2JP7A

Nmr structure of the mex67 uba domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
57
structure length
57
Chain Sequence
RLNPVQLELLNKLHLETKLNAEYTFMLAEQSNWNYEVAIKGFQSSMNGIPREAFVQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Coordination of Hpr1 and ubiquitin binding by the UBA domain of the mRNA export factor Mex67
pubmed doi rcsb
molecule keywords mRNA export factor MEX67
molecule tags Translation
source organism Saccharomyces cerevisiae
total genus 17
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2007-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jp7A00
2OOAA 2EKFA 1VEKA 3MMPA 2DENA 1WGLA 1DO2A 2LVPC 3GLFE 3T6PA 2WZJA 2MJ5B 2QSFX 2L4EA 2LVAA 1ZMUA 4F1IA 1XB2B 2HWJA 1AIPC 2DAMA 1HT1E 1ZV1A 2LVOC 1OAIA 2BWBA 2MROB 2JZ0A 2MGWA 1F4IA 2KHHA 2LBCA 2QNJA 1DO0A 1HT2E 1TR8A 1WJ7A 1HQYE 2K9DA 2BWEA 2B3TA 2R0IA 1GO5A 4Q7JA 1T6OA 2RRUA 2HAKA 1UFZA 1BVSA 1E94E 2JP7A 1NV8A 3FRHA 1CUKA 2JY7A 4GEWA 3FE3A 5JI2E 5DFLA 2LVQD 1WIVA 3H4JA 2DZLA 2DAEA 2DAIA 2JY5A 1IXSA 1G3IA 2DNAA 1QZEA 1DV0A 2DAKA 1T43A 4F2LA 1R4GA 1VQ1A 2CWBA 3LCVB 2KNZA 2DHYA 3F92A 2ZTDA 1V92A 2KNAA 2KNVA 1NV9A 2EJSA 3E46A 3K9PA 1JR3E 2LTUA 3IHPA 2DAGA 2QHOB 1WGNA 3GLIE 2OO9A 1ZMVA 1WHCA 3E21A 2CP8A 1KYIA 1Y8GA 1MN3A 3B89A 1VG5A 1ZMWA 1Q02A 2JUJA 2DKLA 1G4AE 2L4FA 4WP2A 1VEJA 2JY8A 3GLHE 2ZTCA 4G3OA 2MR9A 4UN2B 1OKSA 1XXHE 3BBZA 1G41A 1OQYA 2EKKA 2JY6B 3GLGE 1PGYA 1C7YA 1TTEA 1EFUB 1VDLA 1HJPA 2DI0A 3IECA 2K0BX 2LVNC 1A5TA 2JZ1A 2OOBA 3FRIA 1IFYA 4HEOA 2G3QA 1IM2A 2JNHA 2L2DA 1YLAA 4R71A 1WR1B 1SG9A 3K9OA 2H5XA 3LCUA 4DBGB 1OTRA 1VEGA 1P3QQ 2O25A
chains in the Genus database with same CATH superfamily
2CHQA 4AKHA 3U61B 2OOAA 1KFVA 3GRUA 3AKZA 5GKNA 3L27A 3MMPA 2QQ8A 4L6V6 4JV5M 1WGLA 4ANRA 1IN6A 2F5OA 3KW6A 1MJGM 3GLFE 4GHAA 1GLNA 2UXBM 1MU5A 2WZJA 3W67A 2L4EA 3L29A 1L2DA 5KPTA 3PNVA 2C98A 3U6EA 1TDZA 1ZMUA 4DR4M 1TH4A 1PJJA 4AI6A 5FTMA 5ITUA 3B7NA 1KSFX 2F5SA 2A5YB 4B3MM 4LFBM 4PT5A 2R4JA 2UUCM 2JZ0A 5DYIA 2G8LA 2ZAOA 2CRUA 4LG2A 3I4VA 3GLFA 3ZCBB 3L26A 