2JOYA

Nmr structure of 50s ribosomal protein l14e from sulfolobus solfataricus: northeast structural genomics consortium target ssr105
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
96
structure length
96
Chain Sequence
MPAIEVGRICVKVKGREAGSKCVIVDIIDDNFVLVTGPKDITGVKRRRVNILHLEPTDKKIDIQKGASDEEVKKKLEESNLTEYMKEKIKIRMPTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of 50S Ribosomal Protein L14e; Northeast Structural Genomics Consortium Target SSR105
rcsb
source organism Sulfolobus solfataricus
molecule tags Structural genomics, unknown function
molecule keywords 50S ribosomal protein L14e
total genus 18
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2joyA01
3CXCA 2JOYA 4RG2A 1VQ8T 1VQOA 1W2BA 1Q82C 1KD1U 1YJNT 1VQ5A 1KQSS 1NJIU 1N8RC 3CMEA 4CRIA 3CD6A 3G71A 3CCUA 1VQ6T 1M90U 1YJWA 3G4ST 3P8BB 3PIPA 3CCVT 1YJ9A 1NJIC 2LCLA 3J81E 1VQ9A 3JAME 3CC2T 3CC4A 2QEXA 1S72A 1YIJA 2JNGA 1KC8U 1M1KC 1KQSA 2OTLT 3CC7T 1Q86C 1K9MC 3LGLA 1W2BS 3TREA 3CC7A 1VQKT 3I55A 1VQPA 2LVMA 2DO3A 1YHQT 1M1KU 1YI2T 3OYYA 1Q86U 1K9MU 2L3RA 1Q81C 3LGFA 1YJWT 3G71T 3CPWS 1IZ6A 1YITA 1K73U 1YIJT 5IT9E 3CCVA 2E6ZA 1SSFA 3CCSA 1Q81U 1VQLT 3CC4T 1VQ9T 2OTJA 1VQ4A 2OTLA 1QVGS 4QQDA 1K73C 1Q7YU 1VQOT 1JJ2A 3KBGA 3DLLA 1VQMA 3CMET 4TVRA 4X34A 5HY6A 1YBYA 1Q7YC 1VQ6A 1YITT 1VQ8A 3CD6T 2KVQG 1YJNA 1VQ5T 3CCJA 1NPRA 1Q82U 1VQ7A 4ZN1A 2QA4T 2MWOA 1K8AU 3CCQA 1VQ4T 2KDSA 1XTDA 1NZ9A 4YTLA 1XNIA 3HKSA 2E70A 1NPPA 3G6ET 5LL6S 5DLQE 1N8RU 1QVFS 1K8AC 3CCLA 2QEXT 5IAYA 3I55T 1VQPT 1M90C 1M1GA 1UEBA 3DB4A 3CCRA 3OW2S 1YHQA 1VQNA 3CCRT 3LH0A 1YI2A 5J26A 2JVVA 3CMAA 5A2QE 3CMAT 2MI6A 2G3RA 1KC8C 2XHCA 1EIFA 1QVGA 3CC2A 1X6OA 2EIFA 1YJ9T 1VQKA 1S72T 3ER0A 3A5ZB 3G6EA 1BKBA 2IG0A 1VQNT 3CCMT 3CPFA 3CPWA 1RL2A 3J7AF 1JJ2S 3CCLT 3OW2A 3CXCS 2LQ8A 3G4SA 1VQMT 4ZN3A 1QVFA 3CCUT 2JUFA 1KHIA 5FLXE 3PIOA 2OTJT 3CCJT 1VQ7T 3CCQT 5J3BA 3CCST 3I56A 2CKKA 5DM7R 3DB3A 3CCET 1KD1C 3J80E 3I56T 1VQLA 3CCEA 2QA4A 3CCMA 2MWPA
chains in the Genus database with same CATH superfamily
1M3AA 4RTYA 1VQ8T 1M3CA 1YJNT 1G3YA 1ZA1B 1N8RC 3CD6A 4LD9K 4ME7A 5FU7B 3UT1A 4OMLA 3PIPA 3OW2P 2YWWA 3FDRA 4JDSA 2C0IA 3MPUB 3L2QA 2LMJA 4A4KA 2QQRA 3CCRQ 4EMHA 4HCKA 4OMMA 2H3EB 3EFOB 2X35A 5IHIA 2P0KA 2F2XA 4DEYA 1F1BB 1D09B 1T3SA 2VV5A 1N8RR 1K73U 1UUEA 5GAMd 3V8JA 4KGZB 4BI3A 1RLQC 3SWNC 4BDYA 4OGCA 1VQ9T 1YNZA 2R5MA 3G4SQ 3M57A 1D0YA 5KYWA 3OYAA 2LX7A 4AFUC 3REBB 4Z02A 2WACA 1OV3A 4AG2C 3EG0A 3OSVA 2CZ0B 1TU0B 1U5SA 4E7SA 4C0DB 4AMCA 4XK8E 5CVIA 4ZN1A 2XG8D 1KIKA 2NYSA 1MNDA 1NPPA 4J9HA 5FROA 2CDTA 1V76A 1N8RU 2F5TX 1VQMQ 4PNOA 4E7ZA 2QEXT 1VQPT 1Y71A 1RABB 2OTLQ 2MF2A 3L42A 2EYQA 2FEIA 1NLOC 2C0TA 1M1KR 1BBZA 3RUXA 5GANd 3R6NA 4X9CA 2B8AA 1VIEA 3UA6A 9ATCB 1M8VA 4OB1B 3OYDA 3JCMP 3SB2A 3S3MA 2RHUA 1WFWA 2O31A 4IIMA 4OB2B 2RNAA 1V29B 3CXCA 4PK4A 5KYUA 3JCMV 3VUBA 1M2OA 4RTXA 1VQOA 1OX9A 3VYHB 2YXYA 5KYYA 1K76A 3OYCA 4MDXA 4F16A 3CC4A 1YIJQ 5GANh 3T9NA 1W2BP 2VYTA 1PNJA 1D1AA 2EQUA 1Q86C 4ZTFA 2O9VA 3SDZA 2MPXC 1YFNA 3QWXX 2X4YA 2BTTA 1C1AA 3LGFA 5IHNA 1UJYA 2E10A 5CK9A 2ATCB 3URGA 2F5KA 1ZUKA 3MEVA 3LLRA 2GTOA 4XTVA 2JZ2A 1BIBA 1ZUYA 1FXXA 4E7HA 1PSFA 4E2FB 5HY6A 3AHUA 1Q7YC 4LUEA 4JZ3A 3CD6T 1T3LA 1NPRA 1WA7A 3G6ET 2CT4A 2LNVA 3MEWA 4C5GA 3QPHA 1KD1R 1JBMA 3VS6A 5I21A 4KH1B 1I8FA 1R77A 5GAOl 2L3PA 2YSQA 2EGAA 2ECZA 2HAXA 5A2QE 2FHDA 1N9SA 6AT1B 1MHNA 1X6OA 2EW3A 5GAN2 2RF0A 2PVOB 1KQSP 3CPWA 4P5NA 1U06A 1Q82R 2MAMA 1UGQB 2GGRA 2RM4A 2R5AA 2AT1B 4FL6A 2JUFA 3E2UA 1KHIA 2J05A 1AD5A 3G1JA 1K4US 4KBMB 1WJRA 2JN0A 2AK5A 1YCYA 2DXUA 2IPOB 2PU9B 1AWWA 2PUOB 2DZ9A 1VQLA 2EYWA 3CCEA 3JCMQ 1PHTA 3EFOA 4C0ZA 4M75A 4PJOE 2KROA 2KXCA 2QGFB 4MDWA 4PJOG 1K0XA 4DBQA 2KEAA 2F2VA 1QCNA 4DOVA 3P8BB 3C95A 1YJ9Q 3ZL7C 2YUOA 4GY5A 1YWPA 2RH2A 3CMAQ 1T0JA 4BE2A 5GAOq 1KQSA 2K6DA 3BY7A 2RQUA 2DERA 3TREA 3I55A 3OYFA 1IB8A 2DO3A 3TQ7P 2WSCE 1VQKQ 4M77B 4AFSC 8ATCB 1SKUB 4C92D 2YRCA 4F7UG 4EMKA 3QHSA 3TCJA 2YUPA 3KBGA 1RI9A 3S6WA 1BI1A 1D1BA 1X27A 1VQ8A 2E3IA 2BZYA 3CCEQ 5GAMf 1XTDA 1TSFA 1XNIA 2B86A 1VQ7Q 5D6YA 1UGVA 4LUDA 5C0MA 2K9GA 1AWOA 4M78E 2DYIA 3MP8A 5GMKe 2KK4A 2JVVA 1IXDA 2HL5C 3M4YA 2M1HA 1PD1A 1ZX6A 2DF6A 2O88A 3OYGA 3G6EA 4JLIA 2IG0A 4J7IA 2L3SA 1LOJA 4EIKA 2EQMA 1OOTA 3OW2A 1M27C 5FRMA 3EG9B 1E6HA 1X43A 1H3HA 3EG9A 3BFMA 1T0HA 2NLUA 1K1ZA 2OTJQ 3TU4K 1G83A 1PD0A 3CCMA 1GL5A 4DOWA 1VIFA 4C92A 1B34A 1JRIA 2A7YA 1W2BA 4C92C 1VQ5A 5I11A 2KT8A 3DKMA 1OEBA 4PJMA 2V8KA 1IRXA 1S72Q 4M75G 5GMKh 1B3QA 2CP5A 1NJIC 2LCLA 4J9EA 4CC4B 2DJZA 4C92G 3EFSA 2LCCA 4MZPA 2HDAA 2DIGA 2IIMA 4A54A 3QG1A 3QJ6A 1OX8A 2DEQA 5FRNA 4FYYB 1HD3A 4XU1A 4ZGDB 2QDYB 3LW5E 3JRZA 4C5HA 3JSCA 5GAOn 3OBYA 1VOMA 2JTEA 1B7TA 1SSFA 2COWA 3RKXA 4IUPA 4C8QD 3REAB 4IKFA 1VQ4A 4Q5WA 2KYBA 1XQHA 1N6AA 2BZXA 3OMGA 1GBQA 2DILA 2JS0A 4NOYA 3UF4A 1W6XA 4C8QG 1Q82U 1VQ7A 2YDLA 2V1RA 5GAMe 3CCJQ 2DYBA 3QBYA 4FSXA 2Z0WA 1SEMA 2DD5A 1QKXA 1UEBA 3OW2S 5FWBA 2JS2A 5KE3A 3A8MB 2X9HA 4M7DE 5J26A 2HZYA 1WJSA 4RTVA 5CIUA 1TUCA 4JRKA 5AT1B 4OB3B 4UC4A 1OPKA 4M75D 2RI3A 1XJWB 5A0GA 1S72T 1VQ6Q 3CCMT 2E5QA 4C92E 2MK5A 1LVKA 1B34B 4FM4B 4JS5A 1SRMA 2E5KA 3RMSA 4ORZA 2PVDB 2OTJT 3RKYA 2QQAA 1KG1A 2K5IA 4AFZC 2LT1A 5GAMh 3LYIA 3RESA 2V1QA 5GANe 1VA7A 4CRIA 1QVGP 2EYYA 4M78D 3PGGA 3EG3A 2JXBA 1H3ZA 1AOJA 3G71Q 3JB9H 1HJDA 1MMGA 1MUZA 3GPLA 3LGLA 1W2BS 1TUDA 3WXMB 3M56A 3QDFA 1M1KU 3MP1A 3M0UA 1QP3A 3CPWS 2DJQA 1X2QA 2QA4Q 4FU6A 4LD6A 5IT9E 4L59A 4QW2A 3CC4T 1SHFA 1OZ3A 1Y96B 4FYXB 2FZGB 4QT7A 3MP6A 3JB9D 1ZSZA 1PRMC 4C92F 2QTXA 4M7AC 2RN8A 2DM1A 2CSIA 4OMOA 2QI2A 2K3BA 1AVZC 3CCJA 2K3YA 2J06A 3OS2A 3GIBA 3E1SA 4E7LA 2E12A 1RAEB 3L2UA 3NHNA 3BE3A 2J7IA 4DQ2A 2YHTA 3DB4A 2H3JA 2P0QA 4AG1C 2KSSA 4PJNA 3NTKA 3LH0A 2D8JA 3OS0A 4D8KA 3CMAT 5HK0A 5LJ5f 1EIFA 2RPNA 3A98A 1YJ9T 3HP9A 1UTIA 1EZZB 2LZ6B 4B9WA 2DA9A 4PJOF 1S1NA 4HXJA 1U1SA 1G2BA 1XOVA 4J9BA 1MNEA 1OULA 4L5GA 1Z9ZA 1M5Q1 4CC2A 2ROLA 1TOVA 2SEMA 2CH4A 3R6OA 1IHWA 3DLMA 3J80E 5A0LA 5KYUB 2COYA 4A53A 3GLXA 4RCBA 2E3HA 3L2WA 2FO0A 1ZQ1A 1M1FA 3INZA 2HBPA 3JB9G 4Y28E 1QW1A 2CP2A 3VV0A 2NUPA 3UDCA 5KYYB 1KQSS 4KULA 2MOXA 1MV3A 3HTRA 3JCMJ 2OI3A 1KSWA 4QVCA 1KK7A 4FW2A 1DJ7B 5IN1A 4OMQA 1VQ9A 3J81E 2PQWA 5CKEA 4M7DD 1PWTA 1KC8U 3CC7T 2EKHA 3TVTA 4J6YA 4IUQA 1GXIE 3VU3C 5KYXB 1KHCA 1RAFB 4DEXA 3VS1A 2LCSA 1W70A 4A4EA 4JS4A 4M75E 2KRMA 1R8OB 2LNHB 1CKBA 2CZ1B 4XU2A 4QQGA 3RERA 2BKDN 3C12A 2HKNA 1RAGB 3LX7A 2EGEA 5CCAA 2L8DA 1Q7YU 1ZBJA 4HT9A 3LWIA 2VGNA 3PNWC 1I4K1 1YBYA 1Z9QA 3O8VA 4OGEA 1ZUUA 1TG0A 2RHXA 2DXCA 