S B;  2RHI A;  1VQ4 Q;  3CCR A;  1B34 A;  1QCO A;  4OB2 B;  2RHY A;  3M4G A;  3G71 Q;  2FPD A;  3RES A;  2NYS A;  2CRE A;  2VKN A;  2YUP A;  4RG2 A;  4A4H A;  1MNE A;  4TVR A;  2PVG B;  1WQ7 A;  3RMQ A;  1R0C B;  1ZSG A;  2QEX A;  3PIO A;  4LD9 K;  1K73 R;  1VQK A;  2MMP A;  3C12 A;  3CME A;  4M75 D;  4WCI A;  4C0G A;  2J06 A;  1N9S A;  1RI9 A;  1BCM A;  1UJY A;  4JLI A;  3GLX A;  4X9D A;  3L2R A;  4O6J A;  4CRI A;  4C92 F;  3QDF A;  1T0J A;  3NTH A;  4HKE A;  2E6N A;  2KT8 A;  3SWN A;  5GAM j;  1Q7Y U;  3JB9 J;  4Z89 A;  4AG2 C;  3NHN A;  2J7I A;  1O75 A;  4PJO A;  3QZ5 B;  1D1A A;  2DVJ A;  2MWO A;  1UEB A;  1H8K A;  1AWX A;  2JM8 A;  4ME7 A;  4M7D E;  2LC4 A;  4A4F A;  1B34 B;  1M3A A;  3ZEH A;  3VS0 A;  2OTJ A;  4C8Q D;  1X43 A;  3JCM d;  1F1B B;  4M78 A;  3G6E Q;  1M1K R;  3I35 A;  2BZX A;  1ZLM A;  1QLY A;  4DOW A;  4WF2 A;  1NYF A;  2DYB A;  2LJ3 A;  3C95 A;  5KYX A;  1RAF B;  2CZ7 B;  2H3J A;  7AT1 B;  3E2U A;  2E4H A;  2BIV A;  3HFO A;  1YJ9 Q;  2VXE A;  4M78 E;  4JS4 A;  3JAM E;  1OQK A;  1UGS B;  5J26 A;  1RAD B;  2YUN A;  3CCV T;  2F2W A;  2GNC A;  4J9E A;  1JXO A;  5KYY A;  2LTO A;  2X3X D;  1VQL A;  2VV5 A;  1HD3 A;  4BI3 A;  1YJ9 A;  3SWN B;  1VQO A;  1KQS S;  1X6G A;  5AT1 B;  3SWN C;  4M7D C;  5KCO A;  1YNZ A;  3CCJ Q;  2QQA A;  4FIB A;  3CD6 Q;  4PJO B;  3MEV A;  1MMG A;  3V7C A;  4M75 A;  2A28 A;  5FU7 B;  1YJW T;  2KVQ G;  4J9C A;  2XKO C;  2EJF A;  3VS4 A;  3CCJ A;  2D9T A;  1SKU B;  1U3O A;  2P84 A;  1VA7 A;  3CCS Q;  1S72 Q;  3WVE B;  4IUU A;  4PFO A;  4ZGD B;  2RQV A;  3CCE A;  1U8R A;  4M78 C;  4M77 B;  3VS2 A;  3PIP A;  1UGP B;  3OYM A;  3UF4 A;  4J9I A;  4LXC A;  3H0H A;  1LJO A;  3CCS A;  2H8H A;  4KUI A;  3A8M B;  1K1Z A;  4IUR A;  4C8Q A;  1I0C A;  4MZP A;  3E9G A;  2RQT A;  2KE9 A;  2EGC A;  1YJN T;  4MDX A;  2KI7 A;  4CC4 B;  2EYY A;  2SEM A;  2OI3 A;  1GFC A;  1SRM A;  1M3B A;  2XIC A;  1N8R C;  2CUB A;  4N0A C;  1BI3 A;  3TVT A;  3L2Q A;  2RNA A;  2KRM A;  2E3I A;  2LJ1 A;  2HL5 C;  4C8Q E;  1G3T A;  3GNF B;  5GMK i;  3KBG A;  2ESW A;  3M53 A;  3A8H B;  2WAC A;  4M75 B;  3TRE A;  4EDU A;  1MND A;  4BY6 B;  1QVG P;  1NM7 A;  4LUD A;  1Q82 C;  4QT7 A;  3JCM J;  2JMC A;  4PJO F;  1VQ7 Q;  1WHH A;  2HKQ B;  1M1K U;  3LGF A;  4BI8 B;  4XK8 E;  1JO8 A;  1WHK A;  4R55 A;  2EWN A;  1RAA B;  4BAC A;  1Q81 C;  3VS3 A;  2MAM A;  2J6K A;  3DKM A;  4ATO A;  5CVI A;  1W70 A;  4FL6 A;  3CC4 T;  3H9N A;  2FRY A;  2HD0 A;  3NMZ C;  3CCQ T;  3HFN A;  2XI9 A;  2EJG A;  2DPP B;  1WFW A;  3I56 A;  3FB9 A;  4MDW A;  3G7Z A;  3INZ A;  3JB9 H;  3SD4 A;  5GMK e;  1MV3 A;  2K3X A;  3PFS A;  4C8Q B;  4DBR A;  4EMK A;  2F5K A;  3RMS A;  4M77 F;  2CP2 A;  4C8Q C;  1EIF A;  5FRN A;  1UE9 A;  2EYX A;  3I9Q A;  2CT3 A;  1RAH B;  3M56 A;  4HCK A;  3G4S Q;  3EG3 A;  1YIJ Q;  3OMC A;  1VIE A;  2NUT A;  2OX7 A;  4GLK A;  5GAO n;  1PWT A;  1WA7 A;  2L3R A;  2DM1 A;  2EYW A;  1WJR A;  2ENM A;  4K11 A;  1KD1 C;  4XTW A;  2KYM A;  3URG A;  2E5Q A;  2RJE A;  