2JP7A

Nmr structure of the mex67 uba domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
57
structure length
57
Chain Sequence
b'RLNPVQLELLNKLHLETKLNAEYTFMLAEQSNWNYEVAIKGFQSSMNGIPREAFVQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords mRNA export factor MEX67
publication title Coordination of Hpr1 and ubiquitin binding by the UBA domain of the mRNA export factor Mex67
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 17
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2007-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jp7A00
2B3TA 1E94E 4DBGB 2CP8A 2L4FA 1R4GA 2O25A 3E46A 2JZ0A 1VQ1A 1IM2A 1VEJA 2DZLA 2HAKA 1VEKA 2DAGA 2WZJA 3IHPA 2JY5A 2DENA 2HWJA 3FRHA 2MROB 2MGWA 2H5XA 2QHOB 2LVQD 2R0IA 1OTRA 1OQYA 1TTEA 2MR9A 1EFUB 1P3QQ 3GLFE 3GLHE 4F1IA 1JR3E 1VG5A 1WR1B 2RRUA 2EJSA 2K9DA 4F2LA 1HT2E 4Q7JA 1V92A 1MN3A 1UFZA 1BVSA 1T6OA 1WGLA 1WIVA 1VDLA 1YLAA 2JUJA 1DO2A 2K0BX 1ZV1A 2ZTDA 2DNAA 2JNHA 4GEWA 1KYIA 3GLIE 1ZMUA 4HEOA 2KNVA 2KNZA 3BBZA 2MJ5B 2LTUA 2OOAA 1NV9A 1QZEA 2BWEA 1HQYE 2EKKA 2DAMA 2OOBA 2ZTCA 1IXSA 1DO0A 1G41A 1HT1E 1XXHE 2JY7A 3F92A 2CWBA 1CUKA 1TR8A 2LVOC 1IFYA 2KHHA 1OKSA 1Q02A 2JP7A 2JZ1A 2DHYA 4R71A 1T43A 4G3OA 2L2DA 3E21A 2KNAA 1G3IA 1SG9A 1WHCA 2OO9A 1G4AE 3FRIA 3FE3A 1WGNA 4UN2B 1NV8A 3B89A 2LBCA 1F4IA 3LCUA 2DAKA 1AIPC 2DI0A 3K9OA 1Y8GA 1ZMVA 2EKFA 1A5TA 3K9PA 3H4JA 3MMPA 2DAIA 3LCVB 1HJPA 2BWBA 2L4EA 2QNJA 3GLGE 1ZMWA 5JI2E 5DFLA 2DKLA 1DV0A 2JY6B 2LVPC 1PGYA 2JY8A 1XB2B 1C7YA 2G3QA 3T6PA 4WP2A 1OAIA 2DAEA 2LVNC 1WJ7A 2LVAA 1VEGA 1GO5A 3IECA 2QSFX
chains in the Genus database with same CATH superfamily
4X64M 1E94E 3U6LA 3SFZA 3GPPA 1QAMA 3AOGA 1E32A 3UK6A 3ZQJA 2QQ8A 4LJAA 1R4GA 4AW4A 2O25A 2XH9A 3E46A 4JN6A 3FUWA 3HJQA 1E9RA 1IM2A 1VEJA 3L28A 5ITTA 1VEKA 3KOYE 2WZJA 4DV3M 4LF5M 3SMSA 3DFZA 5DYGA 1PJTA 4KLNA 2UXDM 3GRUA 3U6QA 3FRHA 3DA1A 1HNZM 2MROB 1NNUC 1PJQA 3KOWE 4CIZA 2CFOA 3GPUA 3GRYA 5ITXE 4AQYM 4OX9M 3QYEA 1EFUB 3LMMA 5IZ7D 5FLXS 3E9SA 3GLHE 1QDRA 2O5RA 3GPXA 4MGYE 3TPZA 3KXEC 1DGFA 2EJSA 2UUAM 3U61B 4F2LA 2VIIA 4DR6M 3SYKA 1NO1A 1XHBA 3GQ5A 2QENA 4PCZA 4MGZE 4RF1A 3W0LB 2C9CA 3T1HM 2L09A 1JB0F 3U6SA 4B7HA 3HU2A 1DGBA 4CJ6A 2JUJA 5ITQA 2BJVA 3J27B 2ZTDA 3J7AS 2DZOB 3A42A 3MHVC 4AZFA 2DNAA 2JNHA 2VF8A 3PNVA 4MGIE 2UXBM 3EIHA 2KNVA 4MGHA 2M60A 2H1RA 2CHVA 2OOAA 4CHTB 3HHXA 3L29A 3UZUA 1IY2A 1D0LA 2DVWB 4IJFA 4AG5A 2LXEA 3M6AA 2EKKA 4OW0A 4I4LA 4G4RA 3D8LA 2F5QA 3F92A 2CV1A 1CUKA 3LQQA 2I7NA 1OKSA 1L1TA 2JP7A 4NL4H 3HY5A 4G3OA 3D8BA 5IT9S 1L2DA 3FTFA 1G3IA 3FYCA 3VFDA 1SXJE 1WHCA 2KA6B 3B74A 3SYLA 3TE6A 5H37D 3SAVA 4ITQA 4LF9M 3AL0C 1PJSA 3KSJA 3T1YM 3KOXE 4NSOB 4UN2B 3GRRA 