2DZCA 2DTIA 1P92A 2QA4T 1VQ4T 2ZPIB 3QJYA 3UPUA 2XDBA 1VYUA 4RCCA 4JPBW 4R56A 1Q86R 3KXTA 5IAYA 4LDVA 1YHQA 1AEYA 4JJNK 4PL6A 2COZA 2KT1A 3FEOA 4E47A 2LQNA 1KFZA 2XDPA 2K57A 3I5RA 2K2MA 2CH4W 1PKTA 2DBKA 2XHCA 1U8RA 2RB6A 3QXEB 3GBQA 2RI2A 1I5LA 4HVVA 4M7DG 1UHFA 1VUBA 2DAQA 4N0AA 1YWOA 1D3BA 3CXCS 4BE0A 2E65A 4ZN3A 1ZSZC 1D3BB 2RHYA 3TEEA 3RNJA 4M7DC 1X6GA 2L2PA 2EAYA 2DRKA 2RA2A 2MCNA 1LPLA 3SHWA 4J7FA 4HT8A 2GTJA 2L5QA 3E19A 3C0CA 3OQ5A 3CCMQ 2KMTA 2ZPGB 1G8XA 3G71A 1VQ6T 1M9SA 3VRZA 4KGXB 3MEUA 3OBWA 4PJJA 2GCXA 5M9OA 2QEXA 1NG2A 3HSBA 2CZ7B 2JT4A 2BZ8A 3IQLA 2EYXA 5GAN6 1I0CA 1OU9A 2AKLA 2OJ2A 4D8DA 3C94A 1UHCA 1WXUA 4D6WA 3CCVA 2YLCA 4MMKA 4PFZA 3OYMA 2VXFA 1Y7XA 2LX9A 3DLLA 5EC7A 4PLLA 4KT0E 4X34A 5I2MA 4RG8A 2RI5A 3ZFJA 2RQRA 1BYMA 3RR6A 2X4JA 2DIQA 4PJOD 2FRWA 3LWHA 4XTXA 4FYWB 2KAFA 4O6JA 4ZTJA 2O4XA 5GAOp 4KGVB 5LJ5h 1YI2A 1O75A 2L89A 2BUDA 4J9DA 2FZKB 1GBRA 5DY9A 2G3RA 3NMZC 2KY9A 1WPYA 2SRCA 3H0HA 4L6V5 1IREB 2ZAEA 4DBFA 2BE7D 1UGRB 3MEAA 1YJNQ 3QIIA 1VQ8Q 3CCLT 3EH2A 2A28A 4JJDA 5KH6A 3MKDA 1IGQA 5FLXE 2O01E 3V8LA 4GLKA 2K7AA 3OY9A 3HHTB 1YCSB 2VASA 2XMFA 3ULRB 3EGUA 3FLGA 1YITQ 3EH1A 1BCMA 1FMVA 2R58A 1JB0E 1OI1A 3CCUA 2HKQB 4JRQA 1IHVA 3M9QA 4WCIA 1ZA2B 3QDRB 4AFQC 3JAME 1GFCA 4RTTA 1S72A 1K9MC 5CQXA 2JMCA 3THKA 3OYYA 4BY6B 1AZEA 3G71T 1QCFA 4QQ6A 1FX7A 2FPFA 3VS7A 2G6FX 3CCSA 4XTWA 3X25B 2PZ1A 5KYWB 3SD4A 1VQMA 1JO8A 4IIOA 2RQWA 1AHJB 1YITT 3OYKA 4QVDA 1MMDA 1C0MA 2VKNA 3VS2A 2DXTA 4ZNXA 3CCQA 1KJWA 2DVEA 2M51A 5DLQE 5KYNA 5CR2A 2EYZA 1YI2Q 4M7AB 1UGSB 2CYZB 3CCLQ 1QVFP 2O9SA 2ZZDA 2PNIA 2X3WD 2HBWA 2DPPB 2RK1A 5CKDA 1NYFA 1BIAA 2QTVA 2EQKA 4RTUA 2HQXA 2HQHA 4FT4A 2VXEA 2RO0A 1WYXA 4M78G 3QKJA 3PIOA 2E6NA 3CCJT 2M0YA 2HL3A 3H8ZA 1PSEA 4OB0B 3S3OA 4J83A 1I5OB 2MWPA 3EHQA 5FU6C 2CGHA 3M53A 1Q82C 3AT1B 4LDWA 4DA4A 5GANj 2KGTA 5GAN3 2D9TA 2QQSA 1OQKA 1V1CA 5D6XA 4KUIA 1M90R 1YIJA 3Q1JA 5GAN8 3HL8A 3L2VA 1RAIB 2QG9B 2LVMA 4FCYA 1ACMB 2LJ0A 1Q81R 4K11A 3G6EQ 3X24B 4XTUA 2EKOA 4C0GA 2FYKA 4PKCC 2OTLA 1RADB 1CKAA 1FYNA 3F70A 5GAOm 4F17A 1ZSGA 4FT2A 4HCBA 1D0XA 1UE9A 4FYVB 5CO7A 3VJPA 1TXQA 3CQTA 2E4HA 4HKEA 1J3TA 1K8AC 3JV3A 3OYHA 1IGUA 4C8QB 1FWZA 4OMNA 3CMAA 1QMCA 1GFDA 3D7SB 2X51A 2KYMA 3KUFA 4OP0A 1K9AA 3UWNA 2M0OA 2DE0X 2YT6A 5ECAA 4C0DC 1BKBA 3H0IA 4J8OA 1RL2A 3CBMA 4OMPA 2EJFA 1VQ7T 4C5EA 4WF2A 1VQ4Q 2CKKA 5DM7R 4JJBA 2JJ9A 3I56T 3GP8A 3CCUQ 2QASA 2KR3A 1NBEB 2JTFA 3HRUA 1LCKA 4C0FA 2DXBA 1GCQC 3CMEA 4F7UE 2HNIA 2Y90A 5GANg 2CUDA 2WSEE 1WJQA 4BB7A 4XQ3A 3PT9A 1Y96A 2OTLT 2CUBA 2HQEA 3GF5A 4KRTA 3PFSA 2P4RA 3A8GB 2BIVA 2LJ1A 1X2KA 4F7UA 5I22A 1BU1A 4HCCA 5KYXA 4M75F 1K9MU 1RAHB 1HYOA 2M02A 2I2LA 2DLPA 3PVLA 3CC7Q 4PFPA 4M7DA 1UG1A 1O9SA 4PLIA 4X1VA 3FJPA 5GMKi 3NGPA 2RJEA 1SG5A 4M7DF 1MV0B 4M77A 5CKHA 3QO3A 1WHHA 2XKOC 4YTLA 3HKSA 2CREA 4MZMA 5GMKj 2M16A 2D8HA 1WGSA 2RHZA 1HSQA 1VQNA 2D0QB 2DK3A 2DVJA 4PFOA 4C8QF 3CCRT 3OYJA 2VVKA 1WHKA 4O5VA 4M7AE 5GAMj 1QKWA 2D0NA 2LT4A 4J9GA 2DL7A 4EDUA 4FSSA 4E6RA 3BW1A 3CCVQ 4M77D 1QP2A 2KBTA 3CPFA 4QKUA 3ZEHA 1NYGA 1BK2A 2NUPB 3N5BB 1SHGA 1TTHB 3G4SA 4KH0B 2A36A 1U3OA 3BDLA 1WHLA 3M4GA 3WVDB 1TWBA 4II1A 1GRIA 1K73R 1QVPA 3PVQA 3RIRA 3FC3A 1SPKA 1M30A 2C06A 2OAWA 2L3QA 4RTWA 3HRTA 2A37A 3CC4Q 2ZPHB 1NEBA 1YJ9A 3CXCP 2DTOA 1G3WA 1UGPB 1GCPA 2DRMA 2EGCA 2DFUA 1OYXA 1M8MA 4GBQA 2K5FA 1M2VA 4BI8B 2DNUA 4M75C 4N0AC 4OVAA 1KQ1A 1AT1B 2AZSA 4F14A 3OA6A 3NTHA 1YIJT 1ABOA 3GOXA 1WHJA 2QDLA 1JXMA 2ENMA 4EMKB 3ASKA 4HVWA 2EJ9A 2QQBA 4Z8AA 1KQ2A 1Y07A 2LRQA 1N9RA 3M0SA 5HKCA 1SF9A 1EFNA 1VYTA 2QQ9A 3OYIA 1BCOA 1VYVA 4ELZC 1H641 2FB7A 2MWOA 1OU8A 5LJ5e 2JW4A 4FW1A 1AWXA 4BI4A 3QZ9B 2CP3A 5LJ3h 1UECA 1QVFS 5LJ3j 1PM3A 2ZCFB 4C8QC 1W4SA 2DKGA 3EG1A 2E64A 4N4GA 4JRIA 4X9DA 4M7AF 4A4FA 4A4GA 2VUBA 2LC4A 3OYLA 2RJFA 3OS5A 1I81A 2EIFA 4RTZA 1FMWA 4XTYA 2ED0A 3META 1JJ2S 1VQPQ 1K8AR 2PTKA 4BUGA 1NE8A 2YLBA 3L2RA 4JLGA 1HK9A 1WX6A 2DTHA 1TH7A 1ZLMA 2XI9A 4FIBA 2GQVA 1CSKA 2ZPFB 4LDUA 1JQQA 4GLMA 4CC7A 1OZ2A 4ESRA 3OYNA 3G4ST 2RJDA 1MMNA 5GAMg 2GFAA 8AT1B 3L2ZA 2EBPA 2ED1A 2K79A 5KCHA 3PTAA 3M0PA 4M7AD 3X20B 2V8JA 3CC7A 4J9IA 1RAAB 3JCMf 4XU3A 4DBHA 1TS9A 1JU5C 2IVWA 4F7UF 1UFFA 5FU6B 2BE9B 3HPWA 3GNFB 4ATOA 1IZ6A 3OB9A 2KNBB 5DLOA 1E6GA 3V8KA 2WSFE 4QQDA 3L1AA 4N4HA 3TSZA 5FWCA 4JZ4A 4LE9A 2VWFA 3RMQA 1VQOQ 1VQ6A 2KVQG 2C0OA 2RK2A 1U1TA 4MMLA 1VQ5T 3VKIA 5IH2A 3M58A 3QYHB 1E7OA 5KCOA 3FB9A 5GAN4 3JCMd 5GMKl 5EG2A 2CZ6B 3CCRA 4C8QA 4IURA 4WTOB 3JB9I 2GQIA 2DL8A 3EHRA 2FPDA 3VRYA 3SWNB 2LTOA 2YUQA 3PMIA 3SWNA 1ZHIA 1QVGA 1D1CA 2RD1A 2NUTA 1VQKA 3VS3A 3A5ZB 2RJCA 4JJCA 3V7CA 2KE9A 1A0NB 1X6BA 1D0ZA 4IUTA 1UB4A 3H9NA 4J6XA 3C4SA 1JEGA 5D7UA 1QVFA 2EWNA 3E9GA 3E9FA 4B6MA 2PVGB 4A4HA 3EGDA 1G5VA 3CCSQ 3EAEA 3HFOA 3CCET 5FU7C 1UJ0A 2J6KA 4EMGA 3CBOA 4BY6C 3RDVA 2AZVA 4J9CA 2A08A 3EG2A 1M90U 3U23A 2FPEA 1VQLQ 4LDYA 4Z89A 4M78C 3VS0A 5LJ5g 1AZGB 2KI7A 1M1KC 3A1PA 4J9FA 3H41A 4OF1A 2RQVA 1VQKT 1YHQT 2DETA 2A3LA 2JM8A 1SSHA 3WVEB 3FIFA 2K3XA 3VUZA 7AT1B 2Y4XA 2AIRB 3CC2Q 5IXFA 2Y4YA 1H92A 3JCMe 1RLPC 5HCKA 1Q81U 4V2SA 2HD0A 4BDZA 1JJ2A 5L23A 1PC0A 3CMET 1WHGA 2E1HA 2XD0A 3OYEA 4HA8A 2HEQA 1MMAA 1K8AU 2HCKA 1QWEA 4J6WA 1M3BA 3ME9A 4NL2A 2CP6A 1N27A 4N4IA 2JTMA 2NWMA 3QYGB 3PMTA 1NLPC 3JCMh 1K0SA 3JB9F 3VYGA 4BE1A 5LJ3e 1PCXA 4XTZA 2LJ3A 3JCMW 3P8DA 2FRYA 5IXBA 2NUTB 1G3TA 1Y0MA 2LQWA 3QWYA 1QCOA 2L0AA 2D6FA 2DL3A 3QZ5B 2DMOA 3FRNA 3BDUA 4E7IA 3CBPA 1RUWA 2F69A 1X75C 4M78A 5CKFA 3I56A 1SRLA 1KD1C 3SEMA 3H0FA 3CD6Q 2DD4A 1KD1U 3M59A 2DL4A 4RUGA 1NJIU 3V7SA 2LP5A 2MIOA 1Q7YR 3CCVT 4M78F 3I5SA 3EGXA 2VB6A 2MMPA 2HSPA 1WNLA 2JNGA 4XAXB 3M0TA 1YJWQ 1GCQA 4AT1B 4F7UB 1TUGB 1RACB 2P4TA 5J39A 1H8KA 1Q95G 3MO8A 5LJ3f 3MJXA 1Y57A 2KXDA 2L3RA 3JCMb 1WDXA 4C5IA 2RHIA 4M7DB 5LJ5j 3CEYA 4LXCA 3JCMc 1ZSZB 1M2VB 2XDDA 3CMEQ 1HXDA 4TVRA 3V7RA 2GF7A 2J6FA 4JRPA 5GJVB 5LJ3d 4BACA 2J6OA 4M4ZA 4CI0C 4PJOB 2W10A 2VC8A 2ROTA 2EJGA 3OS1A 2RQTA 1ABQA 3OSSC 3A8LB 4ZGJB 3A8OB 3CPWP 1WXBA 2GFUA 1YHQQ 3I55T 2I0NA 5GAN7 3FJ5A 1NM7A 3HFNA 5FW9A 3HRSA 1ZBXA 1VQNQ 2AKKA 1WI7A 4IUVA 3O5ZA 3ER0A 1QLYA 5LJ5d 1VQNT 2MYSA 4Z88A 3VS4A 3UATA 4LN2A 4OMFB 4IUUA 5IHKA 2RMOA 3I55Q 2QEXQ 1VQMT 3CCUT 3I56Q 1QWFA 4PJLA 3EGXB 5LJ3g 3CCST 4XU0A 5GAN5 2HMAA 3UA7A 3MHXA 2CS7A 3S3NA 4J5YA 2H8HA 4RG2A 4LDXA 3H6ZA 1AWJA 1OPLA 1M4ZA 2F2WA 1VQ9Q 5L8RE 2JMAA 4QVZA 2GBQA 2CSQA 2VGMA 2ZPEB 2P0PA 1X01A 4EPCA 2ESWA 4M77E 2QXFA 1Q81C 2OAUA 1IO6A 4ELYC 3QSUA 1YJWT 2QAZA 1X69A 1ARKA 2DL5A 2E6ZA 3JCMg 4Y92A 2JM9A 2OTJA 4NL3A 1QVGS 2DEUA 2CP0A 1K73C 