1WJ7A 2CHGA 1QUTA 1E32A 1QZMA 1QAQA 2B3TA 1WXQA 2R0IA 1IQPA 2JXNA 1GO5A 2D7EA 4BBAA 3HJQA 2O01F 4Q7JA 2XZFA 1L8QA 2ERCA 2I7NA 2R18A 2R45A 3A46A 1UFZA 1BVSA 2JP7A 1NV8A 3SHGB 3GO8A 1L2CA 3VDPA 3U6LA 4LJAA 2DXIA 2VF7A 3M6AA 5FTJA 4REZA 4I5SA 1QUSA 2LVQD 2XFTA 3FYDA 5DFLA 4PD2A 3GP1A 2DZLA 4JI6M 4GKKM 4XBOA 3VDUA 3FKEA 1NJFA 1T43A 3GPYA 3U6PA 3NBIA 1VQ1A 1ORYB 3FTDA 4LJ6A 4CIZA 4AZFA 3I51A 2KNZA 3F92A 2F5PA 4LF8M 1AUAA 3AJIB 1PJQA 2KNAA 4JI8M 2LHGA 1N77A 2JWSA 2CHVA 2DWZB 1V34A 4X65M 4KHPM 2XGNA 2W82A 2FE8A 1N33M 1WHCA 1NHGC 3E21A 4LFAM 1VG5A 1ZMWA 3I04M 3HHWA 2L4FA 4DR3M 4WP2A 1V33A 5JI3E 1Z6TA 5EXPA 1RU3A 2WSCF 5DNYA 2HL7A 3GLGB 4QNRA 3TE6A 1ZQ9A 1Z5CA 3UGJA 5EP1A 2ZM6M 2V6ZM 4HLQA 3K2LA 1DGFA 3GLGE 1XMOM 2UXCM 8CATA 4CJ6A 1HQCA 1PGYA 2RGHA 4DV4M 3PFIA 3GQ4A 1EFUB 1QDRA 4AQYM 3M0EA 2DI0A 2WSEF 3IECA 4B7GA 3HHZA 2FS1A 1A5TA 1GL6A 2D7GA 1SXJB 4FCTA 3K1JA 2YQZA 1YLAA 1WR1B 1NVMA 3SFZA 1W5SA 5A2QS 5ITXE 1SXJE 3R9XB 3NWLA 3GLGA 1IBLM 3LW5F 4DBGB 3HU1A 2GQFA 2KRUA 2F5NA 5EP3A 1P3QQ 2UU9M 3E9SA 2BJWA 2EKFA 2QBYB 1VEKA 1E9RA 3CTWB 4IBGA 4IBDA 1QAMA 1NSFA 2DENA 4M0WA 1DO2A 2LVPC 3UJNA 1LTMA 4D80A 1NNJA 1IBMM 3DOAA 3KS4A 3SYLA 2MJ5B 1DGBA 4D82A 4RF0A 3W68A 4ITQA 2LVAA 3K8ZA 4WURA 1QYRA 2L6OA 3RE8A 3TWMA 3U6DA 4IJEA 3GRYA 1SXJA 4RNAA 3SAWA 1I94M 1AIPC 2Y0QA 7CATA 2DAMA 3I4YA 2BJVA 4B3SM 2GNOA 1OFHA 1QAOA 3VFDA 5KO3A 1OIPA 3J27B 1OAIA 1R5LA 3SHFA 5C1BA 4YY3M 1HNWM 2C9CA 2R44A 1W5TA 2KHHA 1F4IA 1IN7A 2QNJA 4LGYA 3GQ5A 1IXRC 3PXGA 4PDGA 1N32M 4DR2M 3LQQA 5EXSA 3C9PA 4DR5M 2YFQA 3EIHA 2BWEA 2HCBA 4FCWA 4MH0E 2Z3XA 2C5RA 4YHHM 4JN6A 5DYGA 4M9SA 2RRUA 3WHLA 4OW0A 3AFHA 3FUTA 1UM8A 3THGA 1CUKA 2JY7A 4GEWA 1IY1A 5EJCA 3J7BA 3SMPA 4IBFA 3HJSA 2DAIA 2JY5A 3PVSA 1IXSA 2DNAA 4NL4H 1QZEA 4R7GA 4B7HA 4X62M 5BR8M 2DAKA 3FTFA 3HGIA 2QP9X 4F2LA 4GC9A 3LVWA 4OVZB 1IY2A 1OFIA 3OTOM 1Z5AA 4M9ZA 3GQ3A 1N36M 2V1UA 3U61A 4B3RM 5IZ7D 4NXNM 1XNQM 1Q3BA 3GLIB 3A45A 1XC8A 4D81A 2Z4RA 1D2NA 5E26A 2WSFF 3JR4A 4HL4A 4X66M 1NY5A 1WGNA 4JI5M 1E9SA 3GLIE 5LMUM 2C99A 4L4UA 