4YTL A;  5GAN 4;  3EFR A;  2QAS A;  2LQ8 A;  2EVR A;  3JCM b;  2EKO A;  2KGT A;  5KYW B;  4FT2 A;  1VQP T;  1GCQ C;  4M75 F;  3IQL A;  5KH6 A;  3JB9 G;  2EPD A;  4AFZ C;  1YI2 T;  1GBR A;  3JSC A;  1Q86 C;  4ZTF A;  3GF5 A;  3EGU A;  1S1N A;  2QGG A;  3CCL T;  3OYD A;  2DEU A;  3M59 A;  4FT4 A;  3L1A A;  4PJO G;  1UGQ B;  4LDV A;  3QYH B;  1BKB A;  4GBQ A;  1K76 A;  1Q86 U;  4EMK C;  1JJ2 P;  4PKC C;  1VQ6 T;  1SRL A;  2GTJ A;  4F7U B;  2KEA A;  5GAN d;  8AT1 B;  3JCM f;  4FM4 B;  2QQB A;  2NUT B;  3I5R A;  5HY6 A;  5C0M A;  2EYQ A;  2DK3 A;  4C5H A;  4OMO A;  2H3E B;  4M78 G;  2CKK A;  2JMA A;  1D3B A;  2ZPG B;  2QQ9 A;  1BIA A;  2AHJ B;  2L3S A;  2QDY B;  1M90 C;  1V76 A;  3BDL A;  5GAN 6;  3OYY A;  4OMQ A;  2DL4 A;  2DTH A;  2X51 A;  1QVG A;  4XU3 A;  2QTV A;  5GAN 5;  2MF2 A;  2KXD A;  2DBM A;  3LW5 E;  2RI5 A;  2D0N A;  4FW2 A;  1M90 U;  4PFP A;  5EC7 A;  3L2Z A;  2EQI A;  4D8K A;  2KRS A;  2CP0 A;  4PLI A;  2DIL A;  3V8L A;  1K8A C;  1AHJ B;  3JCM c;  4BE1 A;  3TU4 K;  1U5S A;  1ZSZ B;  2R57 A;  2FYK A;  4M75 G;  1EZZ B;  3PGG A;  4Z88 A;  3THK A;  1YIT Q;  2K7A A;  1K8A U;  2AZV A;  4BD3 A;  2YRC A;  5GAO r;  1R8O B;  2ZPB B;  1K0X A;  4XU0 A;  4JRQ A;  3CBM A;  1UHC A;  4OMF B;  2M0O A;  2DZC A;  1N5Z A;  1KC8 C;  1BIB A;  2DNU A;  2X4Y A;  2BE9 B;  1YJW A;  2LT1 A;  1X6O A;  4RCB A;  4C0D B;  4FU6 A;  2MPX C;  3I55 Q;  1YIT A;  4C0D C;  2KK4 A;  2MIO A;  4LE9 A;  1D3B B;  1ZUK A;  4F7U F;  2KDS A;  2XG8 D;  4X1V A;  2QGF B;  4MZT A;  3TSW A;  3CCM T;  3I5S A;  3M0T A;  3OB9 A;  4GLM A;  1M4Z A;  1PRL C;  5KCH A;  1G2B A;  1Q95 G;  4C8Q G;  2J05 A;  2DF6 A;  2NLU A;  2QAZ A;  4LUE A;  4L59 A;  1PKT A;  1G5V A;  1M27 C;  2ED0 A;  2IVW A;  3EFO A;  3QZ9 B;  3X26 B;  3M0R A;  4BDY A;  1QKW A;  3OYN A;  2BKD N;  1QVP A;  1YBY A;  3EHQ A;  2CZ0 B;  2OTL T;  2KAF A;  4JRK A;  2GTO A;  4DQ2 A;  3TCJ A;  5GMK h;  1YHQ T;  1QP3 A;  4HA8 A;  1NJI C;  1VIF A;  1BU1 A;  1VQN T;  2FZC B;  2EBP A;  2QQS A;  3OYI A;  2I2L A;  2JJ9 A;  2VWF A;  4AFQ C;  4IUT A;  4D6W A;  2NUP B;  1JJ2 A;  2FVU A;  2KRO A;  3NGP A;  2JZ2 A;  3JB9 D;  1M2V B;  3MKD A;  1RAG B;  4FSS A;  2HBW A;  4KUD K;  2FPF A;  4M7D D;  2M0Y A;  3MCA B;  4F14 A;  1RAI B;  1QVG S;  2O4X A;  5LJ3 e;  2HQH A;  2DEQ A;  1SEM A;  2RPN A;  3N5B B;  4R0K A;  2P0K A;  2E70 A;  1H64 1;  4JPB W;  2ZPH B;  1X69 A;  3CC7 T;  2HL3 A;  1Y96 A;  3GNG A;  3VS7 A;  3CBP A;  3CC4 A;  2O9V A;  4KGZ B;  3GBQ A;  3RBB B;  4M7A D;  3CCQ A;  1Z9Z A;  3QBY A;  4B9W A;  3EG9 A;  2LCC A;  3DLM A;  3CCU T;  4KH1 B;  3BDU A;  3CCR Q;  3UA6 A;  3RKY A;  3J7A F;  1BBZ A;  4X34 A;  4XTV A;  2E41 A;  5ECA A;  2CZ1 B;  4EMG A;  1PSE A;  3MO8 A;  3P8D A;  3QG1 A;  2WSE E;  4HVV A;  5GAN j;  4BUG A;  3OA6 A;  3QWX X;  5D7U A;  1NG2 A;  1C6V X;  3H41 A;  4J7I A;  1EFN A;  2EQM A;  3BY7 A;  2LCS A;  3H0F A;  3OYG A;  1WLP B;  2QEX Q;  2HAX A;  3CC2 T;  1H92 A;  1JB0 E;  1VQK Q;  3CME Q;  5GAO l;  4J6Y A;  5DLO A;  4JJN K;  1U06 A;  