1VQOT 1WQ7A 4R55A 5I2SA 2OX7A 5GMKm 2DBMA 3P8HA 5CKBA 2PUKB 4BD3A 2EQIA 2KQWA 1YJNA 1MGQA 4PJOC 2KDSA 1EX4A 2KRNA 4ANJA 3RBBB 1NZ9A 4M77F 1LNXA 2LDMA 4RMOA 1BI3A 2W0ZA 5AYFA 2O4XB 1M90C 3M54A 1PG5B 1BI2A 1RI0A 3KFVA 4MZTA 2MI6A 2XU8A 3JCMX 2EFIA 1NJIR 2XK0A 4F04B 5D6WA 1C6VX 2DX1A 2XIDA 2ZPBB 4M7AA 2FL7A 1KC8R 4RKUE 4C8QE 2NUZA 2QGGA 5GAOr 1B07A 1YN8A 4M77G 3MCAB 1N5ZA 2V26A 4JUVA 4EMKC 1G3SA 3CCQT 5J3BA 3M0QA 2F1LA 1PKSA 5KE2A 3ZBDA 4KUDK 4A63B 3NTIA 1PRLC 4C92B 5C6SA 1WHMA 2X3XD 2JOYA 1UDLA 4M75B 2AHJB 3X26B 4HVUA 1YJWA 4CC3A 3I9QA 1JJ2P 2A0FB 3EGDB 4LNPA 3G7ZA 3CC2T 2CP7A 3LH5A 1I07A 2K2VA 4HCZA 2FVUA 2R57A 1VQPA 5GANf 4E7JA 1WLPB 1YI2T 3NFCA 4R0KA 1Q86U 2X4WA 1I1JA 3OYBA 1WZOA 5HK3A 1YITA 3NPFA 3M5AA 1VQLT 2GNCA 1JXOA 3SFMA 3TSWA 4B9XA 3X28B 1BB9A 3VS5A 2LQKA 2FG0A 3I35A 1BI0A 4DBRA 1WIEA 5CQYA 2HSEB 2ZGWA 1WQWA 5A0DA 2QYZA 4ZGEB 2ABLA 2EVRA 3OMCA 3RKWA 3CCQQ 2FZCB 2E70A 2M9UA 1R0CB 3M0RA 5GJWB 1K9MR 5LL6S 3EFRA 2YUNA 4NS5A 5CAIA 3CCLA 1M1GA 2YRDA 2O2OA 2K4YA 3GNGA 2EQJA 1KC8C 1LJOA 4PJOA 2CT3A 3CC2A 2X4XA 2EPDA 4E7KA 1WXTA 2E41A 4M77C 1FMKA 3QUIA 3PE0A 4VUBA 2K5LA 3JB9J 3J7AF 1R0BG 2V8IA 3M55A 1QQJA 1YP5A 2LQ8A 2KRSA 2YRVA 2XICA 4M78B 1NEGA 2P84A 3A8HB 4Y91A 4M7AG 2QK0A 3DB3A 1W1FA 2D1XA 1VQ5Q 2QA4A
chains in the Genus database with same CATH topology
5FU6C 4EMGA 2CGHA 3CBOA 3LYIA 3M53A 3RESA 1VQ8T 4BY6C 1Q82C 5GANe 4DA4A 4LDWA 1YJNT 1G3YA 5GANj 5GAN3 1N8RC 3CD6A 4CRIA 2D9TA 4LD9K 4ME7A 5FU7B 3UT1A 1M90U 3PIPA 2QQSA 4LDYA 3FDRA 4JDSA 4M78D 3PGGA 5D6XA 4M78C 4KUIA 5LJ5g 1H3ZA 1M1KC 1YIJA 3JB9H 3L2QA 4A4KA 3Q1JA 4OF1A 3LGLA 5GAN8 3GPLA 1W2BS 3HL8A 2QQRA 1VQKT 4EMHA 3L2VA 2LVMA 3WXMB 2X35A 3M56A 2P0KA 1YHQT 1M1KU 3CC4A 2A3LA 3MP1A 3WVEB 3FIFA 2K3XA 2VV5A 3X24B 1QP3A 3CPWS 3VUZA 1K73U 5GAMd 2Y4XA 3V8JA 5IT9E 4FU6A 2Y4YA 4LD6A 4XTUA 4BI3A 4L59A 4QW2A 3SWNC 3JCMe 2EKOA 4BDYA 1Q81U 4OGCA 4C0GA 2FYKA 1OZ3A 1Y96B 2HD0A 4PKCC 3CC4T 2R5MA 3MP6A 3JB9D 2OTLA 4BDZA 1JJ2A 3M57A 3F70A 4C92F 5GAOm 2QTXA 3OYAA 4M7AC 3CMET 4FT2A 2WACA 2E1HA 4Z02A 4HCBA 2XD0A 3OSVA 2QI2A 2CZ0B 3OYEA 5CO7A 3VJPA 3CCJA 2K3YA 4C0DB 4HA8A 4XK8E 5CVIA 4ZN1A 3OS2A 1K8AU 2XG8D 3GIBA 3E1SA 1NPPA 4J6WA 5FROA 4E7LA 2E12A 3ME9A 4NL2A 3L2UA 1N27A 4N4IA 2JTMA 4HKEA 2F5TX 1N8RU 1K8AC 4PNOA 2QEXT 1VQPT 3QYGB 4DQ2A 2YHTA 3DB4A 3PMTA 2H3JA 2P0QA 3OYHA 1Y71A 2KSSA 3NTKA 3LH0A 4C8QB 1FWZA 3CMAA 3OS0A 3JCMh 3JB9F 2MF2A 3VYGA 3L42A 3CMAT 4BE1A 5LJ3e 5HK0A 2EYQA 5LJ5f 1EIFA 3KUFA 4XTZA 4OP0A 3HP9A 3P8DA 3JCMW 1YJ9T 3UWNA 2M0OA 1G3TA 4B9WA 4C0DC 1BKBA 4PJOF 2D6FA 3QZ5B 3RUXA 5GANd 4J8OA 1RL2A 3FRNA 4X9CA 3BDUA 1U1SA 2B8AA 1VIEA 3CBMA 1M8VA 1XOVA 4OB1B 3OYDA 4E7IA 2EJFA 4L5GA 3JCMP 3CBPA 3SB2A 1M5Q1 2F69A 3S3MA 1VQ7T 1X75C 2RHUA 4M78A 4C5EA 4WF2A 5CKFA 2CKKA 3R6OA 5DM7R 3I56A 4OB2B 1KD1C 3DLMA 3J80E 3I56T 5A0LA 3GP8A 1V29B 4A53A 2DD4A 3GLXA 4RCBA 3CXCA 3L2WA 3JCMV 3VUBA 1ZQ1A 1M1FA 3INZA 2HBPA 3JB9G 4Y28E 1QW1A 1VQOA 2JTFA 3HRUA 1KD1U 3VV0A 3M59A 3UDCA 4C0FA 1KQSS 1NJIU 4KULA 3VYHB 2DXBA 3V7SA 3CMEA 3JCMJ 4F7UE 2HNIA 2Y90A 3OYCA 5GANg 4QVCA 4MDXA 3CCVT 2WSEE 1DJ7B 4M78F 5IN1A 1WJQA 1VQ9A 4BB7A 3J81E 4XQ3A 5GANh 2PQWA 2MMPA 1Y96A 3PT9A 5CKEA 2VYTA 3T9NA 4M7DD 1WNLA 2JNGA 4XAXB 2EQUA 1KC8U 2OTLT 3CC7T 1Q86C 4ZTFA 4J6YA 4IUQA 2HQEA 3GF5A 3PFSA 3A8GB 3SDZA 4F7UB 3VU3C 1GXIE 1KHCA 2P4TA 2BIVA 5J39A 4A4EA 4F7UA 4JS4A 4HCCA 4M75E 2X4YA 4M75F 1R8OB 1K9MU 3MO8A 5LJ3f 2L3RA 3JCMb 2I2LA 3LGFA 2E10A 5CK9A 2CZ1B 4XU2A 4C5IA 4QQGA 3RERA 2BKDN 3C12A 1VQ9T 3URGA 4M7DA 2RHIA 2F5KA 3MEVA 3LLRA 3LX7A 4M7DB 5CCAA 1O9SA 2L8DA 5LJ5j 1Q7YU 4PLIA 3CEYA 3FJPA 4XTVA 4HT9A 3LWIA 3JCMc 5GMKi 2JZ2A 1BIBA 2RJEA 2XDDA 2VGNA 3PNWC 1FXXA 1HXDA 1I4K1 4E7HA 1PSFA 4TVRA 5HY6A 3V7RA 3AHUA 1YBYA 3O8VA 1Q7YC 2GF7A 4OGEA 4JRPA 4M7DF 3CD6T 5LJ3d 4M77A 5CKHA 4BACA 4CI0C 4PJOB 1NPRA 2RHXA 2DXCA 2DZCA 3QO3A 2DTIA 1P92A 2QA4T 2VC8A 2XKOC 1VQ4T 2ZPIB 2EJGA 3QJYA 4YTLA 3OS1A 3UPUA 3HKSA 2XDBA 4MZMA 3OSSC 5GMKj 4RCCA 2M16A 3A8LB 2LNVA 3A8OB 4ZGJB 4R56A 3G6ET 3MEWA 4C5GA 3QPHA 1WGSA 2RHZA 1JBMA 2GFUA 3KXTA 5I21A 5IAYA 3I55T 1VQNA 2D0QB 2DK3A 1I8FA 4LDVA 1YHQA 5GAOl 4C8QF 4JJNK 4PL6A 3FEOA 5GAN7 4E47A 3OYJA 3CCRT 3HFNA 2HAXA 3HRSA 2XDPA 1ZBXA 2K57A 4O5VA 5GAMj 5A2QE 2FHDA 4M7AE 1N9SA 2LT4A 4EDUA 2XHCA 1U8RA 4IUVA 3BW1A 1MHNA 1X6OA 5GAN2 3ER0A 4M77D 5LJ5d 2PVOB 2RB6A 3QXEB 1I5LA 2RI2A 1QP2A 1VQNT 3CPFA 3CPWA 4M7DG 3ZEHA 4P5NA 1VUBA 2DAQA 3N5BB 2MAMA 4N0AA 4IUUA 1UGQB 4OMFB 2RM4A 1D3BA 3CXCS 2R5AA 4BE0A 2E65A 3G4SA 1VQMT 4ZN3A 3CCUT 1D3BB 2RHYA 4FL6A 2JUFA 1KHIA 4KBMB 3TEEA 1WJRA 2JN0A 4M7DC 1YCYA 3BDLA 2DXUA 2PU9B 5LJ3g 3M4GA 2PUOB 3WVDB 3CCST 4XU0A 5GAN5 2DZ9A 2EAYA 1VQLA 2RA2A 3CCEA 4II1A 3MHXA 2CS7A 3S3NA 3JCMQ 1QVPA 4J5YA 3RIRA 4J7FA 3FC3A 4C0ZA 4HT8A 4M75A 4PJOE 4RG2A 4LDXA 2C06A 3H6ZA 4MDWA 4PJOG 2L5QA 3OQ5A 3E19A 2KMTA 2ZPGB 3G71A 3HRTA 1VQ6T 1M9SA 1M4ZA 4DOVA 3P8BB 3MEUA 3OBWA 3C95A 5L8RE 4QVZA 2ZPHB 1YJ9A 2DTOA 2GCXA 2ZPEB 1G3WA 2P0PA 1UGPB 1X01A 2RH2A 2VGMA 4GY5A 5M9OA 1OYXA 5GAOq 2QEXA 4BE2A 1KQSA 2K5FA 3BY7A 4EPCA 3TREA 3HSBA 3I55A 3OYFA 2CZ7B 4BI8B 2DO3A 4M75C 4N0AC 5GAN6 4OVAA 1KQ1A 4M77E 2WSCE 2QXFA 4M77B 1Q81C 2OAUA 4ELYC 3QSUA 1YJWT 3OA6A 4C92D 3NTHA 3C94A 1YIJT 4F7UG 3GOXA 4D6WA 3JCMg 2E6ZA 2YLCA 4EMKA 3CCVA 4MMKA 3QHSA 2OTJA 4NL3A 4EMKB 3ASKA 1QVGS 2EJ9A 2QQBA 3OYMA 1K73C 1KQ2A 1Y07A 2VXFA 2LRQA 3TCJA 1VQOT 1WQ7A 1Y7XA 2LX9A 3KBGA 1N9RA 4R55A 3DLLA 5HKCA 3S6WA 2QQ9A 1BI1A 4PLLA 5I2SA 5GMKm 4KT0E 4X34A 3P8HA 5CKBA 2PUKB 5I2MA 3OYIA 4RG8A 2RI5A 3ZFJA 4BD3A 1VQ8A 1BYMA 2KQWA 4ELZC 1YJNA 1H641 2X4JA 2DIQA 4PJOD 1MGQA 2FB7A 2MWOA 5GAMf 5LJ5e 2KDSA 4PJOC 1XTDA 1NZ9A 1XNIA 4M77F 5D6YA 3LWHA 4BI4A 4XTXA 1LNXA 2LDMA 4RMOA 3QZ9B 1BI3A 5LJ3h 5C0MA 5AYFA 2O4XB 1QVFS 5LJ3j 2ZCFB 1M90C 3M54A 4C8QC 2KAFA 1W4SA 2DKGA 1BI2A 2E64A 4M78E 2O4XA 4N4GA 4O6JA 5GAOp 4JRIA 3MP8A 4ZTJA 5LJ5h 1RI0A 1YI2A 1O75A 5GMKe 2L89A 2KK4A 2JVVA 2BUDA 4X9DA 4M7AF 4A4FA 4MZTA 5DY9A 4A4GA 3M4YA 2VUBA 2G3RA 2XU8A 2KY9A 2MI6A 2LC4A 2M1HA 1WPYA 2RJFA 2EFIA 1I81A 3OS5A 3JCMX 3OYLA 2EIFA 4L6V5 1IREB 3OYGA 3G6EA 2XK0A 4JLIA 4XTYA 2IG0A 1UGRB 5D6WA 4J7IA 3MEAA 3META 1LOJA 3QIIA 2XIDA 2ZPBB 2EQMA 1JJ2S 3CCLT 2FL7A 4M7AA 3OW2A 4RKUE 4BUGA 5FRMA 4C8QE 5KH6A 1NE8A 2YLBA 3L2RA 5GAOr 4JLGA 3BFMA 4M77G 5FLXE 2O01E 3V8LA 4GLKA 3MCAB 4JUVA 4EMKC 1HK9A 3OY9A 1G3SA 3CCQT 5J3BA 3HHTB 2DTHA 2NLUA 3ZBDA 5KE2A 1TH7A 2XI9A 4FIBA 3TU4K 4KUDK 3NTIA 3FLGA 3CCMA 4C92B 5C6SA 2GQVA 2R58A 2JOYA 2ZPFB 1VIFA 4DOWA 4C92A 1B34A 1JRIA 2A7YA 1W2BA 4LDUA 4C92C 1VQ5A 