4QHSA 4DV4M 1NV8A 3KDSE 3B89A 4FVMA 4MGKE 3W0FA 4DV2M 3GLIB 2C98A 2K47A 2CHQA 1N78A 3K9OA 1HR0M 2XSZD 1ZMVA 2R44A 4FW9A 4Z6YA 2KXEA 4LJ5A 1IN7A 1DGHA 2KEBA 2Y20A 3MMPA 3PXGA 3VLFB 2X4AA 3AJIB 4G6ZA 4W5WA 3RFWA 3B7QA 3QAUA 2YNMD 2ZAOA 3HU1A 1SXJD 3BOSA 4B7GA 1ZMWA 3JR5A 4LJ8A 5EJCA 4IBEA 5JI2E 3UGJA 3HKPA 4CISA 3R9XB 3SAWA 1K3XA 1QYRA 2WSCF 1D0MA 3HHYA 2C99A 1C7YA 3GPYA 1N32M 4DUYM 4B3MM 4WP2A 4K0KM 4NXNM 3B7NA 2VQFM 1NHWC 3TWLA 1VEGA 4JI7M 3C9PA 1MJGM 1T3TA 3IECA 3U6PA 4AG6A 2G5GX 2DHRA 5E6JA 1IBKM 2L4FA 5A2QS 1LV7A 1K3WA 3I4VA 2JZ0A 4FCTA 1VQ1A 1D2NA 2XZUA 2DZLA 2DWMA 3I4YA 4JI2M 3IHPA 2JY5A 4LF6M 2K6BA 3GLGB 1PM5A 2C5RA 2X8AA 3TQSA 3SARA 2HWJA 1XC8A 4GHLA 4P17A 2F5NA 2ZANA 5FTMA 2R45A 3GLIA 1IN6A 2XGNA 1R2ZA 1Q39A 4B7FA 2H5XA 3SMPA 1Z5AA 3L26A 1TH3A 4S12A 3VK7A 4NRVA 4QNMA 2KW0A 1OTRA 4L16A 2MR9A 1J09A 1P3QQ 4R7GA 4F1IA 5F3WA 2CV0A 4PD2A 2F4VM 4MM3B 3RGSA 1IBLM 1WR1B 2RRUA 4DV0M 2M5ZA 2G8LA 4DR1M 3FTEA 2APLA 1ZAEA 1MN3A 1OIPA 4YHHM 3WHLA 1E9SA 2FFJA 2ZAMA 2BJWA 4AKIA 3UJNA 2CV2A 4LF8M 3AKZA 1VDLA 1YLAA 1PJIA 4NXMM 2K0BX 1ZV1A 2D7GA 1NVMA 2JXNA 4GEWA 1N77A 1Z59A 1TF0B 2DWZB 3C3DA 2R18A 1V34A 4NRWA 1IN5A 3AV0A 2LTUA 3PFIA 1NV9A 4EIWA 5C1BA 4LJ9A 3LVWA 2BWEA 1Q3BA 4BB9A 2R4EA 2N35A 1N33M 1L8QA 1XMOM 3T38A 2ZTCA 4DV6M 4QOZC 2Z3XA 1QUSA 1HT1E 4B08A 2Z4SA 1XXHE 3GLHB 3AFHA 4JXJA 4RKUF 3H4MA 1TR8A 2LVOC 1R7RA 1XXHB 2L7HA 1J5EM 2GNOA 1Q02A 3GLGA 3VKHA 2JZ1A 2DHYA 3RE8A 4CGYB 3J80S 1IXRC 1V33A 5EXTA 3TWKA 1MX0A 2OO9A 2UU9M 1G8PA 2L7IA 2DZNB 2KRKA 3FE3A 1TH4A 2FE8A 3HJSA 4JI4M 5FTNA 2DAKA 1AIPC 4ANRA 1PJJA 5KO3A 1N36M 1EE8A 4AKHA 2RKOA 5FTLA 1Y8GA 1YUBA 1TH2A 2EKFA 5ITUA 3A46A 4B3SM 5FTKA 4LCBA 3VDPA 1R5LA 1VDDA 3FUTA 3H4JA 4L6V6 2DAIA 3HHWA 4KHPM 3TWMA 4L8RC 3FUVA 3A45A 1HJPA 2BWBA 1QANA 4LZZA 1IN8A 1W5TA 3ZH9B 4AI6A 1I94M 3HX3A 1IN4A 3UMMA 1L1ZA 2CEAA 5DFLA 1XWIA 2KZUA 4MH0E 3FUUA 1G59A 2R62A 2KRUA 1PGYA 4Y28F 4JI1M 2OQ4A 1SXJB 3T15A 3I51A 4X62M 3MK6A 4LJ6A 3R8FA 4JI0M 3T6PA 5ITXA 3U6EA 3A98B 3CF0A 4DV7M 1GJTA 2LVNC 1Q3CA 4G4QA 3GLHA 1XMQM 3K1JA 2P5TA 3U61A 1GO5A 2LWXA 1OFHA 1XXHA 2QSFX 2XFSA 2B3TA 3QWLA 4HEOA 1OFIA 3VK8A 2QBYB 4JI6M 2J7OA 1SXJC 4DBGB 1NY6A 2CP8A 1TDZA 1C1KA 4JV5M 4G4OA 1J7KA 1IXSB 3OTOM 1HNWM 2HAKA 8CATA 3IG5A 3KP0E 3Q8GA 3QYBA 4DR5M 3GQ3A 1IY1A 4X66M 3KVWA 3W68A 1GABA 1G71A 4L15A 5FSWA 4BBAA 2RGHA 1N75A 4GKJM 4Z8XA 3KP1E 2MGWA 3KS4A 4DR2M 5EP4A 1FNNA 4XBOA 2J5YA 4LFBM 2VDBB 2Z4RA 2QHOB 4FWGA 2FOIC 1OQYA 1TTEA 4WW0A 3FYDA 3GLFE 1FJGM 2HKJA 4NC6A 2C96A 4JI3M 4DR7M 2LHGA 1JR3E 1TGUA 1VG5A 2X49A 2XSZA 3GRVA 1GKIA 2MH8A 3PVSA 1NHGC 5DYIA 1OIZA 3HZJA 3W67A 2CHGA 4GRIA 1GJSA 3J81S 1S3SA 3HU3A 5BPVA 4IBGA 1V92A 1NNJA 4IJEA 