2EJ9 A;  1Y7X A;  1D1C A;  2P4R A;  5AYF A;  4IIO A;  3BE3 A;  5LJ3 g;  1Q7Y C;  3M54 A;  2LX9 A;  3MHX A;  4DBQ A;  4XAX B;  1AOJ A;  1D1B A;  2HDA A;  3TQ7 P;  1KQ1 A;  1A0N B;  3VS5 A;  2W10 A;  1NPR A;  4MZM A;  5LJ5 e;  4PJL A;  4DA4 A;  2YLB A;  4ELY C;  4KGX B;  1Y96 B;  1JQQ A;  5GAO q;  1MGQ A;  4M7D A;  3S3M A;  2RH2 A;  3CCL A;  2Y4X A;  2DD4 A;  1Y0M A;  2K57 A;  2OAU A;  3JCM P;  2XU8 A;  2OTJ Q;  2DL7 A;  1VQ6 A;  2RK1 A;  2MK5 A;  1JJ2 S;  1UGV A;  3M9Q A;  4M7A A;  2ROL A;  4IUP A;  2XK0 A;  4LNP A;  3G1J A;  3GIB A;  2ROT A;  2JS0 A;  2HZY A;  2D8H A;  3HL8 A;  3LX7 A;  5LL6 S;  3OS1 A;  1W2B P;  4FYY B;  1WYX A;  1RUW A;  5GJV B;  2A3L A;  2DMO A;  1WGS A;  4F17 A;  4NS5 A;  2CYZ B;  3HRU A;  3V7S A;  2QI2 A;  1TUD A;  2CT4 A;  2O2O A;  5GAM f;  1UTI A;  3CQT A;  1V29 B;  2KYB A;  1N8R R;  4M7A E;  3U23 A;  1VQ9 T;  4N4I A;  5CR2 A;  2RN8 A;  1UG1 A;  4PFZ A;  2K3B A;  1W6X A;  1SF9 A;  5CKB A;  1VQL Q;  4RTW A;  1KK7 A;  1ACM B;  2L3Q A;  5IAY A;  1VQO Q;  5CKF A;  3SDZ A;  4QVZ A;  4E7L A;  2X4X A;  3OYJ A;  3LWH A;  2L5Q A;  2YWW A;  4PJJ A;  2YRD A;  1AWO A;  5LJ5 g;  3CXC P;  2DVE A;  1AZE A;  4N0A A;  3MJX A;  4J9H A;  3TEE A;  4M7D B;  1NZ9 A;  1TUG B;  2A36 A;  4QW2 A;  2RK2 A;  1XNI A;  1P92 A;  2KNB B;  4AMC A;  4FSX A;  2HEQ A;  2PVD B;  3LLR A;  3RDV A;  4MML A;  1M8V A;  3E9F A;  2K5I A;  3Q1J A;  1MV0 B;  2KR3 A;  3CCE Q;  1IB8 A;  1QWF A;  2COY A;  4B6M A;  5A0G A;  3OS0 A;  1E6G A;  3FEO A;  1M1F A;  3CEY A;  4M7A C;  5IXB A;  5CIU A;  2WSF E;  1VQ8 T;  1ZUY A;  2CZ6 B;  3OSS C;  4M78 B;  3CMA Q;  4LDY A;  1PD1 A;  2SRC A;  4OGE A;  6AT1 B;  3FIF A;  5KYX B;  4A4G A;  3CCM A;  1K73 U;  4VUB A;  5LJ3 h;  3GOX A;  2QXF A;  4OB3 B;  2K79 A;  1M9S A;  3CMA A;  4RTV A;  4AT1 B;  3I55 T;  2KSS A;  4XTZ A;  3VUB A;  1X6B A;  4JRP A;  1M30 A;  2BUD A;  2VB6 A;  2Z0W A;  3L42 A;  2X3W D;  2RD1 A;  5KYY B;  2L8D A;  4F04 B;  4RTU A;  2A7Y A;  3JCM Q;  2OTL A;  3OQ5 A;  3HHT B;  2W0Z A;  3H8Z A;  1YHQ A;  3E19 A;  1SPK A;  3EFS A;  3R6N A;  1M1K C;  3JB9 F;  3OY9 A;  1TTH B;  1IZ6 A;  2K4Y A;  3JCM W;  3M0S A;  3MEW A;  3QJY A;  1PRM C;  4X9C A;  4PJN A;  4RTX A;  4M7D F;  2KRN A;  4KGV B;  2QA4 T;  3RUX A;  3X20 B;  3O8V A;  5FRM A;  2EIF A;  1GCQ A;  1WHG A;  4OB0 B;  1VQ5 Q;  2FHD A;  1OPK A;  2HCK A;  1VYV A;  3AT1 B;  3I56 Q;  4KBM B;  2D1X A;  1K9M R;  5I21 A;  1W2B A;  2X35 A;  2DL3 A;  1TXQ A;  1UFF A;  4JRI A;  1VQ5 A;  3LH0 A;  3A8L B;  3OYE A;  3REA B;  2EAY A;  2DTO A;  3VJP A;  4M78 F;  2WSC E;  4J6X A;  1RAB B;  3OS2 A;  5LJ5 h;  3NPF A;  4C0F A;  2DXB A;  2F2V A;  2K2M A;  2YSQ A;  5FU6 B;  1M2O A;  3CCU A;  5FU6 C;  5C6S A;  1NPP A;  3CXC A;  3OS5 A;  2V1Q A;  3X28 B;  4C5E A;  4HCZ A;  1T3S A;  1K9A A;  4OML A;  5KE2 A;  2XD0 A;  1PC0 A;  2ED1 A;  4E7Z A;  2RQU A;  1XTD A;  4CC3 A;  5GAM e;  1LNX A;  2A0F B;  2AK5 A;  2M51 A;  3WVD B;  1ZBJ A;  3CC2 A;  3UDC A;  4JJB A;  2CS7 A;  2RI2 A;  1TSF A;  1VQM T;  2V1R A;  