4IBEA 4WW0A 4DR7M 2LWXA 1G8PA 2QCUA 4RF1A 1Q02A 2DKLA 4FWHA 4IBBA 1QDTA 2ZANA 3LVVA 4DV2M 3KSJA 4NXMM 4DV1M 3FUWA 3AOEA 4G3OA 3TWLA 1TF0B 3LMMA 4KO8A 4DR1M 1N34M 3E4RA 1Q39A 3CGWA 2V1CA 1OKSA 4RKUF 3JAMS 3U6OA 4OVZA 3T1YM 4LJ9A 2KXEA 2JY6B 2F4VM 4FVMA 3T38A 1K3WA 3L28A 2DWNA 2UUBM 4JI4M 2L7IA 1QVRA 1C7YA 1TTEA 2VIIA 3EIEA 3WHKA 2O5RA 4CHTB 3VKHA 2RKOA 1VDLA 3ZH9B 2CV0A 2J7NA 4LF6M 2KEBA 3KP1E 4B08A 3TL4X 3FRIA 4LJ7A 2K47A 1J5EM 1J7KA 3A98B 1YUBA 2G3QA 2CEAA 5FTNA 4QOSA 3H4MA 5EQTA 2JNHA 2VF8A 1L1ZA 4CISA 4I81A 5LMNM 1GKIA 1D0KA 2DWMA 2LXEA 4Z8XA 1SG9A 3K9OA 4LF9M 3LCUA 2DVWB 3GPUA 3KFUG 1HNZM 3J2PB 4L8RC 1XNRM 1NJGA 4II7A 3SMSA 1GJSA 2KZUA 2JUJA 1S3SA 4PDIA 3RGSA 2Q2EB 1DGGA 4AW4A 3HZJA 4FWGA 4LJ4A 2YNMD 2UXDM 2CV2A 3ILKA 3SASA 2QSFX 4GMQA 4MM3B 4I8OA 3GRVA 3KOZE 4QHSA 3SAUA 2APLA 2VDBB 2K6BA 3QYEA 2M60A 1TH2A 4L16A 2HWJA 4NRVA 1K3XA 3TPZA 4M0DA 1HT1E 4QOZC 2KW0A 3HHYA 5H37D 2AHMA 1I4WA 4GKJM 1HR0M 1JR3D 2MROB 4IIWA 5EP4A 2XEPA 3B74A 4JI0M 1DO0A 1TR8A 3TQSA 1ZAEA 1GABA 4NSRA 4Y28F 1R2ZA 3U60B 5ITRA 2KZSA 2YR0A 2N35A 2R62A 2QENA 5FLXS 4IBIA 3LQRA 2HAKA 4JI1M 1C1KA 3SAVA 2KDLA 1E94E 1R7RA 4AKIA 4LGMA 3HKPA 2FOIC 4IJFA 4NC6A 1LV7A 3FD9A 3SC3A 5ITXA 4PCZA 4IBKA 4P17A 3CF0A 4XGIA 3AL0C 3H4JA 3HU3A 1IXZA 2DAEA 4JXJA 4KLNA 1G3IA 2EO2A 2XFSA 3UK6A 3HHXA 3FUXA 4DV0M 3U6QA 2XSZA 3IG5A 1D0MA 1DGHB 1R4GA 1D0LA 2X4AA 2ZBKB 4NOOB 2R65A 5ITTA 4LFCM 2XH9A 3T1HM 3U5ZB 5KPRA 3TWKA 3HWSA 4OU7A 4G4OA 3C3DA 4MGIE 2DHYA 4AKGA 2ZTDA 3U60A 2QBYA 3FTEA 2KNVA 1NV9A 2Z8YM 1YE9A 5C18A 4P16A 3K9PA 2LTUA 4QNMA 3BXWA 4IBCA 5KQDA 3IHPA 3L25A 3T15A 3GPPA 3NBXX 1PRBA 2OO9A 1KYIA 1Y8GA 1L2BA 3B89A 5BPVA 1N75A 4GIPA 3KOWE 1IN4A 4A3VB 2EUCA 4EIWA 2JY8A 3CF6E 4FD2A 1PJSA 4BLCA 5FTLA 3Q8GA 4MB7A 3Q8XA 3GLFB 1DGHA 2L09A 1IY0A 4G6ZA 3U5ZA 3C58A 2XLJA 2EKKA 3J80S 4GH9A 4LCBA 1PJIA 1G59A 1J09A 4LJ8A 1JQJC 2HKJA 3FUUA 3AOGA 4IBJA 3A42A 1QQWA 1H6UA 1HJPA 2K0BX 2FH0A 2JZ1A 2OOBA 3QYBA 1IFYA 4JI3M 2KRKA 1FNNA 1IM2A 3KOXE 1R6BX 5E6JA 1PM5A 3VKGA 1QANA 4DUYM 2XZUA 3HU2A 2CV1A 5IT9S 