1UFZA 4FCVA 2QPAA 1BVSA 4GHAA 1K82A 3DZDA 1NSFA 1YSYA 1QDTA 4GC9A 3ZC7B 5EQTA 2FNAA 1SXJA 1WIVA 3WHKA 1XNQM 1DO2A 3K8ZA 3GO8A 3Q8XA 2C9OA 4KODA 3CGWA 4LF4M 1PRBA 1I4WA 1YE9A 1GLNA 3HJ8A 4L4UA 4DV5M 3DOAA 1QZEA 2QBYA 1JR3D 4RF0A 1HQYE 1QVRA 2OPFA 3L25A 2R6FA 3U6DA 4JI8M 3ILKA 2DAMA 2OOBA 5ITYA 3EIEA 3NBXX 4M0WA 1IXSA 1DO0A 5KQ8A 3VDUA 2CUZA 4M0DA 3C58A 2CWBA 4GMQA 3TL4X 3SC3A 2VF7A 3SHGB 2F5PA 4R71A 2YFQA 2DXIA 7CATA 2L2DA 3E21A 3HGIA 4GH9A 2KNAA 5JI3E 1SG9A 3J7BA 3FTCA 4LJ7A 2RGOA 1G4AE 2W82A 4QHTA 4REZA 2QCUA 4TUWA 2VQEM 1N34M 4DV1M 2XZFA 1IXZA 4D81A 4JI5M 4B3RM 3HWSA 4KO8A 3E4RA 1F4IA 2YR0A 5GKNA 2ZM6M 5EP1A 4IBKA 5KPRA 4B3TM 2Y0TA 1A5TA 3K9PA 1IBMM 3CTWB 4DUZM 1KFVA 3L27A 4WURA 1QUTA 1Z6TA 3LCVB 2Z8YM 4GC5A 2UUBM 1NJGA 2WSFF 1QAOA 4PDIA 5LMUM 2J7NA 3MJ5A 2L4EA 2QNJA 4OU7A 1R2YA 5EP2A 4YY3M 1GVNA 4G4NA 2R65A 4GITA 3PNYA 4LY6A 2DKLA 4XGIA 1DV0A 4IBBA 4MB7A 3KFUG 4IBJA 4OVZB 5IWAM 3KS8A 1OJLA 2LHCA 3M7GA 1R6BX 2HHHM 2D7EA 2NQ8C 4P16A 4IBDA 2DAEA 2V1CA 4PT5A 4X65M 1JQJC 4I8OA 2CE7A 3U6CA 2Y0QA 3V76A 2LNHC 1WXQA 4LGMA 1TDHA 3LVVA 1DGHB 2XF3A 5LMNM 3FTDA 4QOSA 4IBFA 1XNRM 2DAGA 4II7A 3B7ZA 2DENA 2A5YB 3LW5F 5L8RF 3SBJA 4AKGA 4KT0F 3VKGA 1Z5CA 2Q2EB 1GL7A 4LGYA 1QQWA 5EXPA 4GKKM 3U60B 2R0IA 2LVQD 2CRUA 5C18A 2BNKA 3SASA 4M9SA 4BLCA 2UUCM 1EIJA 2AHMA 2XLJA 4NOOB 1L2BA 2LH0A 3U5ZB 2KZSA 3KSXA 4HL4A 4I5SA 5EP3A 1OAOC 4IBIA 3SAUA 2K9DA 1HQCA 1HT2E 4Q7JA 5EXXA 2DWNA 4JYAM 1KSFX 4M9ZA 1T6OA 4D80A 3FUXA 1Z5BA 3GP1A 3CF2A 1X37A 2EO2A 1WGLA 4LRSA 4GIPA 3AOEC 4OVZA 5KPZA 2EA0A 3JAMS 3GQ4A 1LTMA 1AUAA 2L6OA 5BR8M 1IQPA 1UM8A 1KYIA 3THGA 3GLIE 4LFCM 1ZMUA 1RU3A 3FD9A 5DNYA 3L2AA 4I81A 2KNZA 1HNXM 3J2PB 5EXSA 1NJFA 1QZMA 3BBZA 2MJ5B 2QP9X 3ZCBB 2E5LM 2D7HA 4R3DA 3LQRA 2Z7JA 4M9XA 4LF7M 1GL6A 4A3VB 4HLQA 2KDLA 3FKEA 3GLFB 2HL7A 1G41A 2JY7A 5E26A 2FS1A 2R46A 2Y21A 1IFYA 2KHHA 5KPTA 3IG8A 1ZQ9A 2HCBA 4LJ4A 3SHFA 3I01M 1T43A 2V1UA 2EUCA 1W5SA 1NY5A 2JA2A 1IY0A 2ERCA 2F5SA 2R4JA 3NBIA 3RGPA 1QAQA 2ZBKB 3FRIA 3U60A 3U6OA 3KW6A 1WGNA 4IIWA 3CF6E 3B9PA 3AOEA 4LZJA 4FWDA 2LBCA 1DGGA 3LCUA 2DI0A 3U5ZA 2XFTA 2I7PA 2V6ZM 2XEPA 1MU5A 3NWLA 4PDGA 2GQFA 3JR4A 4FD2A 4LRTA 4NSRA 4RNAA 5IREB 3BXWA 1H6UA 3K2LA 2JWSA 2UXCM 3M0EA 4ZPXA 5KQDA 4XK8F 3U6MA 3SATA 3GLGE 2O01F 2QZ4A 3C3EA 5ITRA 4DR4M 1D0KA 3KOZE 2YQZA 4LFAM 4QNRA 2DWLA 4FCWA 3HHZA 2JY6B 2LVPC 1ORYB 2JY8A 1XB2B 4FWHA 1L2CA 4LG2A 4D82A 2G3QA 5FTJA 2F5OA 3K92A 2WSEF 1OAIA 4DR3M 3I04M 3GLFA 4L78A 1WJ7A 2LVAA 4IBCA 2FH0A 1JR3A
chains in the Genus database with same CATH topology