1WXB A;  1X27 A;  4OP0 A;  2E3H A;  2LCL A;  1VQ4 T;  3CPF A;  2XDD A;  1DJ7 B;  3G71 T;  1IO6 A;  4DOV A;  4M7D G;  4FYV B;  4IIM A;  2PTK A;  2GF7 A;  4IUQ A;  3BFM A;  1KC8 R;  2JUF A;  1JU5 C;  1N9R A;  3QYG B;  2RM4 A;  1KFZ A;  3EG0 A;  1HK9 A;  1ZUU A;  2D8J A;  4RCC A;  1ZA1 B;  4EMK B;  4RKU E;  1JEG A;  4B9X A;  2PU9 B;  4LDW A;  1N6A A;  3NFC A;  1YN8 A;  1UB4 A;  4M7A G;  4E7J A;  3EGD A;  2LRQ A;  2FPE A;  2ZPI B;  4C8Q F;  4QKU A;  2B86 A;  2RO0 A;  3KXT A;  1WPY A;  4V2S A;  4C92 D;  1UGR B;  1LCK A;  1ZBX A;  4J9B A;  2O88 A;  1PM3 A;  3FDR A;  2V8J A;  2CSQ A;  1BB9 A;  4UC4 A;  3EAE A;  4J6W A;  1WJQ A;  2JTF A;  4XU1 A;  2R5A A;  4FYW B;  2RQW A;  1W2B S;  1K9M U;  1QP2 A;  5CO7 A;  1Z9Q A;  1YCY A;  1WNL A;  4J83 A;  3CCV Q;  9ATC B;  4A54 A;  2HBP A;  1FXX A;  2AKL A;  2J6F A;  2RJC A;  3G6E T;  2RHU A;  4Z02 A;  5GAN 7;  1D0Y A;  1YP5 A;  1OOT A;  3LWI A;  3EHR A;  3CCV A;  4DBF A;  5A2Q E;  3S3N A;  1WJS A;  5I11 A;  1YJW Q;  4P5N A;  3CXC S;  2DJZ A;  2ZPE B;  1OU9 A;  1WHJ A;  2F2X A;  4RMO A;  1YJ9 T;  4CC2 A;  1O9S A;  2E6Z A;  2F1L A;  2LVM A;  2RHX A;  3EGX A;  3EH1 A;  3QDR B;  1BCO A;  2GCX A;  4BDZ A;  4EMH A;  4OMP A;  4NL3 A;  3JCM X;  3SFM A;  4JLG A;  3HRS A;  2BE7 D;  3CCJ T;  2JM9 A;  5CAI A;  1OX9 A;  3PNW C;  3CD6 T;  1CKB A;  2ZGW A;  1QMC A;  1YWO A;  4BB7 A;  5L23 A;  2DE0 X;  3HP9 A;  1B07 A;  4BI4 A;  1FYN A;  1FMK A;  2JXB A;  2VYT A;  2C0T A;  4C92 A;  1OI1 A;  1KHI A;  4J9F A;  3VS1 A;  4GY5 A;  3UAT A;  3PMT A;  1YJN Q;  3NTK A;  2YT6 A;  3O5Z A;  3WXM B;  3CCS T;  1S72 T;  2M02 A;  5GAN 2;  1KSW A;  2YXY A;  4HVW A;  1YJN A;  4C92 E;  3ER0 A;  2K3Y A;  1T0H A;  3ASK A;  3CBO A;  4OF1 A;  2X9H A;  2JTM A;  1I8F A;  1Y71 A;  4XU2 A;  1RAE B;  3E1S A;  3JCM V;  3ME9 A;  3EGX B;  2EGA A;  4L6V 5;  1GXI E;  3L2U A;  3QJ6 A;  1YCS B;  2ZAE A;  4KT0 E;  3MPU B;  1LPL A;  4ELZ C;  2QA4 A;  4A53 A;  2XHC A;  5FLX E;  4F16 A;  2QDL A;  5GAM h;  5GJW B;  4EIK A;  5CQY A;  5HK0 A;  3ZBD A;  2LQW A;  2VXF A;  3CC4 Q;  3CCQ Q;  3FC3 A;  2E12 A;  4QQD A;  2DRM A;  4LDU A;  1QVF P;  3QKJ A;  1C0M A;  3JB9 I;  4A4E A;  3MP1 A;  3DLL A;  2DD5 A;  2B8A A;  1ZHI A;  1GL5 A;  1IHW A;  1VYU A;  3UT1 A;  4C92 C;  5GAO p;  1PNJ A;  3EFO B;  3PVQ A;  1VQ7 T;  2R5M A;  3JCM e;  1OYX A;  3I56 T;  5HKC A;  1WDX A;  1XJW B;  2DER A;  3RER A;  3VUZ A;  1XOV A;  3DB4 A;  3RNJ A;  4ESR A;  3OBY A;  5IHN A;  3MP6 A;  1KQ2 A;  1NE8 A;  1H3H A;  2DIQ A;  2QG9 B;  5CQX A;  2VGM A;  5HCK A;  2CGH A;  1JBM A;  2DTI A;  2CSI A;  2LQN A;  5CKH A;  1QCN A;  3EH2 A;  1WHL A;  4M77 D;  2Y4Y A;  1VQP Q;  1AD5 A;  3G4S T;  1M8M A;  1YIJ T;  2K2V A;  1YI2 Q;  2L3P A;  5GAN 8;  4N4H A;  2MYS A;  2GGR A;  2LT4 A;  2O4X B;  2VAS A;  3C0C A;  5GMK m;  2XMF A;  4BE2 A;  1VQM A;  1VQP A;  1WZO A;  3CCL Q;  5GMK j;  2KBT A;  3PT9 A;  4XQ3 A;  4OGC A;  2VVK A;  5IH2 A;  1VQ4 A;  3PVL A;  3V8J A;  1G3W A;  1YI2 A;  1CKA A;  5FWC A;  1VOM A;  4MMK A;  3G71 A;  