4M75B 3DKMA 1OZ2A 1JB0E 1OI1A 2AHJB 3X26B 3OYNA 3CCUA 1YJWA 3G4ST 2RJDA 2V8KA 5GAMg 4JRQA 4M75G 2GFAA 5GMKh 3M9QA 3G7ZA 3QDRB 2LCLA 1NJIC 3L2ZA 3JAME 3CC2T 2DJZA 4C92G 1S72A 3EFSA 5KCHA 3PTAA 2LCCA 4MZPA 1K9MC 4M7AD 3X20B 2V8JA 2K2VA 4HCZA 2DIGA 3CC7A 2FVUA 2R57A 1VQPA 5GANf 4A54A 5CQXA 3JCMf 4XU3A 3QG1A 3QJ6A 4E7JA 2DEQA 1YI2T 5FRNA 3OYYA 3NFCA 4BY6B 1Q86U 2IVWA 4XU1A 2X4WA 4F7UF 4ZGDB 5FU6B 2QDYB 4V2SA 3HPWA 3LW5E 5HK3A 3GNFB 3OYBA 3G71T 1IZ6A 3JRZA 4QQ6A 3JSCA 4C5HA 3OB9A 5GAOn 1YITA 4ATOA 1FX7A 5DLOA 3OBYA 3V8KA 1SSFA 3RKXA 3CCSA 3M5AA 4IUPA 4XTWA 3X25B 4C8QD 1VQLT 4IKFA 1VQ4A 4B9XA 3SFMA 2WSFE 4Q5WA 4QQDA 1XQHA 3X28B 1N6AA 2LQKA 3SD4A 3L1AA 4N4HA 3OMGA 1VQMA 1BI0A 1AHJB 4NOYA 3RMQA 1VQ6A 1YITT 3OYKA 2KVQG 5CQYA 4QVDA 2RK2A 2ZGWA 4C8QG 1U1TA 4MMLA 1VQ5T 1Q82U 1VQ7A 2DXTA 1WQWA 3VKIA 5A0DA 3M58A 3QYHB 4ZGEB 3CCQA 3OMCA 5GAMe 3RKWA 2DVEA 2E70A 3FB9A 5KCOA 2M9UA 5GAN4 3QBYA 3JCMd 4FSXA 5GMKl 5LL6S 5DLQE 3EFRA 2DD5A 4NS5A 5EG2A 5CAIA 5CR2A 3CCLA 2CZ6B 4M7AB 1M1GA 1UEBA 1UGSB 2CYZB 4C8QA 3CCRA 3OW2S 4IURA 3JB9I 5KE3A 3A8MB 4M7DE 5J26A 1WJSA 2ZZDA 2K4YA 3SWNB 3GNGA 2EQJA 2LTOA 1KC8C 5CIUA 3PMIA 1ZHIA 3SWNA 1LJOA 4JRKA 4OB3B 4UC4A 1QVGA 3CC2A 2RD1A 2X4XA 4PJOA 2DPPB 4M75D 2RI3A 5A0GA 4E7KA 3A5ZB 2E41A 2RK1A 1S72T 1VQKA 4M77C 2RJCA 5CKDA 3QUIA 3V7CA 3CCMT 1BIAA 2E5QA 2K5LA 4VUBA 4C92E 4IUTA 1B34B 4FM4B 4JS5A 3JB9J 2EQKA 1UB4A 3J7AF 2V8IA 3M55A 4J6XA 2HQXA 3RMSA 4FT4A 3C4SA 2LQ8A 2VXEA 1QVFA 2EWNA 2PVDB 2RO0A 2YRVA 3E9GA 4M78G 2XICA 3E9FA 2PVGB 4M78B 3QKJA 4A4HA 3PIOA 1G5VA 2E6NA 3A8HB 3CCJT 2OTJT 3RKYA 4Y91A 4M7AG 2QQAA 3EAEA 1KG1A 2K5IA 3H8ZA 3DB3A 3HFOA 1PSEA 3CCET 5FU7C 4OB0B 3S3OA 4J83A 2QA4A 2LT1A 5GAMh 2MWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC A;  2JOY A;  4RG2 A;  1VQ8 T;  1VQO A;  1W2B A;  1Q82 C;  1KD1 U;  1YJN T;  1VQ5 A;  1KQS S;  1NJI U;  1N8R C;  3CME A;  4CRI A;  3CD6 A;  3G71 A;  3CCU A;  1VQ6 T;  1M90 U;  1YJW A;  3G4S T;  3P8B B;  3PIP A;  3CCV T;  1YJ9 A;  1NJI C;  2LCL A;  3J81 E;  1VQ9 A;  3JAM E;  3CC2 T;  3CC4 A;  2QEX A;  1S72 A;  1YIJ A;  2JNG A;  1KC8 U;  1M1K C;  1KQS A;  2OTL T;  3CC7 T;  1Q86 C;  1K9M C;  3LGL A;  1W2B S;  3TRE A;  3CC7 A;  1VQK T;  3I55 A;  1VQP A;  2LVM A;  2DO3 A;  1YHQ T;  1M1K U;  1YI2 T;  3OYY A;  1Q86 U;  1K9M U;  2L3R A;  1Q81 C;  3LGF A;  1YJW T;  3G71 T;  3CPW S;  1IZ6 A;  1YIT A;  1K73 U;  1YIJ T;  5IT9 E;  3CCV A;  2E6Z A;  1SSF A;  3CCS A;  1Q81 U;  1VQL T;  3CC4 T;  1VQ9 T;  2OTJ A;  1VQ4 A;  2OTL A;  1QVG S;  4QQD A;  1K73 C;  1Q7Y U;  1VQO T;  1JJ2 A;  3KBG A;  3DLL A;  1VQM A;  3CME T;  4TVR A;  4X34 A;  5HY6 A;  1YBY A;  1Q7Y C;  1VQ6 A;  1YIT T;  1VQ8 A;  3CD6 T;  2KVQ G;  1YJN A;  1VQ5 T;  3CCJ A;  1NPR A;  1Q82 U;  1VQ7 A;  4ZN1 A;  2QA4 T;  2MWO A;  1K8A U;  3CCQ A;  1VQ4 T;  2KDS A;  1XTD A;  1NZ9 A;  4YTL A;  1XNI A;  3HKS A;  2E70 A;  1NPP A;  3G6E T;  5LL6 S;  5DLQ E;  1N8R U;  1QVF S;  1K8A C;  3CCL A;  2QEX T;  5IAY A;  3I55 T;  1VQP T;  1M90 C;  1M1G A;  1UEB A;  3DB4 A;  3CCR A;  3OW2 S;  1YHQ A;  1VQN A;  3CCR T;  3LH0 A;  1YI2 A;  5J26 A;  2JVV A;  3CMA A;  5A2Q E;  3CMA T;  2MI6 A;  2G3R A;  1KC8 C;  2XHC A;  1EIF A;  1QVG A;  3CC2 A;  1X6O A;  2EIF A;  1YJ9 T;  1VQK A;  1S72 T;  3ER0 A;  3A5Z B;  3G6E A;  1BKB A;  2IG0 A;  1VQN T;  3CCM T;  3CPF A;  3CPW A;  1RL2 A;  3J7A F;  1JJ2 S;  3CCL T;  3OW2 A;  3CXC S;  2LQ8 A;  3G4S A;  1VQM T;  4ZN3 A;  1QVF A;  3CCU T;  2JUF A;  1KHI A;  5FLX E;  3PIO A;  2OTJ T;  3CCJ T;  1VQ7 T;  3CCQ T;  5J3B A;  3CCS T;  3I56 A;  2CKK A;  5DM7 R;  3DB3 A;  3CCE T;  1KD1 C;  3J80 E;  3I56 T;  1VQL A;  3CCE A;  2QA4 A;  3CCM A;  2MWP A; 
#chains in the Genus database with same CATH topology
 1M3A A;  4RTY A;  1VQ8 T;  1M3C A;  1YJN T;  1G3Y A;  1ZA1 B;  1N8R C;  3CD6 A;  4LD9 K;  4ME7 A;  5FU7 B;  3UT1 A;  4OML A;  3PIP A;  3OW2 P;  2YWW A;  3FDR A;  4JDS A;  2C0I A;  3MPU B;  3L2Q A;  2LMJ A;  4A4K A;  2QQR A;  3CCR Q;  4EMH A;  4HCK A;  4OMM A;  2H3E B;  3EFO B;  2X35 A;  5IHI A;  2P0K A;  2F2X A;  4DEY A;  1F1B B;  1D09 B;  1T3S A;  2VV5 A;  1N8R R;  1K73 U;  1UUE A;  5GAM d;  3V8J A;  4KGZ B;  4BI3 A;  1RLQ C;  3SWN C;  4BDY A;  4OGC A;  1VQ9 T;  1YNZ A;  2R5M A;  3G4S Q;  3M57 A;  1D0Y A;  5KYW A;  3OYA A;  2LX7 A;  4AFU C;  3REB B;  4Z02 A;  2WAC A;  1OV3 A;  4AG2 C;  3EG0 A;  3OSV A;  2CZ0 B;  1TU0 B;  1U5S A;  4E7S A;  4C0D B;  4AMC A;  4XK8 E;  5CVI A;  4ZN1 A;  2XG8 D;  1KIK A;  2NYS A;  1MND A;  1NPP A;  4J9H A;  5FRO A;  2CDT A;  1V76 A;  1N8R U;  2F5T X;  1VQM Q;  4PNO A;  4E7Z A;  2QEX T;  1VQP T;  1Y71 A;  1RAB B;  2OTL Q;  2MF2 A;  3L42 A;  2EYQ A;  2FEI A;  1NLO C;  2C0T A;  1M1K R;  1BBZ A;  3RUX A;  5GAN d;  3R6N A;  4X9C A;  2B8A A;  1VIE A;  3UA6 A;  9ATC B;  1M8V A;  4OB1 B;  3OYD A;  3JCM P;  3SB2 A;  3S3M A;  2RHU A;  1WFW A;  2O31 A;  4IIM A;  4OB2 B;  2RNA A;  1V29 B;  3CXC A;  4PK4 A;  5KYU A;  3JCM V;  3VUB A;  1M2O A;  4RTX A;  1VQO A;  1OX9 A;  3VYH B;  2YXY A;  5KYY A;  1K76 A;  3OYC A;  4MDX A;  4F16 A;  3CC4 A;  1YIJ Q;  5GAN h;  3T9N A;  1W2B P;  2VYT A;  1PNJ A;  1D1A A;  2EQU A;  1Q86 C;  4ZTF A;  2O9V A;  3SDZ A;  2MPX C;  1YFN A;  3QWX X;  2X4Y A;  2BTT A;  1C1A A;  3LGF A;  5IHN A;  1UJY A;  2E10 A;  5CK9 A;  2ATC B;  3URG A;  2F5K A;  1ZUK A;  3MEV A;  3LLR A;  2GTO A;  4XTV A;  2JZ2 A;  1BIB A;  1ZUY A;  1FXX A;  4E7H A;  1PSF A;  4E2F B;  5HY6 A;  3AHU A;  1Q7Y C;  4LUE A;  4JZ3 A;  3CD6 T;  1T3L A;  1NPR A;  1WA7 A;  3G6E T;  2CT4 A;  2LNV A;  3MEW A;  4C5G A;  3QPH A;  1KD1 R;  1JBM A;  3VS6 A;  5I21 A;  4KH1 B;  1I8F A;  1R77 A;  5GAO l;  2L3P A;  2YSQ A;  2EGA A;  2ECZ A;  2HAX A;  5A2Q E;  2FHD A;  1N9S A;  6AT1 B;  1MHN A;  1X6O A;  2EW3 A;  5GAN 2;  2RF0 A;  2PVO B;  1KQS P;  3CPW A;  4P5N A;  1U06 A;  1Q82 R;  2MAM A;  1UGQ B;  2GGR A;  2RM4 A;  2R5A A;  2AT1 B;  4FL6 A;  2JUF A;  3E2U A;  1KHI A;  2J05 A;  1AD5 A;  3G1J A;  1K4U S;  4KBM B;  1WJR A;  2JN0 A;  2AK5 A;  1YCY A;  2DXU A;  2IPO B;  2PU9 B;  1AWW A;  2PUO B;  2DZ9 A;  1VQL A;  2EYW A;  3CCE A;  3JCM Q;  1PHT A;  3EFO A;  4C0Z A;  4M75 A;  4PJO E;  2KRO A;  2KXC A;  2QGF B;  4MDW A;  4PJO G;  1K0X A;  4DBQ A;  2KEA A;  2F2V A;  1QCN A;  4DOV A;  3P8B B;  3C95 A;  1YJ9 Q;  3ZL7 C;  2YUO A;  4GY5 A;  1YWP A;  2RH2 A;  3CMA Q;  1T0J A;  4BE2 A;  5GAO q;  1KQS A;  2K6D A;  3BY7 A;  2RQU A;  2DER A;  3TRE A;  3I55 A;  3OYF A;  1IB8 A;  2DO3 A;  3TQ7 P;  2WSC E;  1VQK Q;  4M77 B;  4AFS