2B3TA 1E94E 4DBGB 2CP8A 2L4FA 1R4GA 2O25A 3E46A 2JZ0A 1VQ1A 1IM2A 1VEJA 2DZLA 2HAKA 1VEKA 2DAGA 2WZJA 3IHPA 2JY5A 2DENA 2HWJA 3FRHA 2MROB 2MGWA 2H5XA 2QHOB 2LVQD 2R0IA 1OTRA 1OQYA 1TTEA 2MR9A 1EFUB 1P3QQ 3GLFE 3GLHE 4F1IA 1JR3E 1VG5A 1WR1B 2RRUA 2EJSA 2K9DA 4F2LA 1HT2E 4Q7JA 1V92A 1MN3A 1UFZA 1BVSA 1T6OA 1WGLA 1WIVA 1VDLA 1YLAA 2JUJA 1DO2A 2K0BX 1ZV1A 2ZTDA 2DNAA 2JNHA 4GEWA 1KYIA 3GLIE 1ZMUA 4HEOA 2KNVA 2KNZA 3BBZA 2MJ5B 2LTUA 2OOAA 1NV9A 1QZEA 2BWEA 1HQYE 2EKKA 2DAMA 2OOBA 2ZTCA 1IXSA 1DO0A 1G41A 1HT1E 1XXHE 2JY7A 3F92A 2CWBA 1CUKA 1TR8A 2LVOC 1IFYA 2KHHA 1OKSA 1Q02A 2JP7A 2JZ1A 2DHYA 4R71A 1T43A 4G3OA 2L2DA 3E21A 2KNAA 1G3IA 1SG9A 1WHCA 2OO9A 1G4AE 3FRIA 3FE3A 1WGNA 4UN2B 1NV8A 3B89A 2LBCA 1F4IA 3LCUA 2DAKA 1AIPC 2DI0A 3K9OA 1Y8GA 1ZMVA 2EKFA 1A5TA 3K9PA 3H4JA 3MMPA 2DAIA 3LCVB 1HJPA 2BWBA 2L4EA 2QNJA 3GLGE 1ZMWA 5JI2E 5DFLA 2DKLA 1DV0A 2JY6B 2LVPC 1PGYA 2JY8A 1XB2B 1C7YA 2G3QA 3T6PA 4WP2A 1OAIA 2DAEA 2LVNC 1WJ7A 2LVAA 1VEGA 1GO5A 3IECA 2QSFX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B3T A;  1E94 E;  4DBG B;  2CP8 A;  2L4F A;  1R4G A;  2O25 A;  3E46 A;  2JZ0 A;  1VQ1 A;  1IM2 A;  1VEJ A;  2DZL A;  2HAK A;  1VEK A;  2DAG A;  2WZJ A;  3IHP A;  2JY5 A;  2DEN A;  2HWJ A;  3FRH A;  2MRO B;  2MGW A;  2H5X A;  2QHO B;  2LVQ D;  2R0I A;  1OTR A;  1OQY A;  1TTE A;  2MR9 A;  1EFU B;  1P3Q Q;  3GLF E;  3GLH E;  4F1I A;  1JR3 E;  1VG5 A;  1WR1 B;  2RRU A;  2EJS A;  2K9D A;  4F2L A;  1HT2 E;  4Q7J A;  1V92 A;  1MN3 A;  1UFZ A;  1BVS A;  1T6O A;  1WGL A;  1WIV A;  1VDL A;  1YLA A;  2JUJ A;  1DO2 A;  2K0B X;  1ZV1 A;  2ZTD A;  2DNA A;  2JNH A;  4GEW A;  1KYI A;  3GLI E;  1ZMU A;  4HEO A;  2KNV A;  2KNZ A;  3BBZ A;  2MJ5 B;  2LTU A;  2OOA A;  1NV9 A;  1QZE A;  2BWE A;  1HQY E;  2EKK A;  2DAM A;  2OOB A;  2ZTC A;  1IXS A;  1DO0 A;  1G41 A;  1HT1 E;  1XXH E;  2JY7 A;  3F92 A;  2CWB A;  1CUK A;  1TR8 A;  2LVO C;  1IFY A;  2KHH A;  1OKS A;  1Q02 A;  2JP7 A;  2JZ1 A;  2DHY A;  4R71 A;  1T43 A;  4G3O A;  2L2D A;  3E21 A;  2KNA A;  1G3I A;  1SG9 A;  1WHC A;  2OO9 A;  1G4A E;  3FRI A;  3FE3 A;  1WGN A;  4UN2 B;  1NV8 A;  3B89 A;  2LBC A;  1F4I A;  3LCU A;  2DAK A;  1AIP C;  2DI0 A;  3K9O A;  1Y8G A;  1ZMV A;  2EKF A;  1A5T A;  3K9P A;  3H4J A;  3MMP A;  2DAI A;  3LCV B;  1HJP A;  2BWB A;  2L4E A;  2QNJ A;  3GLG E;  1ZMW A;  5JI2 E;  5DFL A;  2DKL A;  1DV0 A;  2JY6 B;  2LVP C;  1PGY A;  2JY8 A;  1XB2 B;  1C7Y A;  2G3Q A;  3T6P A;  4WP2 A;  1OAI A;  2DAE A;  2LVN C;  1WJ7 A;  2LVA A;  1VEG A;  1GO5 A;  3IEC A;  2QSF X; 
#chains in the Genus database with same CATH topology