5EG2 A;  2JS2 A;  3OSV A;  4FYX B;  2DX1 A;  5GAN f;  4QVD A;  1WHM A;  1QQJ A;  2E65 A;  2KY9 A;  1VQ6 Q;  3EG9 B;  2YDL A;  4IUV A;  1X2K A;  1I81 A;  3A8O B;  3JCM g;  2PNI A;  2PZ1 A;  2D6F A;  4AG1 C;  5CKE A;  5FWB A;  4KH0 B;  1YFN A;  2M1H A;  3VU3 C;  1IXD A;  2KQW A;  2P0Q A;  4QVC A;  4II1 A;  2ZZD A;  5KYN A;  3T9N A;  2YHT A;  2COZ A;  3M57 A;  3QWY A;  1MMD A;  2EQJ A;  2V8K A;  4HXJ A;  1ZA2 B;  1ARK A;  4AFS C;  5LJ3 d;  2BZY A;  1BYM A;  5A0D A;  1RAC B;  3ZFJ A;  3VS6 A;  3J81 E;  5GAN 3;  2KXC A;  3OYL A;  4PJM A;  1JXM A;  2EQU A;  3M0Q A;  5FW9 A;  3OYC A;  4L5G A;  1TUC A;  2JNG A;  1TWB A;  2VGN A;  3OYK A;  2FO0 A;  1NLO C;  4E7S A;  4J7F A;  5IT9 E;  4HVU A;  5D6W A;  3V8K A;  2EFI A;  1G3S A;  4JZ3 A;  1I5L A;  2RF0 A;  4PJO E;  3UA7 A;  3FJP A;  2LP5 A;  2O9S A;  4M77 A;  2X4W A;  2AZS A;  2DLP A;  1QVF A;  3M0U A;  2XID A;  1Q82 R;  2AIR B;  3MEU A;  4RTY A;  3VYG A;  1GCP A;  4RUG A;  3G6E A;  2DXU A;  1IGQ A;  2EGE A;  3A5Z B;  3KFV A;  2OJ2 A;  4M77 E;  2ABL A;  1Q81 R;  4LDX A;  4FCY A;  1IRX A;  2EW3 A;  2FZK B;  1UUE A;  2E64 A;  2LQK A;  5CKD A;  3PE0 A;  3FRN A;  3M5A A;  1NEG A;  3MEA A;  2CP3 A;  4M7A B;  1SSH A;  5GMK l;  1RLQ C;  5M9O A;  2L2P A;  3CCM Q;  1K73 C;  1ZQ1 A;  3CPW P;  4OVA A;  4OMM A;  4PJO C;  1RL2 A;  2QYZ A;  1WX6 A;  3P8B B;  5FU7 C;  2MWP A;  1AEY A;  1G83 A;  4C0Z A;  5LJ5 d;  4C92 G;  1TOV A;  3L2V A;  2NUZ A;  1YIT T;  1AWJ A;  3EG1 A;  3M55 A;  3CD6 A;  4HT8 A;  1EX4 A;  5DLQ E;  1OX8 A;  1KIK A;  2OTL Q;  2FZG B;  2LDM A;  5CK9 A;  4M75 E;  1BI2 A;  3PMI A;  3LH5 A;  1YHQ Q;  4E7I A;  1KD1 R;  1SHG A;  4M77 C;  1ABQ A;  2LJ0 A;  4PNO A;  4NOY A;  1T3L A; 
#chains in the Genus database with same CATH homology
 4BDY A;  4C0G A;  3OYN A;  1HK9 A;  3HPW A;  1N9S A;  1QVP A;  2BKD N;  3GLX A;  4JLI A;  1YBY A;  4RCC A;  4X9D A;  3RKW A;  4EMK B;  2CZ0 B;  4RKU E;  3L2R A;  4O6J A;  4CRI A;  4C92 F;  2OTL T;  3JCM h;  3S3O A;  2KAF A;  4JRK A;  4B9X A;  2F69 A;  2PU9 B;  3NTH A;  4LDW A;  4N4G A;  4HKE A;  2E6N A;  3SWN A;  5GAM j;  1Q7Y U;  1N6A A;  2DO3 A;  3NFC A;  3OYF A;  4DQ2 A;  1FWZ A;  2R58 A;  3TCJ A;  5GMK h;  3JB9 J;  1YHQ T;  1QP3 A;  4HA8 A;  1UB4 A;  1NJI C;  1WQW A;  1BI0 A;  4M7A G;  2O01 E;  4E7J A;  1O75 A;  2LRQ A;  1VIF A;  3CMA T;  1VQN A;  4PJO A;  3VYH B;  2RJD A;  3NTI A;  1VQN T;  3M4Y A;  3VV0 A;  2ZPI B;  2QQS A;  3QZ5 B;  4C8Q F;  2I2L A;  3OYI A;  2RO0 A;  3KXT A;  2MWO A;  3OYB A;  1UEB A;  1WPY A;  4V2S A;  4C92 D;  1UGR B;  4IUT A;  1U1T A;  4D6W A;  1ZBX A;  1JJ2 A;  2FVU A;  4ME7 A;  4M7D E;  3FDR A;  2LC4 A;  4A4F A;  2V8J A;  3JB9 D;  2JZ2 A;  4OB1 B;  1B34 B;  1U1S A;  3ZEH A;  2FB7 A;  4UC4 A;  2RHZ A;  4M75 C;  4KUD K;  1JRI A;  3EAE A;  2OTJ A;  1N8R U;  3KUF A;  4J6W A;  4C8Q D;  4M7D D;  3JCM d;  4BY6 C;  3MCA B;  1WJQ A;  2JTF A;  4XU1 A;  4M78 A;  5GAN e;  2R5A A;  4M7A F;  1QVG S;  2O4X A;  1W2B S;  5LJ3 e;  1K9M U;  1I4K 1;  4QQ6 A;  1QP2 A;  5CO7 A;  