C;  8ATC B;  1SKU B;  4C92 D;  2YRC A;  4F7U G;  4EMK A;  3QHS A;  3TCJ A;  2YUP A;  3KBG A;  1RI9 A;  3S6W A;  1BI1 A;  1D1B A;  1X27 A;  1VQ8 A;  2E3I A;  2BZY A;  3CCE Q;  5GAM f;  1XTD A;  1TSF A;  1XNI A;  2B86 A;  1VQ7 Q;  5D6Y A;  1UGV A;  4LUD A;  5C0M A;  2K9G A;  1AWO A;  4M78 E;  2DYI A;  3MP8 A;  5GMK e;  2KK4 A;  2JVV A;  1IXD A;  2HL5 C;  3M4Y A;  2M1H A;  1PD1 A;  1ZX6 A;  2DF6 A;  2O88 A;  3OYG A;  3G6E A;  4JLI A;  2IG0 A;  4J7I A;  2L3S A;  1LOJ A;  4EIK A;  2EQM A;  1OOT A;  3OW2 A;  1M27 C;  5FRM A;  3EG9 B;  1E6H A;  1X43 A;  1H3H A;  3EG9 A;  3BFM A;  1T0H A;  2NLU A;  1K1Z A;  2OTJ Q;  3TU4 K;  1G83 A;  1PD0 A;  3CCM A;  1GL5 A;  4DOW A;  1VIF A;  4C92 A;  1B34 A;  1JRI A;  2A7Y A;  1W2B A;  4C92 C;  1VQ5 A;  5I11 A;  2KT8 A;  3DKM A;  1OEB A;  4PJM A;  2V8K A;  1IRX A;  1S72 Q;  4M75 G;  5GMK h;  1B3Q A;  2CP5 A;  1NJI C;  2LCL A;  4J9E A;  4CC4 B;  2DJZ A;  4C92 G;  3EFS A;  2LCC A;  4MZP A;  2HDA A;  2DIG A;  2IIM A;  4A54 A;  3QG1 A;  3QJ6 A;  1OX8 A;  2DEQ A;  5FRN A;  4FYY B;  1HD3 A;  4XU1 A;  4ZGD B;  2QDY B;  3LW5 E;  3JRZ A;  4C5H A;  3JSC A;  5GAO n;  3OBY A;  1VOM A;  2JTE A;  1B7T A;  1SSF A;  2COW A;  3RKX A;  4IUP A;  4C8Q D;  3REA B;  4IKF A;  1VQ4 A;  4Q5W A;  2KYB A;  1XQH A;  1N6A A;  2BZX A;  3OMG A;  1GBQ A;  2DIL A;  2JS0 A;  4NOY A;  3UF4 A;  1W6X A;  4C8Q G;  1Q82 U;  1VQ7 A;  2YDL A;  2V1R A;  5GAM e;  3CCJ Q;  2DYB A;  3QBY A;  4FSX A;  2Z0W A;  1SEM A;  2DD5 A;  1QKX A;  1UEB A;  3OW2 S;  5FWB A;  2JS2 A;  5KE3 A;  3A8M B;  2X9H A;  4M7D E;  5J26 A;  2HZY A;  1WJS A;  4RTV A;  5CIU A;  1TUC A;  4JRK A;  5AT1 B;  4OB3 B;  4UC4 A;  1OPK A;  4M75 D;  2RI3 A;  1XJW B;  5A0G A;  1S72 T;  1VQ6 Q;  3CCM T;  2E5Q A;  4C92 E;  2MK5 A;  1LVK A;  1B34 B;  4FM4 B;  4JS5 A;  1SRM A;  2E5K A;  3RMS A;  4ORZ A;  2PVD B;  2OTJ T;  3RKY A;  2QQA A;  1KG1 A;  2K5I A;  4AFZ C;  2LT1 A;  5GAM h;  3LYI A;  3RES A;  2V1Q A;  5GAN e;  1VA7 A;  4CRI A;  1QVG P;  2EYY A;  4M78 D;  3PGG A;  3EG3 A;  2JXB A;  1H3Z A;  1AOJ A;  3G71 Q;  3JB9 H;  1HJD A;  1MMG A;  1MUZ A;  3GPL A;  3LGL A;  1W2B S;  1TUD A;  3WXM B;  3M56 A;  3QDF A;  1M1K U;  3MP1 A;  3M0U A;  1QP3 A;  3CPW S;  2DJQ A;  1X2Q A;  2QA4 Q;  4FU6 A;  4LD6 A;  5IT9 E;  4L59 A;  4QW2 A;  3CC4 T;  1SHF A;  1OZ3 A;  1Y96 B;  4FYX B;  2FZG B;  4QT7 A;  3MP6 A;  3JB9 D;  1ZSZ A;  1PRM C;  4C92 F;  2QTX A;  4M7A C;  2RN8 A;  2DM1 A;  2CSI A;  4OMO A;  2QI2 A;  2K3B A;  1AVZ C;  3CCJ A;  2K3Y A;  2J06 A;  3OS2 A;  3GIB A;  3E1S A;  4E7L A;  2E12 A;  1RAE B;  3L2U A;  3NHN A;  3BE3 A;  2J7I A;  4DQ2 A;  2YHT A;  3DB4 A;  2H3J A;  2P0Q A;  4AG1 C;  2KSS A;  4PJN A;  3NTK A;  3LH0 A;  2D8J A;  3OS0 A;  4D8K A;  3CMA T;  5HK0 A;  5LJ5 f;  1EIF A;  2RPN A;  3A98 A;  1YJ9 T;  3HP9 A;  1UTI A;  1EZZ B;  2LZ6 B;  4B9W A;  2DA9 A;  4PJO F;  1S1N A;  4HXJ A;  1U1S A;  1G2B A;  1XOV A;  4J9B A;  1MNE A;  1OUL A;  4L5G A;  1Z9Z A;  1M5Q 1;  4CC2 A;  2ROL A;  1TOV A;  2SEM A;  2CH4 A;  3R6O A;  1IHW A;  3DLM A;  3J80 E;  5A0L A;  5KYU B;  2COY A;  4A53 A;  3GLX A;  4RCB A;  2E3H A;  3L2W A;  2FO0 A;  1ZQ1 A;  1M1F A;  3INZ A;  2HBP A;  3JB9 G;  4Y28 E;  1QW1 A;  2CP2 A;  3VV0 A;  2NUP A;  3UDC A;  5KYY B;  1KQS S;  4KUL A;  2MOX A;  1MV3 A;  3HTR A;  3JCM J;  2OI3 A;  1KSW A;  4QVC A;  1KK7 A;  4FW2 A;  1DJ7 B;  5IN1 A;  4OMQ A;  1VQ9 A;  3J81 E;  2PQW A;  5CKE A;  4M7D D;  1PWT A;  1KC8 U;  3CC7 T;  2EKH A;  3TVT A;  4J6Y A;  4IUQ A;  1GXI E;  3VU3 C;  5KYX B;  1KHC A;  1RAF B;  4DEX A;  3VS1 A;  2LCS A;  1W70 A;  4A4E A;  4JS4 A;  4M75 E;  2KRM A;  1R8O B;  2LNH B;  1CKB A;  2CZ1 B;  4XU2 A;  4QQG A;  3RER A;  2BKD N;  3C12 A;  2HKN A;  1RAG B;  3LX7 A;  2EGE A;  5CCA A;  2L8D A;  1Q7Y U;  1ZBJ A;  4HT9 A;  3LWI A;  2VGN A;  3PNW C;  1I4K 1;  1YBY A;  1Z9Q A;  3O8V A;  4OGE A;  1ZUU A;  1TG0 A;  2RHX A;  2DXC A;  2DZC A;  2DTI A;  1P92 A;  2QA4 T;  1VQ4 T;  2ZPI B;  3QJY A;  3UPU A;  2XDB A;  1VYU A;  4RCC A;  4JPB W;  4R56 A;  1Q86 R;  3KXT A;  5IAY A;  4LDV A;  1YHQ A;  1AEY A;  4JJN K;  4PL6 A;  2COZ A;  2KT1 A;  3FEO A;  4E47 A;  2LQN A;  1KFZ A;  2XDP A;  2K57 A;  3I5R A;  2K2M A;  2CH4 W;  1PKT A;  2DBK A;  2XHC A;  1U8R A;  2RB6 A;  3QXE B;  3GBQ A;  2RI2 A;  1I5L A;  4HVV A;  4M7D G;  1UHF A;  1VUB A;  2DAQ A;  4N0A A;  1YWO A;  1D3B A;  3CXC S;  4BE0 A;  2E65 A;  4ZN3 A;  1ZSZ C;  1D3B B;  2RHY A;  3TEE A;  3RNJ A;  4M7D C;  1X6G A;  2L2P A;  2EAY A;  2DRK A;  2RA2 A;  2MCN A;  1LPL A;  3SHW A;  4J7F A;  4HT8 A;  2GTJ A;  2L5Q A;  3E19 A;  3C0C A;  3OQ5 A;  3CCM Q;  2KMT A;  2ZPG B;  1G8X A;  3G71 A;  1VQ6 T;  1M9S A;  3VRZ A;  4KGX B;  3MEU A;  3OBW A;  4PJJ A;  2GCX A;  5M9O A;  2QEX A;  1NG2 A;  3HSB A;  2CZ7 B;  2JT4 A;  2BZ8 A;  3IQL A;  2EYX A;  5GAN 6;  1I0C A;  1OU9 A;  2AKL A;  2OJ2 A;  4D8D A;  3C94 A;  1UHC A;  1WXU A;  4D6W A;  3CCV A;  2YLC A;  4MMK A;  4PFZ A;  3OYM A;  2VXF A;  1Y7X A;  2LX9 A;  3DLL A;  5EC7 A;  4PLL A;  4KT0 E;  4X34 A;  5I2M A;  4RG8 A;  2RI5 A;  3ZFJ A;  2RQR A;  1BYM A;  3RR6 A;  2X4J A;  2DIQ A;  4PJO D;  2FRW A;  3LWH A;  4XTX A;  4FYW B;  2KAF A;  4O6J A;  4ZTJ A;  2O4X A;  5GAO p;  4KGV B;  5LJ5 h;  1YI2 A;  1O75 A;  2L89 A;  2BUD A;  4J9D A;  2FZK B;  1GBR A;  5DY9 A;  2G3R A;  3NMZ C;  2KY9 A;  1WPY A;  2SRC A;  3H0H A;  4L6V 5;  1IRE B;  2ZAE A;  4DBF A;  2BE7 D;  1UGR B;  3MEA A;  1YJN Q;  3QII A;  1VQ8 Q;  3CCL T;  3EH2 A;  2A28 A;  4JJD A;  5KH6 A;  3MKD A;  1IGQ A;  5FLX E;  2O01 E;  3V8L A;  4GLK A;  2K7A A;  3OY9 A;  3HHT B;  1YCS B;  2VAS A;  2XMF A;  3ULR B;  3EGU A;  3FLG A;  1YIT Q;  3EH1 A;  1BCM A;  1FMV A;  2R58 A;  1JB0 E;  1OI1 A;  3CCU A;  2HKQ B;  4JRQ A;  1IHV A;  3M9Q A;  4WCI A;  1ZA2 B;  3QDR B;  4AFQ C;  3JAM E;  1GFC A;  4RTT A;  1S72 A;  1K9M C;  5CQX A;  2JMC A;  3THK A;  3OYY A;  4BY6 B;  1AZE A;  3G71 T;  1QCF A;  4QQ6 A;  1FX7 A;  2FPF A;  3VS7 A;  2G6F X;  3CCS A;  4XTW A;  3X25 B;  2PZ1 A;  5KYW B;  3SD4 A;  1VQM A;  1JO8 A;  4IIO A;  2RQW A;  1AHJ B;  1YIT T;  3OYK A;  4QVD A;  1MMD A;  1C0M A;  2VKN A;  3VS2 A;  2DXT A;  4ZNX A;  3CCQ A;  1KJW A;  2DVE A;  2M51 A;  5DLQ E;  5KYN A;  5CR2 A;  2EYZ A;  1YI2 Q;  4M7A B;  1UGS B;  2CYZ B;  3CCL Q;  1QVF P;  2O9S A;  2ZZD A;  2PNI A;  2X3W D;  2HBW A;  2DPP B;  2RK1 A;  5CKD A;  1NYF A;  1BIA A;  2QTV A;  2EQK A;  4RTU A;  2HQX A;  2HQH A;  4FT4 A;  2VXE A;  2RO0 A;  1WYX A;  4M78 G;  3QKJ A;  3PIO A;  2E6N A;  