 4X64 M;  1E94 E;  3U6L A;  3SFZ A;  3GPP A;  1QAM A;  3AOG A;  1E32 A;  3UK6 A;  3ZQJ A;  2QQ8 A;  4LJA A;  1R4G A;  4AW4 A;  2O25 A;  2XH9 A;  3E46 A;  4JN6 A;  3FUW A;  3HJQ A;  1E9R A;  1IM2 A;  1VEJ A;  3L28 A;  5ITT A;  1VEK A;  3KOY E;  2WZJ A;  4DV3 M;  4LF5 M;  3SMS A;  3DFZ A;  5DYG A;  1PJT A;  4KLN A;  2UXD M;  3GRU A;  3U6Q A;  3FRH A;  3DA1 A;  1HNZ M;  2MRO B;  1NNU C;  1PJQ A;  3KOW E;  4CIZ A;  2CFO A;  3GPU A;  3GRY A;  5ITX E;  4AQY M;  4OX9 M;  3QYE A;  1EFU B;  3LMM A;  5IZ7 D;  5FLX S;  3E9S A;  3GLH E;  1QDR A;  2O5R A;  3GPX A;  4MGY E;  3TPZ A;  3KXE C;  1DGF A;  2EJS A;  2UUA M;  3U61 B;  4F2L A;  2VII A;  4DR6 M;  3SYK A;  1NO1 A;  1XHB A;  3GQ5 A;  2QEN A;  4PCZ A;  4MGZ E;  4RF1 A;  3W0L B;  2C9C A;  3T1H M;  2L09 A;  1JB0 F;  3U6S A;  4B7H A;  3HU2 A;  1DGB A;  4CJ6 A;  2JUJ A;  5ITQ A;  2BJV A;  3J27 B;  2ZTD A;  3J7A S;  2DZO B;  3A42 A;  3MHV C;  4AZF A;  2DNA A;  2JNH A;  2VF8 A;  3PNV A;  4MGI E;  2UXB M;  3EIH A;  2KNV A;  4MGH A;  2M60 A;  2H1R A;  2CHV A;  2OOA A;  4CHT B;  3HHX A;  3L29 A;  3UZU A;  1IY2 A;  1D0L A;  2DVW B;  4IJF A;  4AG5 A;  2LXE A;  3M6A A;  2EKK A;  4OW0 A;  4I4L A;  4G4R A;  3D8L A;  2F5Q A;  3F92 A;  2CV1 A;  1CUK A;  3LQQ A;  2I7N A;  1OKS A;  1L1T A;  2JP7 A;  4NL4 H;  3HY5 A;  4G3O A;  3D8B A;  5IT9 S;  1L2D A;  3FTF A;  1G3I A;  3FYC A;  3VFD A;  1SXJ E;  1WHC A;  2KA6 B;  3B74 A;  3SYL A;  3TE6 A;  5H37 D;  3SAV A;  4ITQ A;  4LF9 M;  3AL0 C;  1PJS A;  3KSJ A;  3T1Y M;  3KOX E;  4NSO B;  4UN2 B;  3GRR A;  4QHS A;  4DV4 M;  1NV8 A;  3KDS E;  3B89 A;  4FVM A;  4MGK E;  3W0F A;  4DV2 M;  3GLI B;  2C98 A;  2K47 A;  2CHQ A;  1N78 A;  3K9O A;  1HR0 M;  2XSZ D;  1ZMV A;  2R44 A;  4FW9 A;  4Z6Y A;  2KXE A;  4LJ5 A;  1IN7 A;  1DGH A;  2KEB A;  2Y20 A;  3MMP A;  3PXG A;  3VLF B;  2X4A A;  3AJI B;  4G6Z A;  4W5W A;  3RFW A;  3B7Q A;  3QAU A;  2YNM D;  2ZAO A;  3HU1 A;  1SXJ D;  3BOS A;  4B7G A;  1ZMW A;  3JR5 A;  4LJ8 A;  5EJC A;  4IBE A;  5JI2 E;  3UGJ A;  3HKP A;  4CIS A;  3R9X B;  3SAW A;  1K3X A;  1QYR A;  2WSC F;  1D0M A;  3HHY A;  2C99 A;  1C7Y A;  3GPY A;  1N32 M;  4DUY M;  4B3M M;  4WP2 A;  4K0K M;  4NXN M;  3B7N A;  2VQF M;  1NHW C;  3TWL A;  1VEG A;  4JI7 M;  3C9P A;  1MJG M;  1T3T A;  3IEC A;  3U6P A;  4AG6 A;  2G5G X;  2DHR A;  5E6J A;  1IBK M;  2L4F A;  5A2Q S;  1LV7 A;  1K3W A;  3I4V A;  2JZ0 A;  4FCT A;  1VQ1 A;  1D2N A;  2XZU A;  2DZL A;  2DWM A;  3I4Y A;  4JI2 M;  3IHP A;  2JY5 A;  4LF6 M;  2K6B A;  3GLG B;  1PM5 A;  2C5R A;  2X8A A;  3TQS A;  3SAR A;  2HWJ A;  1XC8 A;  4GHL A;  4P17 A;  2F5N A;  2ZAN A;  5FTM A;  2R45 A;  3GLI A;  1IN6 A;  2XGN A;  1R2Z A;  1Q39 A;  4B7F A;  2H5X A;  3SMP A;  1Z5A A;  3L26 A;  1TH3 A;  4S12 A;  3VK7 A;  4NRV A;  4QNM A;  2KW0 A;  1OTR A;  4L16 A;  2MR9 A;  1J09 A;  1P3Q Q;  4R7G A;  4F1I A;  5F3W A;  2CV0 A;  4PD2 