2L2DA 3KVWA 2DZNB 2Y0TA 1R2YA 4NSOB 4GC5A 4DUZM 5IREB 4G4NA 2BNKA 1IN5A 2Y20A 3IG8A 4FCVA 1OTRA 2QPAA 5KPZA 4TUWA 4AG6A 2R46A 3SATA 2H1RA 1XWIA 5FTKA 2VQFM 4CGYB 2HHHM 3FTCA 4R3DA 4DV7M 4JYAM 2I7PA 4GRIA 1EE8A 1OIZA 3GLIA 4JI7M 1XHBA 3DZDA 3T6PA 1XMQM 2CUZA 3VK8A 4DV6M 3VK7A 4M9XA 2DHRA 3KS8A 2UUAM 1Z5BA 4W5WA 3J7AS 2FNAA 5ITQA 2E5LM 1OAOC 4F1IA 1XB2B 3KSXA 3L2AA 2RGOA 1ZV1A 4G4RA 1Z59A 1PJTA 4LF4M 1EIJA 2LVOC 3HJ8A 2BWBA 4FW9A 1TDHA 4MGZE 2MGWA 5EXXA 3MHVC 2CE7A 2LBCA 2LHCA 2FFJA 2DWLA 1MX0A 3KDSE 1GVNA 4L78A 2X49A 1HT2E 2LNHC 4LZZA 3KOYE 4MGHA 3C3EA 1HQYE 2C96A 1TGUA 1FJGM 2K9DA 1GJTA 3W0LB 1K82A 2D7HA 3ZC7B 2J7OA 4OX9M 2Y21A 4NRWA 2C9OA 2P5TA 4GITA 1T6OA 1NNUC 1SXJC 1G71A 2ZAMA 3U6SA 3GPXA 4MGYE 3UZUA 3SARA 3FRHA 1IBKM 4AG5A 4L15A 2F5QA 4B3TM 3D8LA 3FE3A 5JI2E 3KXEC 3ZQJA 3CF2A 1WIVA 4QHTA 3D8BA 2EA0A 4LY6A 4X64M 3K92A 2VQEM 3HY5A 1T3TA 4LRTA 2LH0A 2OPFA 4B7FA 3V76A 3JR5A 2R4EA 2X8AA 3B9PA 3BOSA 4LF7M 2CWBA 4XK8F 3LCVB 3KP0E 1NO1A 3QWLA 1YSYA 4ZPXA 2J5YA 1V92A 3R8FA 5EXTA 3SBJA 2EJSA 3E46A 1JR3E 2KA6B 3J81S 2G5GX 4LRSA 3RFWA 1SXJD 2DAGA 2DZOB 2QHOB 2Z4SA 1VDDA 1X37A 3B7QA 3DFZA 4DV3M 1ZMVA 2CP8A 5KQ8A 2NQ8C 1HNXM 1IN8A 3GLHB 3MJ5A 1N78A 1MN3A 5EP2A 3FUVA 2XSZD 4KODA 4DR6M 2XF3A 1DV0A 1G4AE 3MK6A 1GL7A 4Z6YA 1XXHB 1VEJA 1TH3A 1JB0F 3GLHE 5L8RF 2ZTCA 4MGKE 3U6CA 2MR9A 5F3WA 4LF5M 4DV5M 2OQ4A 1NHWC 1L1TA 2R6FA 3W0FA 5IWAM 3AV0A 4UN2B 3UMMA 4K0KM 1XXHE 3BBZA 1G41A 3U6MA 1JR3A 1OJLA 1OQYA 4KT0F 2Z7JA 3I01M 2M5ZA 3PNYA 4GHLA 4LJ5A 4FWDA 2L7HA 2LVNC 3RGPA 3HX3A 2MH8A 3VLFB 4HEOA 4G4QA 3GRRA 3GLHA 3SYKA 2CFOA 3AOEC 1Q3CA 2QZ4A 3DA1A 3QAUA 4JI2M 4BB9A 3FYCA 4R71A 3B7ZA 1IXSB 1XXHA 5ITYA 4I4LA 5FSWA 2H5XA 3M7GA 1NY6A 2JA2A 4LZJA 4S12A 1VEGA 2O25A
chains in the Genus database with same CATH topology
2OOAA 2EKFA 1VEKA 3MMPA 2DENA 1WGLA 1DO2A 2LVPC 3GLFE 3T6PA 2WZJA 2MJ5B 2QSFX 2L4EA 2LVAA 1ZMUA 4F1IA 1XB2B 2HWJA 1AIPC 2DAMA 1HT1E 1ZV1A 2LVOC 1OAIA 2BWBA 2MROB 2JZ0A 2MGWA 1F4IA 2KHHA 2LBCA 2QNJA 1DO0A 1HT2E 1TR8A 1WJ7A 1HQYE 2K9DA 2BWEA 2B3TA 2R0IA 1GO5A 4Q7JA 1T6OA 2RRUA 2HAKA 1UFZA 1BVSA 1E94E 2JP7A 1NV8A 3FRHA 1CUKA 2JY7A 4GEWA 3FE3A 5JI2E 5DFLA 2LVQD 1WIVA 3H4JA 2DZLA 2DAEA 2DAIA 2JY5A 1IXSA 1G3IA 2DNAA 1QZEA 1DV0A 2DAKA 1T43A 4F2LA 1R4GA 1VQ1A 2CWBA 3LCVB 2KNZA 2DHYA 3F92A 2ZTDA 1V92A 2KNAA 2KNVA 1NV9A 2EJSA 3E46A 3K9PA 1JR3E 2LTUA 3IHPA 2DAGA 2QHOB 1WGNA 3GLIE 2OO9A 1ZMVA 1WHCA 3E21A 2CP8A 1KYIA 1Y8GA 1MN3A 3B89A 1VG5A 1ZMWA 1Q02A 2JUJA 2DKLA 1G4AE 2L4FA 4WP2A 1VEJA 2JY8A 3GLHE 2ZTCA 4G3OA 2MR9A 4UN2B 1OKSA 1XXHE 3BBZA 1G41A 1OQYA 2EKKA 2JY6B 3GLGE 1PGYA 1C7YA 1TTEA 1EFUB 1VDLA 1HJPA 2DI0A 3IECA 2K0BX 2LVNC 1A5TA 2JZ1A 2OOBA 3FRIA 1IFYA 4HEOA 2G3QA 1IM2A 2JNHA 2L2DA 1YLAA 4R71A 1WR1B 1SG9A 3K9OA 2H5XA 3LCUA 4DBGB 1OTRA 1VEGA 1P3QQ 2O25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OOA A;  2EKF A;  1VEK A;  3MMP A;  2DEN A;  1WGL A;  1DO2 A;  2LVP C;  3GLF E;  3T6P A;  2WZJ A;  2MJ5 B;  2QSF X;  2L4E A;  2LVA A;  1ZMU A;  4F1I A;  1XB2 B;  2HWJ A;  1AIP C;  2DAM A;  1HT1 E;  1ZV1 A;  2LVO C;  1OAI A;  2BWB A;  2MRO B;  2JZ0 A;  2MGW A;  1F4I A;  2KHH A;  2LBC A;  2QNJ A;  1DO0 A;  1HT2 E;  1TR8 A;  1WJ7 A;  1HQY E;  2K9D A;  2BWE A;  2B3T A;  2R0I A;  1GO5 A;  4Q7J A;  1T6O A;  2RRU A;  2HAK A;  1UFZ A;  1BVS A;  1E94 E;  2JP7 A;  1NV8 A;  3FRH A;  1CUK A;  2JY7 A;  4GEW A;  3FE3 A;  5JI2 E;  5DFL A;  2LVQ D;  1WIV A;  3H4J A;  2DZL A;  2DAE A;  2DAI A;  2JY5 A;  1IXS A;  1G3I A;  2DNA A;  1QZE A;  1DV0 A;  2DAK A;  1T43 A;  4F2L A;  1R4G A;  1VQ1 A;  2CWB A;  3LCV B;  2KNZ A;  2DHY A;  3F92 A;  2ZTD A;  1V92 A;  2KNA A;  2KNV A;  1NV9 A;  2EJS A;  3E46 A;  3K9P A;  1JR3 E;  2LTU A;  3IHP A;  2DAG A;  2QHO B;  1WGN A;  3GLI E;  2OO9 A;  1ZMV A;  1WHC A;  3E21 A;  2CP8 A;  1KYI A;  1Y8G A;  1MN3 A;  3B89 A;  1VG5 A;  1ZMW A;  1Q02 A;  2JUJ A;  2DKL A;  1G4A E;  2L4F A;  4WP2 A;  1VEJ A;  2JY8 A;  3GLH E;  2ZTC A;  4G3O A;  2MR9 A;  4UN2 B;  1OKS A;  1XXH E;  3BBZ A;  1G41 A;  1OQY A;  2EKK A;  2JY6 B;  3GLG E;  1PGY A;  1C7Y A;  1TTE A;  1EFU B;  1VDL A;  1HJP A;  2DI0 A;  3IEC A;  2K0B X;  2LVN C;  1A5T A;  2JZ1 A;  2OOB A;  3FRI A;  1IFY A;  4HEO A;  2G3Q A;  1IM2 A;  2JNH A;  2L2D A;  1YLA A;  4R71 A;  1WR1 B;  1SG9 A;  3K9O A;  2H5X A;  3LCU A;  4DBG B;  1OTR A;  1VEG A;  1P3Q Q;  2O25 A; 