3CCJ T;  2M0Y A;  2HL3 A;  3H8Z A;  1PSE A;  4OB0 B;  3S3O A;  4J83 A;  1I5O B;  2MWP A;  3EHQ A;  5FU6 C;  2CGH A;  3M53 A;  1Q82 C;  3AT1 B;  4LDW A;  4DA4 A;  5GAN j;  2KGT A;  5GAN 3;  2D9T A;  2QQS A;  1OQK A;  1V1C A;  5D6X A;  4KUI A;  1M90 R;  1YIJ A;  3Q1J A;  5GAN 8;  3HL8 A;  3L2V A;  1RAI B;  2QG9 B;  2LVM A;  4FCY A;  1ACM B;  2LJ0 A;  1Q81 R;  4K11 A;  3G6E Q;  3X24 B;  4XTU A;  2EKO A;  4C0G A;  2FYK A;  4PKC C;  2OTL A;  1RAD B;  1CKA A;  1FYN A;  3F70 A;  5GAO m;  4F17 A;  1ZSG A;  4FT2 A;  4HCB A;  1D0X A;  1UE9 A;  4FYV B;  5CO7 A;  3VJP A;  1TXQ A;  3CQT A;  2E4H A;  4HKE A;  1J3T A;  1K8A C;  3JV3 A;  3OYH A;  1IGU A;  4C8Q B;  1FWZ A;  4OMN A;  3CMA A;  1QMC A;  1GFD A;  3D7S B;  2X51 A;  2KYM A;  3KUF A;  4OP0 A;  1K9A A;  3UWN A;  2M0O A;  2DE0 X;  2YT6 A;  5ECA A;  4C0D C;  1BKB A;  3H0I A;  4J8O A;  1RL2 A;  3CBM A;  4OMP A;  2EJF A;  1VQ7 T;  4C5E A;  4WF2 A;  1VQ4 Q;  2CKK A;  5DM7 R;  4JJB A;  2JJ9 A;  3I56 T;  3GP8 A;  3CCU Q;  2QAS A;  2KR3 A;  1NBE B;  2JTF A;  3HRU A;  1LCK A;  4C0F A;  2DXB A;  1GCQ C;  3CME A;  4F7U E;  2HNI A;  2Y90 A;  5GAN g;  2CUD A;  2WSE E;  1WJQ A;  4BB7 A;  4XQ3 A;  3PT9 A;  1Y96 A;  2OTL T;  2CUB A;  2HQE A;  3GF5 A;  4KRT A;  3PFS A;  2P4R A;  3A8G B;  2BIV A;  2LJ1 A;  1X2K A;  4F7U A;  5I22 A;  1BU1 A;  4HCC A;  5KYX A;  4M75 F;  1K9M U;  1RAH B;  1HYO A;  2M02 A;  2I2L A;  2DLP A;  3PVL A;  3CC7 Q;  4PFP A;  4M7D A;  1UG1 A;  1O9S A;  4PLI A;  4X1V A;  3FJP A;  5GMK i;  3NGP A;  2RJE A;  1SG5 A;  4M7D F;  1MV0 B;  4M77 A;  5CKH A;  3QO3 A;  1WHH A;  2XKO C;  4YTL A;  3HKS A;  2CRE A;  4MZM A;  5GMK j;  2M16 A;  2D8H A;  1WGS A;  2RHZ A;  1HSQ A;  1VQN A;  2D0Q B;  2DK3 A;  2DVJ A;  4PFO A;  4C8Q F;  3CCR T;  3OYJ A;  2VVK A;  1WHK A;  4O5V A;  4M7A E;  5GAM j;  1QKW A;  2D0N A;  2LT4 A;  4J9G A;  2DL7 A;  4EDU A;  4FSS A;  4E6R A;  3BW1 A;  3CCV Q;  4M77 D;  1QP2 A;  2KBT A;  3CPF A;  4QKU A;  3ZEH A;  1NYG A;  1BK2 A;  2NUP B;  3N5B B;  1SHG A;  1TTH B;  3G4S A;  4KH0 B;  2A36 A;  1U3O A;  3BDL A;  1WHL A;  3M4G A;  3WVD B;  1TWB A;  4II1 A;  1GRI A;  1K73 R;  1QVP A;  3PVQ A;  3RIR A;  3FC3 A;  1SPK A;  1M30 A;  2C06 A;  2OAW A;  2L3Q A;  4RTW A;  3HRT A;  2A37 A;  3CC4 Q;  2ZPH B;  1NEB A;  1YJ9 A;  3CXC P;  2DTO A;  1G3W A;  1UGP B;  1GCP A;  2DRM A;  2EGC A;  2DFU A;  1OYX A;  1M8M A;  4GBQ A;  2K5F A;  1M2V A;  4BI8 B;  2DNU A;  4M75 C;  4N0A C;  4OVA A;  1KQ1 A;  1AT1 B;  2AZS A;  4F14 A;  3OA6 A;  3NTH A;  1YIJ T;  1ABO A;  3GOX A;  1WHJ A;  2QDL A;  1JXM A;  2ENM A;  4EMK B;  3ASK A;  4HVW A;  2EJ9 A;  2QQB A;  4Z8A A;  1KQ2 A;  1Y07 A;  2LRQ A;  1N9R A;  3M0S A;  5HKC A;  1SF9 A;  1EFN A;  1VYT A;  2QQ9 A;  3OYI A;  1BCO A;  1VYV A;  4ELZ C;  1H64 1;  2FB7 A;  2MWO A;  1OU8 A;  5LJ5 e;  2JW4 A;  4FW1 A;  1AWX A;  4BI4 A;  3QZ9 B;  2CP3 A;  5LJ3 h;  1UEC A;  1QVF S;  5LJ3 j;  1PM3 A;  2ZCF B;  4C8Q C;  1W4S A;  2DKG A;  3EG1 A;  2E64 A;  4N4G A;  4JRI A;  4X9D A;  4M7A F;  4A4F A;  4A4G A;  2VUB A;  2LC4 A;  3OYL A;  2RJF A;  3OS5 A;  1I81 A;  2EIF A;  4RTZ A;  1FMW A;  4XTY A;  2ED0 A;  3MET A;  1JJ2 S;  1VQP Q;  1K8A R;  2PTK A;  4BUG A;  1NE8 A;  2YLB A;  3L2R A;  4JLG A;  1HK9 A;  1WX6 A;  2DTH A;  1TH7 A;  1ZLM A;  2XI9 A;  4FIB A;  2GQV A;  1CSK A;  2ZPF B;  4LDU A;  1JQQ A;  4GLM A;  4CC7 A;  1OZ2 A;  4ESR A;  3OYN A;  3G4S T;  2RJD A;  1MMN A;  5GAM g;  2GFA A;  8AT1 B;  3L2Z A;  2EBP A;  2ED1 A;  2K79 A;  5KCH A;  3PTA A;  3M0P A;  4M7A D;  3X20 B;  2V8J A;  3CC7 A;  4J9I A;  1RAA B;  3JCM f;  4XU3 A;  4DBH A;  1TS9 A;  1JU5 C;  2IVW A;  4F7U F;  1UFF A;  5FU6 B;  2BE9 B;  3HPW A;  3GNF B;  4ATO A;  1IZ6 A;  3OB9 A;  2KNB B;  5DLO A;  1E6G A;  3V8K A;  2WSF E;  4QQD A;  3L1A A;  4N4H A;  3TSZ A;  5FWC A;  4JZ4 A;  4LE9 A;  2VWF A;  3RMQ A;  1VQO Q;  1VQ6 A;  2KVQ G;  2C0O A;  2RK2 A;  1U1T A;  4MML A;  1VQ5 T;  3VKI A;  5IH2 A;  3M58 A;  3QYH B;  1E7O A;  5KCO A;  3FB9 A;  5GAN 4;  3JCM d;  5GMK l;  5EG2 A;  2CZ6 B;  3CCR A;  4C8Q A;  4IUR A;  4WTO B;  3JB9 I;  2GQI A;  2DL8 A;  3EHR A;  2FPD A;  3VRY A;  3SWN B;  2LTO A;  2YUQ A;  3PMI A;  3SWN A;  1ZHI A;  1QVG A;  1D1C A;  2RD1 A;  2NUT A;  1VQK A;  3VS3 A;  3A5Z B;  2RJC A;  4JJC A;  3V7C A;  2KE9 A;  1A0N B;  1X6B A;  1D0Z A;  4IUT A;  1UB4 A;  3H9N A;  4J6X A;  3C4S A;  1JEG A;  5D7U A;  1QVF A;  2EWN A;  3E9G A;  3E9F A;  4B6M A;  2PVG B;  4A4H A;  3EGD A;  1G5V A;  3CCS Q;  3EAE A;  3HFO A;  3CCE T;  5FU7 C;  1UJ0 A;  2J6K A;  4EMG A;  3CBO A;  4BY6 C;  3RDV A;  2AZV A;  4J9C A;  2A08 A;  3EG2 A;  1M90 U;  3U23 A;  2FPE A;  1VQL Q;  4LDY A;  4Z89 A;  4M78 C;  3VS0 A;  5LJ5 g;  1AZG B;  2KI7 A;  1M1K C;  3A1P A;  4J9F A;  3H41 A;  4OF1 A;  2RQV A;  1VQK T;  1YHQ T;  2DET A;  2A3L A;  2JM8 A;  1SSH A;  3WVE B;  3FIF A;  2K3X A;  3VUZ A;  7AT1 B;  2Y4X A;  2AIR B;  3CC2 Q;  5IXF A;  2Y4Y A;  1H92 A;  3JCM e;  1RLP C;  5HCK A;  1Q81 U;  4V2S A;  2HD0 A;  4BDZ A;  1JJ2 A;  5L23 A;  1PC0 A;  3CME T;  1WHG A;  2E1H A;  2XD0 A;  3OYE A;  4HA8 A;  2HEQ A;  1MMA A;  1K8A U;  2HCK A;  1QWE A;  4J6W A;  1M3B A;  3ME9 A;  4NL2 A;  2CP6 A;  1N27 A;  4N4I A;  2JTM A;  2NWM A;  3QYG B;  3PMT A;  1NLP C;  3JCM h;  1K0S A;  3JB9 F;  3VYG A;  4BE1 A;  5LJ3 e;  1PCX A;  4XTZ A;  2LJ3 A;  3JCM W;  3P8D A;  2FRY A;  5IXB A;  2NUT B;  1G3T A;  1Y0M A;  2LQW A;  3QWY A;  1QCO A;  2L0A A;  2D6F A;  2DL3 A;  3QZ5 B;  2DMO A;  3FRN A;  3BDU A;  4E7I A;  3CBP A;  1RUW A;  2F69 A;  1X75 C;  4M78 A;  5CKF A;  3I56 A;  1SRL A;  1KD1 C;  3SEM A;  3H0F A;  3CD6 Q;  2DD4 A;  1KD1 U;  3M59 A;  2DL4 A;  4RUG A;  1NJI U;  3V7S A;  2LP5 A;  2MIO A;  1Q7Y R;  3CCV T;  4M78 F;  3I5S A;  3EGX A;  2VB6 A;  2MMP A;  2HSP A;  1WNL A;  2JNG A;  4XAX B;  3M0T A;  1YJW Q;  1GCQ A;  4AT1 B;  4F7U B;  1TUG B;  1RAC B;  2P4T A;  5J39 A;  1H8K A;  1Q95 G;  3MO8 A;  5LJ3 f;  3MJX A;  1Y57 A;  2KXD A;  2L3R A;  3JCM b;  1WDX A;  4C5I A;  2RHI A;  4M7D B;  5LJ5 j;  3CEY A;  4LXC A;  3JCM c;  1ZSZ B;  1M2V B;  2XDD A;  3CME Q;  1HXD A;  4TVR A;  3V7R A;  2GF7 A;  2J6F A;  4JRP A;  5GJV B;  5LJ3 d;  4BAC A;  2J6O A;  4M4Z A;  4CI0 C;  4PJO B;  2W10 A;  2VC8 A;  2ROT A;  2EJG A;  3OS1 A;  2RQT A;  1ABQ A;  3OSS C;  3A8L B;  4ZGJ B;  3A8O B;  3CPW P;  1WXB A;  2GFU A;  1YHQ Q;  3I55 T;  2I0N A;  5GAN 7;  3FJ5 A;  1NM7 A;  3HFN A;  5FW9 A;  3HRS A;  1ZBX A;  1VQN Q;  2AKK A;  1WI7 A;  4IUV A;  3O5Z A;  3ER0 A;  1QLY A;  5LJ5 