A;  2F4V M;  4MM3 B;  3RGS A;  1IBL M;  1WR1 B;  2RRU A;  4DV0 M;  2M5Z A;  2G8L A;  4DR1 M;  3FTE A;  2APL A;  1ZAE A;  1MN3 A;  1OIP A;  4YHH M;  3WHL A;  1E9S A;  2FFJ A;  2ZAM A;  2BJW A;  4AKI A;  3UJN A;  2CV2 A;  4LF8 M;  3AKZ A;  1VDL A;  1YLA A;  1PJI A;  4NXM M;  2K0B X;  1ZV1 A;  2D7G A;  1NVM A;  2JXN A;  4GEW A;  1N77 A;  1Z59 A;  1TF0 B;  2DWZ B;  3C3D A;  2R18 A;  1V34 A;  4NRW A;  1IN5 A;  3AV0 A;  2LTU A;  3PFI A;  1NV9 A;  4EIW A;  5C1B A;  4LJ9 A;  3LVW A;  2BWE A;  1Q3B A;  4BB9 A;  2R4E A;  2N35 A;  1N33 M;  1L8Q A;  1XMO M;  3T38 A;  2ZTC A;  4DV6 M;  4QOZ C;  2Z3X A;  1QUS A;  1HT1 E;  4B08 A;  2Z4S A;  1XXH E;  3GLH B;  3AFH A;  4JXJ A;  4RKU F;  3H4M A;  1TR8 A;  2LVO C;  1R7R A;  1XXH B;  2L7H A;  1J5E M;  2GNO A;  1Q02 A;  3GLG A;  3VKH A;  2JZ1 A;  2DHY A;  3RE8 A;  4CGY B;  3J80 S;  1IXR C;  1V33 A;  5EXT A;  3TWK A;  1MX0 A;  2OO9 A;  2UU9 M;  1G8P A;  2L7I A;  2DZN B;  2KRK A;  3FE3 A;  1TH4 A;  2FE8 A;  3HJS A;  4JI4 M;  5FTN A;  2DAK A;  1AIP C;  4ANR A;  1PJJ A;  5KO3 A;  1N36 M;  1EE8 A;  4AKH A;  2RKO A;  5FTL A;  1Y8G A;  1YUB A;  1TH2 A;  2EKF A;  5ITU A;  3A46 A;  4B3S M;  5FTK A;  4LCB A;  3VDP A;  1R5L A;  1VDD A;  3FUT A;  3H4J A;  4L6V 6;  2DAI A;  3HHW A;  4KHP M;  3TWM A;  4L8R C;  3FUV A;  3A45 A;  1HJP A;  2BWB A;  1QAN A;  4LZZ A;  1IN8 A;  1W5T A;  3ZH9 B;  4AI6 A;  1I94 M;  3HX3 A;  1IN4 A;  3UMM A;  1L1Z A;  2CEA A;  5DFL A;  1XWI A;  2KZU A;  4MH0 E;  3FUU A;  1G59 A;  2R62 A;  2KRU A;  1PGY A;  4Y28 F;  4JI1 M;  2OQ4 A;  1SXJ B;  3T15 A;  3I51 A;  4X62 M;  3MK6 A;  4LJ6 A;  3R8F A;  4JI0 M;  3T6P A;  5ITX A;  3U6E A;  3A98 B;  3CF0 A;  4DV7 M;  1GJT A;  2LVN C;  1Q3C A;  4G4Q A;  3GLH A;  1XMQ M;  3K1J A;  2P5T A;  3U61 A;  1GO5 A;  2LWX A;  1OFH A;  1XXH A;  2QSF X;  2XFS A;  2B3T A;  3QWL A;  4HEO A;  1OFI A;  3VK8 A;  2QBY B;  4JI6 M;  2J7O A;  1SXJ C;  4DBG B;  1NY6 A;  2CP8 A;  1TDZ A;  1C1K A;  4JV5 M;  4G4O A;  1J7K A;  1IXS B;  3OTO M;  1HNW M;  2HAK A;  8CAT A;  3IG5 A;  3KP0 E;  3Q8G A;  3QYB A;  4DR5 M;  3GQ3 A;  1IY1 A;  4X66 M;  3KVW A;  3W68 A;  1GAB A;  1G71 A;  4L15 A;  5FSW A;  4BBA A;  2RGH A;  1N75 A;  4GKJ M;  4Z8X A;  3KP1 E;  2MGW A;  3KS4 A;  4DR2 M;  5EP4 A;  1FNN A;  4XBO A;  2J5Y A;  4LFB M;  2VDB B;  2Z4R A;  2QHO B;  4FWG A;  2FOI C;  1OQY A;  1TTE A;  4WW0 A;  3FYD A;  3GLF E;  1FJG M;  2HKJ A;  4NC6 A;  2C96 A;  4JI3 M;  4DR7 M;  2LHG A;  1JR3 E;  1TGU A;  1VG5 A;  2X49 A;  2XSZ A;  3GRV A;  1GKI A;  2MH8 A;  3PVS A;  1NHG C;  5DYI A;  1OIZ A;  3HZJ A;  3W67 A;  2CHG A;  4GRI A;  1GJS A;  3J81 S;  1S3S A;  3HU3 A;  5BPV A;  4IBG A;  1V92 A;  1NNJ A;  4IJE A;  1UFZ A;  4FCV A;  2QPA A;  1BVS A;  4GHA A;  1K82 A;  3DZD A;  1NSF A;  1YSY A;  1QDT A;  4GC9 A;  3ZC7 B;  5EQT A;  2FNA A;  1SXJ A;  1WIV A;  3WHK A;  1XNQ M;  1DO2 A;  3K8Z A;  3GO8 A;  3Q8X A;  2C9O A;  4KOD A;  3CGW A;  4LF4 M;  1PRB A;  1I4W A;  1YE9 A;  1GLN A;  3HJ8 A;  4L4U A;  4DV5 M;  3DOA A;  1QZE A;  2QBY A;  1JR3 D;  4RF0 A;  1HQY E;  1QVR A;  2OPF A;  3L25 A;  2R6F A;  3U6D A;  4JI8 M;  3ILK A;  2DAM A;  2OOB A;  5ITY A;  3EIE A;  3NBX X;  4M0W A;  1IXS A;  1DO0 A;  5KQ8 A;  3VDU A;  2CUZ A;  4M0D A;  3C58 A;  2CWB A;  4GMQ A;  3TL4 X;  3SC3 A;  2VF7 A;  3SHG B;  2F5P A;  4R71 A;  2YFQ A;  2DXI A;  7CAT A;  2L2D A;  3E21 A;  3HGI A;  4GH9 A;  2KNA A;  5JI3 E;  1SG9 A;  3J7B A;  3FTC A;  4LJ7 A;  2RGO A;  1G4A E;  2W82 A;  4QHT A;  4REZ A;  2QCU A;  4TUW A;  2VQE M;  1N34 M;  4DV1 M;  2XZF A;  1IXZ A;  4D81 A;  4JI5 M;  4B3R M;  3HWS A;  4KO8 A;  3E4R A;  1F4I A;  2YR0 A;  5GKN A;  2ZM6 M;  5EP1 A;  4IBK A;  5KPR A;  4B3T M;  2Y0T A;  1A5T A;  3K9P A;  1IBM M;  3CTW B;  4DUZ M;  1KFV A;  3L27 A;  4WUR A;  1QUT A;  1Z6T A;  3LCV B;  2Z8Y M;  4GC5 A;  2UUB M;  1NJG A;  2WSF F;  1QAO A;  4PDI A;  5LMU M;  2J7N A;  3MJ5 A;  2L4E A;  2QNJ A;  4OU7 A;  1R2Y A;  5EP2 A;  4YY3 M;  1GVN A;  4G4N A;  2R65 A;  4GIT A;  3PNY A;  4LY6 A;  2DKL A;  4XGI A;  1DV0 A;  4IBB A;  4MB7 A;  3KFU G;  4IBJ A;  4OVZ B;  5IWA M;  3KS8 A;  1OJL A;  2LHC A;  3M7G A;  1R6B X;  2HHH M;  2D7E A;  2NQ8 C;  4P16 A;  4IBD A;  2DAE A;  2V1C A;  4PT5 A;  4X65 M;  1JQJ C;  4I8O A;  2CE7 A;  3U6C A;  2Y0Q A;  3V76 A;  2LNH C;  1WXQ A;  4LGM A;  1TDH A;  3LVV A;  1DGH B;  2XF3 A;  5LMN M;  3FTD A;  4QOS A;  4IBF A;  1XNR M;  2DAG A;  4II7 A;  3B7Z A;  2DEN A;  2A5Y B;  3LW5 F;  5L8R F;  3SBJ A;  4AKG A;  4KT0 F;  3VKG A;  1Z5C A;  2Q2E B;  1GL7 A;  4LGY A;  1QQW A;  5EXP A;  4GKK M;  3U60 B;  2R0I A;  2LVQ D;  2CRU A;  5C18 A;  2BNK A;  3SAS A;  4M9S A;  4BLC A;  2UUC M;  1EIJ A;  2AHM A;  2XLJ A;  4NOO B;  1L2B A;  2LH0 A;  3U5Z B;  2KZS A;  3KSX A;  4HL4 A;  4I5S A;  5EP3 A;  1OAO C;  4IBI A;  3SAU A;  2K9D A;  1HQC A;  1HT2 E;  4Q7J A;  5EXX A;  2DWN A;  4JYA M;  1KSF X;  4M9Z A;  1T6O A;  4D80 A;  3FUX A;  1Z5B A;  3GP1 A;  3CF2 A;  1X37 A;  2EO2 A;  1WGL A;  4LRS A;  4GIP A;  3AOE C;  4OVZ A;  5KPZ A;  2EA0 A;  3JAM S;  3GQ4 A;  1LTM A;  1AUA A;  2L6O A;  5BR8 M;  1IQP A;  1UM8 A;  1KYI A;  3THG A;  3GLI E;  4LFC M;  1ZMU A;  1RU3 A;  3FD9 A;  5DNY A;  3L2A A;  4I81 A;  2KNZ A;  1HNX M;  3J2P B;  5EXS A;  1NJF A;  1QZM A;  3BBZ A;  2MJ5 B;  2QP9 X;  3ZCB B;  2E5L M;  2D7H A;  4R3D A;  3LQR A;  2Z7J A;  4M9X A;  4LF7 M;  1GL6 A;  