#chains in the Genus database with same CATH topology
 2CHQ A;  4AKH A;  3U61 B;  2OOA A;  1KFV A;  3GRU A;  3AKZ A;  5GKN A;  3L27 A;  3MMP A;  2QQ8 A;  4L6V 6;  4JV5 M;  1WGL A;  4ANR A;  1IN6 A;  2F5O A;  3KW6 A;  1MJG M;  3GLF E;  4GHA A;  1GLN A;  2UXB M;  1MU5 A;  2WZJ A;  3W67 A;  2L4E A;  3L29 A;  1L2D A;  5KPT A;  3PNV A;  2C98 A;  3U6E A;  1TDZ A;  1ZMU A;  4DR4 M;  1TH4 A;  1PJJ A;  4AI6 A;  5FTM A;  5ITU A;  3B7N A;  1KSF X;  2F5S A;  2A5Y B;  4B3M M;  4LFB M;  4PT5 A;  2R4J A;  2UUC M;  2JZ0 A;  5DYI A;  2G8L A;  2ZAO A;  2CRU A;  4LG2 A;  3I4V A;  3GLF A;  3ZCB B;  3L26 A;  1WJ7 A;  2CHG A;  1QUT A;  1E32 A;  1QZM A;  1QAQ A;  2B3T A;  1WXQ A;  2R0I A;  1IQP A;  2JXN A;  1GO5 A;  2D7E A;  4BBA A;  3HJQ A;  2O01 F;  4Q7J A;  2XZF A;  1L8Q A;  2ERC A;  2I7N A;  2R18 A;  2R45 A;  3A46 A;  1UFZ A;  1BVS A;  2JP7 A;  1NV8 A;  3SHG B;  3GO8 A;  1L2C A;  3VDP A;  3U6L A;  4LJA A;  2DXI A;  2VF7 A;  3M6A A;  5FTJ A;  4REZ A;  4I5S A;  1QUS A;  2LVQ D;  2XFT A;  3FYD A;  5DFL A;  4PD2 A;  3GP1 A;  2DZL A;  4JI6 M;  4GKK M;  4XBO A;  3VDU A;  3FKE A;  1NJF A;  1T43 A;  3GPY A;  3U6P A;  3NBI A;  1VQ1 A;  1ORY B;  3FTD A;  4LJ6 A;  4CIZ A;  4AZF A;  3I51 A;  2KNZ A;  3F92 A;  2F5P A;  4LF8 M;  1AUA A;  3AJI B;  1PJQ A;  2KNA A;  4JI8 M;  2LHG A;  1N77 A;  2JWS A;  2CHV A;  2DWZ B;  1V34 A;  4X65 M;  4KHP M;  2XGN A;  2W82 A;  2FE8 A;  1N33 M;  1WHC A;  1NHG C;  3E21 A;  4LFA M;  1VG5 A;  1ZMW A;  3I04 M;  3HHW A;  2L4F A;  4DR3 M;  4WP2 A;  1V33 A;  5JI3 E;  1Z6T A;  5EXP A;  1RU3 A;  2WSC F;  5DNY A;  2HL7 A;  3GLG B;  4QNR A;  3TE6 A;  1ZQ9 A;  1Z5C A;  3UGJ A;  5EP1 A;  2ZM6 M;  2V6Z M;  4HLQ A;  3K2L A;  1DGF A;  3GLG E;  1XMO M;  2UXC M;  8CAT A;  4CJ6 A;  1HQC A;  1PGY A;  2RGH A;  4DV4 M;  3PFI