d;  1VQN T;  2MYS A;  4Z88 A;  3VS4 A;  3UAT A;  4LN2 A;  4OMF B;  4IUU A;  5IHK A;  2RMO A;  3I55 Q;  2QEX Q;  1VQM T;  3CCU T;  3I56 Q;  1QWF A;  4PJL A;  3EGX B;  5LJ3 g;  3CCS T;  4XU0 A;  5GAN 5;  2HMA A;  3UA7 A;  3MHX A;  2CS7 A;  3S3N A;  4J5Y A;  2H8H A;  4RG2 A;  4LDX A;  3H6Z A;  1AWJ A;  1OPL A;  1M4Z A;  2F2W A;  1VQ9 Q;  5L8R E;  2JMA A;  4QVZ A;  2GBQ A;  2CSQ A;  2VGM A;  2ZPE B;  2P0P A;  1X01 A;  4EPC A;  2ESW A;  4M77 E;  2QXF A;  1Q81 C;  2OAU A;  1IO6 A;  4ELY C;  3QSU A;  1YJW T;  2QAZ A;  1X69 A;  1ARK A;  2DL5 A;  2E6Z A;  3JCM g;  4Y92 A;  2JM9 A;  2OTJ A;  4NL3 A;  1QVG S;  2DEU A;  2CP0 A;  1K73 C;  1VQO T;  1WQ7 A;  4R55 A;  5I2S A;  2OX7 A;  5GMK m;  2DBM A;  3P8H A;  5CKB A;  2PUK B;  4BD3 A;  2EQI A;  2KQW A;  1YJN A;  1MGQ A;  4PJO C;  2KDS A;  1EX4 A;  2KRN A;  4ANJ A;  3RBB B;  1NZ9 A;  4M77 F;  1LNX A;  2LDM A;  4RMO A;  1BI3 A;  2W0Z A;  5AYF A;  2O4X B;  1M90 C;  3M54 A;  1PG5 B;  1BI2 A;  1RI0 A;  3KFV A;  4MZT A;  2MI6 A;  2XU8 A;  3JCM X;  2EFI A;  1NJI R;  2XK0 A;  4F04 B;  5D6W A;  1C6V X;  2DX1 A;  2XID A;  2ZPB B;  4M7A A;  2FL7 A;  1KC8 R;  4RKU E;  4C8Q E;  2NUZ A;  2QGG A;  5GAO r;  1B07 A;  1YN8 A;  4M77 G;  3MCA B;  1N5Z A;  2V26 A;  4JUV A;  4EMK C;  1G3S A;  3CCQ T;  5J3B A;  3M0Q A;  2F1L A;  1PKS A;  5KE2 A;  3ZBD A;  4KUD K;  4A63 B;  3NTI A;  1PRL C;  4C92 B;  5C6S A;  1WHM A;  2X3X D;  2JOY A;  1UDL A;  4M75 B;  2AHJ B;  3X26 B;  4HVU A;  1YJW A;  4CC3 A;  3I9Q A;  1JJ2 P;  2A0F B;  3EGD B;  4LNP A;  3G7Z A;  3CC2 T;  2CP7 A;  3LH5 A;  1I07 A;  2K2V A;  4HCZ A;  2FVU A;  2R57 A;  1VQP A;  5GAN f;  4E7J A;  1WLP B;  1YI2 T;  3NFC A;  4R0K A;  1Q86 U;  2X4W A;  1I1J A;  3OYB A;  1WZO A;  5HK3 A;  1YIT A;  3NPF A;  3M5A A;  1VQL T;  2GNC A;  1JXO A;  3SFM A;  3TSW A;  4B9X A;  3X28 B;  1BB9 A;  3VS5 A;  2LQK A;  2FG0 A;  3I35 A;  1BI0 A;  4DBR A;  1WIE A;  5CQY A;  2HSE B;  2ZGW A;  1WQW A;  5A0D A;  2QYZ A;  4ZGE B;  2ABL A;  2EVR A;  3OMC A;  3RKW A;  3CCQ Q;  2FZC B;  2E70 A;  2M9U A;  1R0C B;  3M0R A;  5GJW B;  1K9M R;  5LL6 S;  3EFR A;  2YUN A;  4NS5 A;  5CAI A;  3CCL A;  1M1G A;  2YRD A;  2O2O A;  2K4Y A;  3GNG A;  2EQJ A;  1KC8 C;  1LJO A;  4PJO A;  2CT3 A;  3CC2 A;  2X4X A;  2EPD A;  4E7K A;  1WXT A;  2E41 A;  4M77 C;  1FMK A;  3QUI A;  3PE0 A;  4VUB A;  2K5L A;  3JB9 J;  3J7A F;  1R0B G;  2V8I A;  3M55 A;  1QQJ A;  1YP5 A;  2LQ8 A;  2KRS A;  2YRV A;  2XIC A;  4M78 B;  1NEG A;  2P84 A;  3A8H B;  4Y91 A;  4M7A G;  2QK0 A;  3DB3 A;  1W1F A;  2D1X A;  1VQ5 Q;  2QA4 A; 
#chains in the Genus database with same CATH homology
 5FU6 C;  4EMG A;  2CGH A;  3CBO A;  3LYI A;  3M53 A;  3RES A;  1VQ8 T;  4BY6 C;  1Q82 C;  5GAN e;  4DA4 A;  4LDW A;  1YJN T;  1G3Y A;  5GAN j;  5GAN 3;  1N8R C;  3CD6 A;  4CRI A;  2D9T A;  4LD9 K;  4ME7 A;  5FU7 B;  3UT1 A;  1M90 U;  3PIP A;  2QQS A;  4LDY A;  3FDR A;  4JDS A;  4M78 D;  3PGG A;  5D6X A;  4M78 C;  4KUI A;  5LJ5 g;  1H3Z A;  1M1K C;  1YIJ A;  3JB9 H;  3L2Q A;  4A4K A;  3Q1J A;  4OF1 A;  3LGL A;  5GAN 8;  3GPL A;  1W2B S;  3HL8 A;  2QQR A;  1VQK T;  4EMH A;  3L2V A;  2LVM A;  3WXM B;  2X35 A;  3M56 A;  2P0K A;  1YHQ T;  1M1K U;  3CC4 A;  2A3L A;  3MP1 A;  3WVE B;  3FIF A;  2K3X A;  2VV5 A;  3X24 B;  1QP3 A;  3CPW S;  3VUZ A;  1K73 U;  5GAM d;  2Y4X A;  3V8J A;  5IT9 E;  4FU6 A;  2Y4Y A;  4LD6 A;  4XTU A;  4BI3 A;  4L59 A;  4QW2 A;  3SWN C;  3JCM e;  2EKO A;  4BDY A;  1Q81 U;  4OGC A;  4C0G A;  2FYK A;  1OZ3 A;  1Y96 B;  2HD0 A;  4PKC C;  3CC4 T;  2R5M A;  3MP6 A;  3JB9 D;  2OTL A;  4BDZ A;  1JJ2 A;  3M57 A;  3F70 A;  4C92 F;  5GAO m;  2QTX A;  3OYA A;  4M7A C;  3CME T;  4FT2 A;  2WAC A;  2E1H A;  4Z02 A;  4HCB A;  2XD0 A;  3OSV A;  2QI2 A;  2CZ0 B;  3OYE A;  5CO7 A;  3VJP A;  3CCJ A;  2K3Y A;  4C0D B;  4HA8 A;  4XK8 E;  5CVI A;  4ZN1 A;  3OS2 A;  1K8A U;  2XG8 D;  3GIB A;  3E1S A;  1NPP A;  4J6W A;  5FRO A;  4E7L A;  2E12 A;  3ME9 A;  4NL2 A;  3L2U A;  1N27 A;  4N4I A;  2JTM A;  4HKE A;  2F5T X;  1N8R U;  1K8A C;  4PNO A;  2QEX T;  1VQP T;  3QYG B;  4DQ2 A;  2YHT A;  3DB4 A;  3PMT A;  2H3J A;  2P0Q A;  3OYH A;  1Y71 A;  2KSS A;  3NTK A;  3LH0 A;  4C8Q B;  1FWZ A;  3CMA A;  3OS0 A;  3JCM h;  3JB9 F;  2MF2 A;  3VYG A;  3L42 A;  3CMA T;  4BE1 A;  5LJ3 e;  5HK0 A;  2EYQ A;  5LJ5 f;  1EIF A;  3KUF A;  4XTZ A;  4OP0 A;  3HP9 A;  3P8D A;  3JCM W;  1YJ9 T;  3UWN A;  2M0O A;  1G3T A;  4B9W A;  4C0D C;  1BKB A;  4PJO F;  2D6F A;  3QZ5 B;  3RUX A;  5GAN d;  4J8O A;  1RL2 A;  3FRN A;  4X9C A;  3BDU A;  1U1S A;  2B8A A;  1VIE A;  3CBM A;  1M8V A;  1XOV A;  4OB1 B;  3OYD A;  4E7I A;  2EJF A;  4L5G A;  3JCM P;  3CBP A;  3SB2 A;  1M5Q 1;  2F69 A;  3S3M A;  1VQ7 T;  1X75 C;  2RHU A;  4M78 A;  4C5E A;  4WF2 A;  5CKF A;  2CKK A;  3R6O A;  5DM7 R;  3I56 A;  4OB2 B;  1KD1 C;  3DLM A;  3J80 E;  3I56 T;  5A0L A;  3GP8 A;  1V29 B;  4A53 A;  2DD4 A;  3GLX A;  4RCB A;  3CXC A;  3L2W A;  3JCM V;  3VUB A;  1ZQ1 A;  1M1F A;  3INZ A;  2HBP A;  3JB9 G;  4Y28 E;  1QW1 A;  1VQO A;  2JTF A;  3HRU A;  1KD1 U;  3VV0 A;  3M59 A;  3UDC A;  4C0F A;  1KQS S;  1NJI U;  4KUL A;  3VYH B;  2DXB A;  3V7S A;  3CME A;  3JCM J;  4F7U E;  2HNI A;  2Y90 A;  3OYC A;  5GAN g;  4QVC A;  4MDX A;  3CCV T;  2WSE E;  1DJ7 B;  4M78 F;  5IN1 A;  1WJQ A;  1VQ9 A;  4BB7 A;  3J81 E;  4XQ3 A;  5GAN h;  2PQW A;  2MMP A;  1Y96 A;  3PT9 A;  5CKE A;  2VYT A;  3T9N A;  4M7D D;  1WNL A;  2JNG A;  4XAX B;  2EQU A;  1KC8 U;  2OTL T;  3CC7 T;  1Q86 C;  4ZTF A;  4J6Y A;  4IUQ A;  2HQE A;  3GF5 A;  3PFS A;  3A8G B;  3SDZ A;  4F7U B;  3VU3 C;  1GXI E;  1KHC A;  2P4T A;  2BIV A;  5J39 A;  4A4E A;  4F7U A;  4JS4 A;  4HCC A;  4M75 E;  2X4Y A;  4M75 F;  1R8O B;  1K9M U;  3MO8 A;  5LJ3 f;  2L3R A;  3JCM b;  2I2L A;  3LGF A;  2E10 A;  5CK9 A;  2CZ1 B;  4XU2 A;  4C5I A;  4QQG A;  3RER A;  2BKD N;  3C12 A;  1VQ9 T;  3URG A;  4M7D A;  2RHI A;  2F5K A;  3MEV A;  3LLR A;  3LX7 A;  4M7D B;  5CCA A;  1O9S A;  2L8D A;  5LJ5 j;  1Q7Y U;  4PLI A;  3CEY A;  3FJP A;  4XTV A;  4HT9 A;  3LWI A;  3JCM c;  5GMK i;  2JZ2 A;  1BIB A;  2RJE A;  2XDD A;  2VGN A;  3PNW C;  1FXX A;  1HXD A;  1I4K 1;  4E7H A;  1PSF A;  4TVR A;  5HY6 A;  3V7R A;  3AHU A;  1YBY A;  3O8V A;  1Q7Y C;  2GF7 A;  4OGE A;  4JRP A;  4M7D F;  3CD6 T;  5LJ3 d;  4M77 A;  5CKH A;  4BAC A;  4CI0 C;  4PJO B;  1NPR A;  2RHX A;  2DXC A;  2DZC A;  3QO3 A;  2DTI A;  1P92 A;  2QA4 T;  2VC8 A;  2XKO C;  1VQ4 T;  2ZPI B;  2EJG A;  3QJY A;  4YTL A;  3OS1 A;  