4DOW A;  4WF2 A;  1YCY A;  1M1G A;  3C95 A;  1WNL A;  2DEQ A;  4J83 A;  2HQE A;  2CZ7 B;  2H3J A;  1TH7 A;  3N5B B;  4XTX A;  2VC8 A;  4A54 A;  4CI0 C;  2P0K A;  2DXT A;  2E70 A;  1QVF S;  2HBP A;  2BIV A;  3CC7 A;  1H64 1;  3J80 E;  1FXX A;  2ZPH B;  3HFO A;  3CC7 T;  2K5L A;  2RJC A;  1Y96 A;  3GNG A;  1Q82 U;  3G6E T;  2C06 A;  2VXE A;  3CBP A;  2RHU A;  2X4J A;  4Z02 A;  5GAN 7;  3CC4 A;  2K5F A;  3CCQ A;  4M7A D;  4M78 E;  3QBY A;  1VQ7 A;  3RER A;  4B9W A;  3OYH A;  3JAM E;  4JS4 A;  3LWI A;  1UGS B;  5J26 A;  3CCV A;  1X75 C;  5A2Q E;  2LCC A;  3S3N A;  3DLM A;  3CCV T;  3CCU T;  1HXD A;  3BDU A;  2HQX A;  5A0L A;  1WJS A;  2LTO A;  1VQL A;  2VV5 A;  3MET A;  4P5N A;  3RKY A;  3QSU A;  1Q81 U;  3J7A F;  4X34 A;  4XTV A;  1OZ2 A;  2DJZ A;  2ZPE B;  3V7R A;  4BI3 A;  3CXC S;  3SWN B;  1YJ9 A;  2E41 A;  4EMG A;  2CZ1 B;  1VQO A;  4RMO A;  1KQS S;  1PSE A;  1YJ9 T;  3SWN C;  4M7D C;  5KCO A;  2FL7 A;  3MO8 A;  1O9S A;  2QQA A;  3P8D A;  2E6Z A;  3LYI A;  3QG1 A;  2WSE E;  4FIB A;  2LVM A;  4F7U A;  5HK3 A;  4PJO B;  2RHX A;  3MEV A;  5GAN j;  4BUG A;  3OA6 A;  5IN1 A;  1BI1 A;  3V7C A;  4J7I A;  2KMT A;  4M75 A;  2EQM A;  3BY7 A;  5LJ3 j;  3QDR B;  3CCR T;  2GCX A;  5FU7 B;  1YJW T;  2KVQ G;  4BDZ A;  4EMH A;  3OYG A;  2XKO C;  2HAX A;  2EJF A;  4NL3 A;  3JCM X;  3SFM A;  4HCC A;  4XTY A;  3HRT A;  1W4S A;  3CCJ A;  3RIR A;  3CC2 T;  4JLG A;  3HRS A;  2D9T A;  4J5Y A;  3X25 B;  3CCJ T;  5CAI A;  1JB0 E;  4E7K A;  3PNW C;  3CD6 T;  2ZGW A;  3G4S A;  1YIJ A;  4BB7 A;  1S72 A;  3OYA A;  3QII A;  4J6Y A;  4F7U E;  5DLO A;  5GAO l;  3CPW A;  3HP9 A;  4JJN K;  3WVE B;  4IUU A;  3JRZ A;  4ZGD B;  2EJ9 A;  1Y7X A;  4Y28 E;  3CCE A;  2DXC A;  5AYF A;  5GAN g;  4BI4 A;  2QEX T;  1U8R A;  4M78 C;  2JVV A;  2VYT A;  4M77 B;  5LJ3 g;  1Q7Y C;  4C92 A;  3PIP A;  3M54 A;  2LX9 A;  1OI1 A;  3MHX A;  4XAX B;  1KHI A;  4GY5 A;  1UGP B;  4NL2 A;  3OYM A;  1KQ1 A;  1VQK T;  2LNV A;  3PMT A;  1QW1 A;  2DZ9 A;  3QXE B;  3NTK A;  1LJO A;  3CME T;  1KD1 U;  3CCS A;  1NPR A;  3WXM B;  4MZM A;  5LJ5 e;  3CCS T;  4KUI A;  4R56 A;  2YLB A;  4DA4 A;  4LD6 A;  4ELY C;  1S72 T;  3A8M B;  1Y96 B;  5GAO q;  1VUB A;  4IUR A;  1SSF A;  1MGQ A;  5GAN 2;  4C8Q A;  4M7D A;  2RA2 A;  5DY9 A;  3S3M A;  5LJ3 f;  2RH2 A;  4MZP A;  3CCL A;  2Y4X A;  2EQK A;  2DD4 A;  3E9G A;  1YJN A;  4C92 E;  2D0Q B;  2K57 A;  1YJN T;  3ER0 A;  4HCB A;  2K3Y A;  4MDX A;  2OAU A;  3JCM P;  1Y07 A;  3ASK A;  2XU8 A;  2XDB A;  5FRO A;  3CBO A;  4OF1 A;  2PUO B;  2Y90 A;  5DM7 R;  2XIC A;  2VUB A;  2JTM A;  1N8R C;  1I8F A;  3SB2 A;  4N0A C;  1BI3 A;  1Y71 A;  4XU2 A;  3L2Q A;  1VQ6 A;  1KG1 A;  2RI3 A;  2RK1 A;  2DKG A;  4A4K A;  3QUI A;  3GP8 A;  3E1S A;  4QQG A;  1K9M C;  4C8Q E;  3JCM V;  1G3T A;  3GNF B;  3ME9 A;  5GMK i;  1JJ2 S;  1H3Z A;  3C4S A;  3M9Q A;  5CCA A;  4L6V 5;  4M7A A;  1GXI E;  5GAM g;  3OW2 A;  3KBG A;  3M53 A;  3A8H B;  4IUP A;  3L2U A;  2WAC A;  4ZGE B;  4M75 B;  3QJ6 A;  2PVO B;  2XK0 A;  