4A3V B;  4HLQ A;  2KDL A;  3FKE A;  3GLF B;  2HL7 A;  1G41 A;  2JY7 A;  5E26 A;  2FS1 A;  2R46 A;  2Y21 A;  1IFY A;  2KHH A;  5KPT A;  3IG8 A;  1ZQ9 A;  2HCB A;  4LJ4 A;  3SHF A;  3I01 M;  1T43 A;  2V1U A;  2EUC A;  1W5S A;  1NY5 A;  2JA2 A;  1IY0 A;  2ERC A;  2F5S A;  2R4J A;  3NBI A;  3RGP A;  1QAQ A;  2ZBK B;  3FRI A;  3U60 A;  3U6O A;  3KW6 A;  1WGN A;  4IIW A;  3CF6 E;  3B9P A;  3AOE A;  4LZJ A;  4FWD A;  2LBC A;  1DGG A;  3LCU A;  2DI0 A;  3U5Z A;  2XFT A;  2I7P A;  2V6Z M;  2XEP A;  1MU5 A;  3NWL A;  4PDG A;  2GQF A;  3JR4 A;  4FD2 A;  4LRT A;  4NSR A;  4RNA A;  5IRE B;  3BXW A;  1H6U A;  3K2L A;  2JWS A;  2UXC M;  3M0E A;  4ZPX A;  5KQD A;  4XK8 F;  3U6M A;  3SAT A;  3GLG E;  2O01 F;  2QZ4 A;  3C3E A;  5ITR A;  4DR4 M;  1D0K A;  3KOZ E;  2YQZ A;  4LFA M;  4QNR A;  2DWL A;  4FCW A;  3HHZ A;  2JY6 B;  2LVP C;  1ORY B;  2JY8 A;  1XB2 B;  4FWH A;  1L2C A;  4LG2 A;  4D82 A;  2G3Q A;  5FTJ A;  2F5O A;  3K92 A;  2WSE F;  1OAI A;  4DR3 M;  3I04 M;  3GLF A;  4L78 A;  1WJ7 A;  2LVA A;  4IBC A;  2FH0 A;  1JR3 A; 
#chains in the Genus database with same CATH homology
 2B3T A;  1E94 E;  4DBG B;  2CP8 A;  2L4F A;  1R4G A;  2O25 A;  3E46 A;  2JZ0 A;  1VQ1 A;  1IM2 A;  1VEJ A;  2DZL A;  2HAK A;  1VEK A;  2DAG A;  2WZJ A;  3IHP A;  2JY5 A;  2DEN A;  2HWJ A;  3FRH A;  2MRO B;  2MGW A;  2H5X A;  2QHO B;  2LVQ D;  2R0I A;  1OTR A;  1OQY A;  1TTE A;  2MR9 A;  1EFU B;  1P3Q Q;  3GLF E;  3GLH E;  4F1I A;  1JR3 E;  1VG5 A;  1WR1 B;  2RRU A;  2EJS A;  2K9D A;  4F2L A;  1HT2 E;  4Q7J A;  1V92 A;  1MN3 A;  1UFZ A;  1BVS A;  1T6O A;  1WGL A;  1WIV A;  1VDL A;  1YLA A;  2JUJ A;  1DO2 A;  2K0B X;  1ZV1 A;  2ZTD A;  2DNA A;  2JNH A;  4GEW A;  1KYI A;  3GLI E;  1ZMU A;  4HEO A;  2KNV A;  2KNZ A;  3BBZ A;  2MJ5 B;  2LTU A;  2OOA A;  1NV9 A;  1QZE A;  2BWE A;  1HQY E;  2EKK A;  2DAM A;  2OOB A;  2ZTC A;  1IXS A;  1DO0 A;  1G41 A;  1HT1 E;  1XXH E;  2JY7 A;  3F92 A;  2CWB A;  1CUK A;  1TR8 A;  2LVO C;  1IFY A;  2KHH A;  1OKS A;  1Q02 A;  2JP7 A;  2JZ1 A;  2DHY A;  4R71 A;  1T43 A;  4G3O A;  2L2D A;  3E21 A;  2KNA A;  1G3I A;  1SG9 A;  1WHC A;  2OO9 A;  1G4A E;  3FRI A;  3FE3 A;  1WGN A;  4UN2 B;  1NV8 A;  3B89 A;  2LBC A;  1F4I A;  3LCU A;  2DAK A;  1AIP C;  2DI0 A;  3K9O A;  1Y8G A;  1ZMV A;  2EKF A;  1A5T A;  3K9P A;  3H4J A;  3MMP A;  2DAI A;  3LCV B;  1HJP A;  2BWB A;  2L4E A;  2QNJ A;  3GLG E;  1ZMW A;  5JI2 E;  5DFL A;  2DKL A;  1DV0 A;  2JY6 B;  2LVP C;  1PGY A;  2JY8 A;  1XB2 B;  1C7Y A;  2G3Q A;  3T6P A;  4WP2 A;  1OAI A;  2DAE A;  2LVN C;  1WJ7 A;  2LVA A;  1VEG A;  1GO5 A;  3IEC A;  2QSF X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...