3UPU A;  3HKS A;  2XDB A;  4MZM A;  3OSS C;  5GMK j;  4RCC A;  2M16 A;  3A8L B;  2LNV A;  3A8O B;  4ZGJ B;  4R56 A;  3G6E T;  3MEW A;  4C5G A;  3QPH A;  1WGS A;  2RHZ A;  1JBM A;  2GFU A;  3KXT A;  5I21 A;  5IAY A;  3I55 T;  1VQN A;  2D0Q B;  2DK3 A;  1I8F A;  4LDV A;  1YHQ A;  5GAO l;  4C8Q F;  4JJN K;  4PL6 A;  3FEO A;  5GAN 7;  4E47 A;  3OYJ A;  3CCR T;  3HFN A;  2HAX A;  3HRS A;  2XDP A;  1ZBX A;  2K57 A;  4O5V A;  5GAM j;  5A2Q E;  2FHD A;  4M7A E;  1N9S A;  2LT4 A;  4EDU A;  2XHC A;  1U8R A;  4IUV A;  3BW1 A;  1MHN A;  1X6O A;  5GAN 2;  3ER0 A;  4M77 D;  5LJ5 d;  2PVO B;  2RB6 A;  3QXE B;  1I5L A;  2RI2 A;  1QP2 A;  1VQN T;  3CPF A;  3CPW A;  4M7D G;  3ZEH A;  4P5N A;  1VUB A;  2DAQ A;  3N5B B;  2MAM A;  4N0A A;  4IUU A;  1UGQ B;  4OMF B;  2RM4 A;  1D3B A;  3CXC S;  2R5A A;  4BE0 A;  2E65 A;  3G4S A;  1VQM T;  4ZN3 A;  3CCU T;  1D3B B;  2RHY A;  4FL6 A;  2JUF A;  1KHI A;  4KBM B;  3TEE A;  1WJR A;  2JN0 A;  4M7D C;  1YCY A;  3BDL A;  2DXU A;  2PU9 B;  5LJ3 g;  3M4G A;  2PUO B;  3WVD B;  3CCS T;  4XU0 A;  5GAN 5;  2DZ9 A;  2EAY A;  1VQL A;  2RA2 A;  3CCE A;  4II1 A;  3MHX A;  2CS7 A;  3S3N A;  3JCM Q;  1QVP A;  4J5Y A;  3RIR A;  4J7F A;  3FC3 A;  4C0Z A;  4HT8 A;  4M75 A;  4PJO E;  4RG2 A;  4LDX A;  2C06 A;  3H6Z A;  4MDW A;  4PJO G;  2L5Q A;  3OQ5 A;  3E19 A;  2KMT A;  2ZPG B;  3G71 A;  3HRT A;  1VQ6 T;  1M9S A;  1M4Z A;  4DOV A;  3P8B B;  3MEU A;  3OBW A;  3C95 A;  5L8R E;  4QVZ A;  2ZPH B;  1YJ9 A;  2DTO A;  2GCX A;  2ZPE B;  1G3W A;  2P0P A;  1UGP B;  1X01 A;  2RH2 A;  2VGM A;  4GY5 A;  5M9O A;  1OYX A;  5GAO q;  2QEX A;  4BE2 A;  1KQS A;  2K5F A;  3BY7 A;  4EPC A;  3TRE A;  3HSB A;  3I55 A;  3OYF A;  2CZ7 B;  4BI8 B;  2DO3 A;  4M75 C;  4N0A C;  5GAN 6;  4OVA A;  1KQ1 A;  4M77 E;  2WSC E;  2QXF A;  4M77 B;  1Q81 C;  2OAU A;  4ELY C;  3QSU A;  1YJW T;  3OA6 A;  4C92 D;  3NTH A;  3C94 A;  1YIJ T;  4F7U G;  3GOX A;  4D6W A;  3JCM g;  2E6Z A;  2YLC A;  4EMK A;  3CCV A;  4MMK A;  3QHS A;  2OTJ A;  4NL3 A;  4EMK B;  3ASK A;  1QVG S;  2EJ9 A;  2QQB A;  3OYM A;  1K73 C;  1KQ2 A;  1Y07 A;  2VXF A;  2LRQ A;  3TCJ A;  1VQO T;  1WQ7 A;  1Y7X A;  2LX9 A;  3KBG A;  1N9R A;  4R55 A;  3DLL A;  5HKC A;  3S6W A;  2QQ9 A;  1BI1 A;  4PLL A;  5I2S A;  5GMK m;  4KT0 E;  4X34 A;  3P8H A;  5CKB A;  2PUK B;  5I2M A;  3OYI A;  4RG8 A;  2RI5 A;  3ZFJ A;  4BD3 A;  1VQ8 A;  1BYM A;  2KQW A;  4ELZ C;  1YJN A;  1H64 1;  2X4J A;  2DIQ A;  4PJO D;  1MGQ A;  2FB7 A;  2MWO A;  5GAM f;  5LJ5 e;  2KDS A;  4PJO C;  1XTD A;  1NZ9 A;  1XNI A;  4M77 F;  5D6Y A;  3LWH A;  4BI4 A;  4XTX A;  1LNX A;  2LDM A;  4RMO A;  3QZ9 B;  1BI3 A;  5LJ3 h;  5C0M A;  5AYF A;  2O4X B;  1QVF S;  5LJ3 j;  2ZCF B;  1M90 C;  3M54 A;  4C8Q C;  2KAF A;  1W4S A;  2DKG A;  1BI2 A;  2E64 A;  4M78 E;  2O4X A;  4N4G A;  4O6J A;  5GAO p;  4JRI A;  3MP8 A;  4ZTJ A;  5LJ5 h;  1RI0 A;  1YI2 A;  1O75 A;  5GMK e;  2L89 A;  2KK4 A;  2JVV A;  2BUD A;  4X9D A;  4M7A F;  4A4F A;  4MZT A;  5DY9 A;  4A4G A;  3M4Y A;  2VUB A;  2G3R A;  2XU8 A;  2KY9 A;  2MI6 A;  2LC4 A;  2M1H A;  1WPY A;  2RJF A;  2EFI A;  1I81 A;  3OS5 A;  3JCM X;  3OYL A;  2EIF A;  4L6V 5;  1IRE B;  3OYG A;  3G6E A;  2XK0 A;  4JLI A;  4XTY A;  2IG0 A;  1UGR B;  5D6W A;  4J7I A;  3MEA A;  3MET A;  1LOJ A;  3QII A;  2XID A;  2ZPB B;  2EQM A;  1JJ2 S;  3CCL T;  2FL7 A;  4M7A A;  3OW2 A;  4RKU E;  4BUG A;  5FRM A;  4C8Q E;  5KH6 A;  1NE8 A;  2YLB A;  3L2R A;  5GAO r;  4JLG A;  3BFM A;  4M77 G;  5FLX E;  2O01 E;  3V8L A;  4GLK A;  3MCA B;  4JUV A;  4EMK C;  1HK9 A;  3OY9 A;  1G3S A;  3CCQ T;  5J3B A;  3HHT B;  2DTH A;  2NLU A;  3ZBD A;  5KE2 A;  1TH7 A;  2XI9 A;  4FIB A;  3TU4 K;  4KUD K;  3NTI A;  3FLG A;  3CCM A;  4C92 B;  5C6S A;  2GQV A;  2R58 A;  2JOY A;  2ZPF B;  1VIF A;  4DOW A;  4C92 A;  1B34 A;  1JRI A;  2A7Y A;  1W2B A;  4LDU A;  4C92 C;  1VQ5 A;  4M75 B;  3DKM A;  1OZ2 A;  1JB0 E;  1OI1 A;  2AHJ B;  3X26 B;  3OYN A;  3CCU A;  1YJW A;  3G4S T;  2RJD A;  2V8K A;  5GAM g;  4JRQ A;  4M75 G;  2GFA A;  5GMK h;  3M9Q A;  3G7Z A;  3QDR B;  2LCL A;  1NJI C;  3L2Z A;  3JAM E;  3CC2 T;  2DJZ A;  4C92 G;  1S72 A;  3EFS A;  5KCH A;  3PTA A;  2LCC A;  4MZP A;  1K9M C;  4M7A D;  3X20 B;  2V8J A;  2K2V A;  4HCZ A;  2DIG A;  3CC7 A;  2FVU A;  2R57 A;  1VQP A;  5GAN f;  4A54 A;  5CQX A;  3JCM f;  4XU3 A;  3QG1 A;  3QJ6 A;  4E7J A;  2DEQ A;  1YI2 T;  5FRN A;  3OYY A;  3NFC A;  4BY6 B;  1Q86 U;  2IVW A;  4XU1 A;  2X4W A;  4F7U F;  4ZGD B;  5FU6 B;  2QDY B;  4V2S A;  3HPW A;  3LW5 E;  5HK3 A;  3GNF B;  3OYB A;  3G71 T;  1IZ6 A;  3JRZ A;  4QQ6 A;  3JSC A;  4C5H A;  3OB9 A;  5GAO n;  1YIT A;  4ATO A;  1FX7 A;  5DLO A;  3OBY A;  3V8K A;  1SSF A;  3RKX A;  3CCS A;  3M5A A;  4IUP A;  4XTW A;  3X25 B;  4C8Q D;  1VQL T;  4IKF A;  1VQ4 A;  4B9X A;  3SFM A;  2WSF E;  4Q5W A;  4QQD A;  1XQH A;  3X28 B;  1N6A A;  2LQK A;  3SD4 A;  3L1A A;  4N4H A;  3OMG A;  1VQM A;  1BI0 A;  1AHJ B;  4NOY A;  3RMQ A;  1VQ6 A;  1YIT T;  3OYK A;  2KVQ G;  5CQY A;  4QVD A;  2RK2 A;  2ZGW A;  4C8Q G;  1U1T A;  4MML A;  1VQ5 T;  1Q82 U;  1VQ7 A;  2DXT A;  1WQW A;  3VKI A;  5A0D A;  3M58 A;  3QYH B;  4ZGE B;  3CCQ A;  3OMC A;  5GAM e;  3RKW A;  2DVE A;  2E70 A;  3FB9 A;  5KCO A;  2M9U A;  5GAN 4;  3QBY A;  3JCM d;  4FSX A;  5GMK l;  5LL6 S;  5DLQ E;  3EFR A;  2DD5 A;  4NS5 A;  5EG2 A;  5CAI A;  5CR2 A;  3CCL A;  2CZ6 B;  4M7A B;  1M1G A;  1UEB A;  1UGS B;  2CYZ B;  4C8Q A;  3CCR A;  3OW2 S;  4IUR A;  3JB9 I;  5KE3 A;  3A8M B;  4M7D E;  5J26 A;  1WJS A;  2ZZD A;  2K4Y A;  3SWN B;  3GNG A;  2EQJ A;  2LTO A;  1KC8 C;  5CIU A;  3PMI A;  1ZHI A;  3SWN A;  1LJO A;  4JRK A;  4OB3 B;  4UC4 A;  1QVG A;  3CC2 A;  2RD1 A;  2X4X A;  4PJO A;  2DPP B;  4M75 D;  2RI3 A;  5A0G A;  4E7K A;  3A5Z B;  2E41 A;  2RK1 A;  1S72 T;  1VQK A;  4M77 C;  2RJC A;  5CKD A;  3QUI A;  3V7C A;  3CCM T;  1BIA A;  2E5Q A;  2K5L A;  4VUB A;  4C92 E;  4IUT A;  1B34 B;  4FM4 B;  4JS5 A;  3JB9 J;  2EQK A;  1UB4 A;  3J7A F;  2V8I A;  3M55 A;  4J6X A;  2HQX A;  3RMS A;  4FT4 A;  3C4S A;  2LQ8 A;  2VXE A;  1QVF A;  2EWN A;  2PVD B;  2RO0 A;  2YRV A;  3E9G A;  4M78 G;  2XIC A;  3E9F A;  2PVG B;  4M78 B;  3QKJ A;  4A4H A;  3PIO A;  1G5V A;  2E6N A;  3A8H B;  3CCJ T;  2OTJ T;  3RKY A;  4Y91 A;  4M7A G;  2QQA A;  3EAE A;  1KG1 A;  2K5I A;  3H8Z A;  3DB3 A;  3HFO A;  1PSE A;  3CCE T;  5FU7 C;  4OB0 B;  3S3O A;  4J83 A;  2QA4 A;  2LT1 A;  5GAM h;  2MWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...