3TRE A;  4KT0 E;  4EDU A;  4E47 A;  2YRV A;  4BY6 B;  2V8I A;  2QA4 A;  4ELZ C;  3GIB A;  4A53 A;  2XHC A;  1IRE B;  3LX7 A;  5LL6 S;  3HL8 A;  5FLX E;  5GAM h;  3OS1 A;  2OTJ T;  3S6W A;  1Q82 C;  3AHU A;  2A3L A;  3BW1 A;  3PTA A;  1WGS A;  3A8G B;  5CQY A;  5HK0 A;  3ZBD A;  2VXF A;  5LJ5 j;  4M77 G;  4NS5 A;  3JCM J;  4O5V A;  2CYZ B;  3HRU A;  3V7S A;  2QI2 A;  4JDS A;  4PJO F;  3FC3 A;  2E12 A;  3DB3 A;  3X24 B;  4QQD A;  3GPL A;  4ZTJ A;  1M1K U;  3LGF A;  4LDU A;  4BI8 B;  3QKJ A;  5GAM f;  1VQ9 A;  4XK8 E;  1V29 B;  3JB9 I;  4M7A E;  4A4E A;  1VQ9 T;  4R55 A;  2EWN A;  3MP1 A;  4N4I A;  2DAQ A;  5CR2 A;  4BAC A;  1FX7 A;  5I2M A;  3DLL A;  3C94 A;  2DD5 A;  5I2S A;  1Q81 C;  2B8A A;  5CKB A;  1ZHI A;  2MAM A;  3DKM A;  2QQR A;  3UT1 A;  5CKF A;  3SDZ A;  5IAY A;  4QVZ A;  5CVI A;  4ATO A;  4C92 C;  4E7L A;  3MP8 A;  4FL6 A;  5GAO p;  2M16 A;  3CC4 T;  2X4X A;  3OYJ A;  2HD0 A;  3LWH A;  3CCQ T;  2L5Q A;  3HFN A;  2XI9 A;  1VQ7 T;  2EJG A;  3OBW A;  2R5M A;  2HNI A;  2DPP B;  3I56 A;  3JCM e;  2M9U A;  5LJ5 g;  1OYX A;  3FB9 A;  4MDW A;  3I56 T;  3G7Z A;  5HKC A;  4E7H A;  3INZ A;  3JB9 H;  2DVE A;  3SD4 A;  4N0A A;  3VUZ A;  5KE3 A;  2K3X A;  3PFS A;  4C8Q B;  5GMK e;  1VQL T;  3TEE A;  2F5K A;  4EMK A;  3RMS A;  5GAM d;  4M7D B;  4M77 F;  1NZ9 A;  4C8Q C;  1XOV A;  3DB4 A;  1VQO T;  1EIF A;  5FRN A;  3OBY A;  4QW2 A;  2RK2 A;  3MP6 A;  1KQ2 A;  1NE8 A;  1XNI A;  2DIQ A;  1P92 A;  5CQX A;  4FSX A;  1RI0 A;  2E10 A;  2PVD B;  2RJF A;  3LLR A;  3M56 A;  2VGM A;  2CGH A;  4MML A;  4C5I A;  3OMC A;  1JBM A;  1M8V A;  5LJ5 f;  1VIE A;  3E9F A;  2DTI A;  2K5I A;  5CKH A;  3Q1J A;  2E1H A;  2JOY A;  4GLK A;  5GAO n;  4IKF A;  2F5T X;  4KUL A;  4M77 D;  4EPC A;  2Y4Y A;  2L3R A;  5A0G A;  1WJR A;  3OS0 A;  4C5G A;  3FEO A;  1M1F A;  3CEY A;  4M7A C;  1MHN A;  1VQ8 A;  3G4S T;  4XTW A;  1KD1 C;  5CIU A;  1YIJ T;  2WSF E;  1VQ8 T;  3URG A;  2K2V A;  2CZ6 B;  2E5Q A;  2RJE A;  3OSS C;  4HT9 A;  4YTL A;  5GAN 8;  3EFR A;  5GAN 4;  3CPW S;  4N4H A;  4M78 B;  1X01 A;  2XDP A;  3CCE T;  2LT4 A;  2O4X B;  2YLC A;  2LQ8 A;  5D6Y A;  4LDY A;  2PQW A;  5GMK m;  3F70 A;  4BE2 A;  3JCM b;  1VQM A;  2DIG A;  2G3R A;  2EKO A;  4OGE A;  4JS5 A;  1VQP A;  3FIF A;  4A4G A;  5GAN h;  5GMK j;  4FT2 A;  3PT9 A;  4XQ3 A;  3L2W A;  3CCM A;  1VQP T;  4OGC A;  4M75 F;  1VQ4 A;  2GFA A;  4VUB A;  5LJ3 h;  3V8J A;  1G3W A;  3QHS A;  5KH6 A;  3GOX A;  1YI2 A;  1KC8 U;  5L8R E;  2QXF A;  4MMK A;  4OB3 B;  3G71 A;  3JB9 G;  1YI2 T;  5EG2 A;  1M9S A;  3OSV A;  3I55 A;  3CMA A;  3JSC A;  1Q86 C;  4ZTF A;  5GAN f;  4QVD A;  3I55 T;  2KSS A;  4XTZ A;  3GF5 A;  2E65 A;  2KY9 A;  2JN0 A;  3H6Z A;  3VUB A;  3FLG A;  4ZN3 A;  3QO3 A;  3R6O A;  4JRP A;  2BUD A;  3M58 A;  3UWN A;  4IUV A;  3L42 A;  3CCL T;  1I81 A;  3OYD A;  3A8O B;  3JCM g;  3M59 A;  4FT4 A;  2RD1 A;  3L1A A;  4PJO G;  2D6F A;  1UGQ B;  4LDV A;  5GAO m;  3QYH B;  5CKE A;  2L8D A;  3VKI A;  5D6X A;  2A7Y A;  2M1H A;  1BKB A;  3VU3 C;  3JCM Q;  2OTL A;  2KQW A;  2P0Q A;  3OMG A;  3OQ5 A;  4QVC A;  4II1 A;  1Q86 U;  2ZZD A;  3HHT B;  1PSF A;  4EMK C;  2RB6 A;  3T9N A;  4PKC C;  3H8Z A;  1YHQ A;  1VQ6 T;  4BE0 A;  2YHT A;  3E19 A;  4F7U B;  3M57 A;  3EFS A;  2EQJ A;  2V8K A;  2MI6 A;  5GAN d;  1M1K C;  3OY9 A;  1LOJ A;  1IZ6 A;  2K4Y A;  3JB9 F;  3JCM W;  3JCM f;  5LJ3 d;  4ZGJ B;  3MEW A;  2QQB A;  4FM4 B;  3OW2 S;  3QJY A;  3QPH A;  4X9C A;  5HY6 A;  1BYM A;  5A0D A;  5C0M A;  3ZFJ A;  3J81 E;  4PLL A;  5GAN 3;  4M7D F;  2P0P A;  2EYQ A;  2DK3 A;  2QA4 T;  3RUX A;  3X20 B;  4C5H A;  2IG0 A;  4M78 G;  3OYL A;  3HKS A;  3O8V A;  2CKK A;  2EQU A;  5FRM A;  3OYC A;  1D3B A;  2EIF A;  2JNG A;  2VGN A;  2ZPG B;  4L5G A;  3OYK A;  1NJI U;  4J7F A;  2QQ9 A;  1BIA A;  2AHJ B;  4OB0 B;  2FHD A;  1M5Q 1;  2QDY B;  1M90 C;  3LGL A;  5IT9 E;  5D6W A;  3BDL A;  3V8K A;  2EFI A;  5GAN 6;  1G3S A;  4Y91 A;  3OYY A;  1I5L A;  4PJO E;  4KBM B;  2GFU A;  2DTH A;  4C92 B;  1QVG A;  4RG8 A;  4XU3 A;  3FJP A;  5I21 A;  1W2B A;  2X35 A;  4Q5W A;  5GAN 5;  4JRI A;  2MF2 A;  4M77 A;  1VQ5 A;  2X4W A;  3LH0 A;  3LW5 E;  4PJO D;  3A8L B;  2RI5 A;  1M90 U;  1VQ5 T;  3OYE A;  2P4T A;  2EAY A;  2GQV A;  1QVF A;  1OZ3 A;  2DTO A;  2XID A;  3L2Z A;  3VJP A;  3MEU A;  4M78 F;  3VYG A;  1KHC A;  3UPU A;  2WSC E;  4J6X A;  4PL6 A;  3G6E A;  2DXU A;  4XTU A;  2PUK B;  3OS2 A;  5LJ5 h;  1XQH A;  4PLI A;  1N27 A;  3V8L A;  1K8A C;  4C0F A;  2DXB A;  1AHJ B;  3A5Z B;  3JCM c;  4BE1 A;  3TU4 K;  4J8O A;  4JUV A;  5FU6 B;  4F7U G;  2ZPF B;  3P8H A;  4M77 E;  3CCU A;  5FU6 C;  3RKX A;  5C6S A;  2R57 A;  4LDX A;  2ZCF B;  2FYK A;  4M75 G;  1NPP A;  3CXC A;  3HSB A;  2QTX A;  3PGG A;  3OS5 A;  2E64 A;  4M78 D;  3X28 B;  4C5E A;  2LQK A;  5CKD A;  1KQS A;  4ZN1 A;  5J39 A;  3FRN A;  3M5A A;  4HCZ A;  5J3B A;  2L89 A;  1K8A U;  3MEA A;  4BD3 A;  4M7A B;  1R8O B;  2ZPB B;  5KE2 A;  5GMK l;  4XU0 A;  4JRQ A;  5GAO r;  2XD0 A;  3CBM A;  4OMF B;  5M9O A;  1G3Y A;  1K73 C;  2M0O A;  2DZC A;  2RHI A;  1XTD A;  1KC8 C;  1ZQ1 A;  1BIB A;  5GAM e;  4OVA A;  1B34 A;  3CCR A;  2X4Y A;  1LNX A;  4PJO C;  4OB2 B;  1YJW A;  2LT1 A;  1RL2 A;  1X6O A;  2RHY A;  3M4G A;  3RES A;  4RCB A;  4C0D B;  4FU6 A;  1YIT A;  3P8B B;  5FU7 C;  2MWP A;  4C0D C;  3WVD B;  2KK4 A;  4C0Z A;  5LJ5 d;  1D3B B;  4C92 G;  3UDC A;  3L2V A;  4F7U F;  1YIT T;  3CC2 A;  3M55 A;  2CS7 A;  2RI2 A;  2KDS A;  1VQM T;  3CD6 A;  4RG2 A;  4HT8 A;  4OP0 A;  2XG8 D;  5DLQ E;  4MZT A;  4A4H A;  3CCM T;  2LCL A;  1VQ4 T;  3OB9 A;  4TVR A;  2PVG B;  1WQ7 A;  3CPF A;  1M4Z A;  1DJ7 B;  3RMQ A;  2XDD A;  3G71 T;  5KCH A;  2QEX A;  4DOV A;  2LDM A;  3PIO A;  5CK9 A;  4M75 E;  4C8Q G;  4LD9 K;  4M7D G;  1BI2 A;  3PMI A;  2NLU A;  2GF7 A;  4E7I A;  4IUQ A;  3BFM A;  4L59 A;  4M77 C;  2JUF A;  1K73 U;  2MMP A;  3C12 A;  1VQK A;  1N9R A;  1G5V A;  2IVW A;  3QYG B;  3CME A;  3QZ9 B;  3X26 B;  2RM4 A;  4PNO A;  4NOY A;  4M75 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...