A;  3GQ4 A;  1EFU B;  1QDR A;  4AQY M;  3M0E A;  2DI0 A;  2WSE F;  3IEC A;  4B7G A;  3HHZ A;  2FS1 A;  1A5T A;  1GL6 A;  2D7G A;  1SXJ B;  4FCT A;  3K1J A;  2YQZ A;  1YLA A;  1WR1 B;  1NVM A;  3SFZ A;  1W5S A;  5A2Q S;  5ITX E;  1SXJ E;  3R9X B;  3NWL A;  3GLG A;  1IBL M;  3LW5 F;  4DBG B;  3HU1 A;  2GQF A;  2KRU A;  2F5N A;  5EP3 A;  1P3Q Q;  2UU9 M;  3E9S A;  2BJW A;  2EKF A;  2QBY B;  1VEK A;  1E9R A;  3CTW B;  4IBG A;  4IBD A;  1QAM A;  1NSF A;  2DEN A;  4M0W A;  1DO2 A;  2LVP C;  3UJN A;  1LTM A;  4D80 A;  1NNJ A;  1IBM M;  3DOA A;  3KS4 A;  3SYL A;  2MJ5 B;  1DGB A;  4D82 A;  4RF0 A;  3W68 A;  4ITQ A;  2LVA A;  3K8Z A;  4WUR A;  1QYR A;  2L6O A;  3RE8 A;  3TWM A;  3U6D A;  4IJE A;  3GRY A;  1SXJ A;  4RNA A;  3SAW A;  1I94 M;  1AIP C;  2Y0Q A;  7CAT A;  2DAM A;  3I4Y A;  2BJV A;  4B3S M;  2GNO A;  1OFH A;  1QAO A;  3VFD A;  5KO3 A;  1OIP A;  3J27 B;  1OAI A;  1R5L A;  3SHF A;  5C1B A;  4YY3 M;  1HNW M;  2C9C A;  2R44 A;  1W5T A;  2KHH A;  1F4I A;  1IN7 A;  2QNJ A;  4LGY A;  3GQ5 A;  1IXR C;  3PXG A;  4PDG A;  1N32 M;  4DR2 M;  3LQQ A;  5EXS A;  3C9P A;  4DR5 M;  2YFQ A;  3EIH A;  2BWE A;  2HCB A;  4FCW A;  4MH0 E;  2Z3X A;  2C5R A;  4YHH M;  4JN6 A;  5DYG A;  4M9S A;  2RRU A;  3WHL A;  4OW0 A;  3AFH A;  3FUT A;  1UM8 A;  3THG A;  1CUK A;  2JY7 A;  4GEW A;  1IY1 A;  5EJC A;  3J7B A;  3SMP A;  4IBF A;  3HJS A;  2DAI A;  2JY5 A;  3PVS A;  1IXS A;  2DNA A;  4NL4 H;  1QZE A;  4R7G A;  4B7H A;  4X62 M;  5BR8 M;  2DAK A;  3FTF A;  3HGI A;  2QP9 X;  4F2L A;  4GC9 A;  3LVW A;  4OVZ B;  1IY2 A;  1OFI A;  3OTO M;  1Z5A A;  4M9Z A;  3GQ3 A;  1N36 M;  2V1U A;  3U61 A;  4B3R M;  5IZ7 D;  4NXN M;  1XNQ M;  1Q3B A;  3GLI B;  3A45 A;  1XC8 A;  4D81 A;  2Z4R A;  1D2N A;  5E26 A;  2WSF F;  3JR4 A;  4HL4 A;  4X66 M;  1NY5 A;  1WGN A;  4JI5 M;  1E9S A;  3GLI E;  5LMU M;  2C99 A;  4L4U A;  4IBE A;  4WW0 A;  4DR7 M;  2LWX A;  1G8P A;  2QCU A;  4RF1 A;  1Q02 A;  2DKL A;  4FWH A;  4IBB A;  1QDT A;  2ZAN A;  3LVV A;  4DV2 M;  3KSJ A;  4NXM M;  4DV1 M;  3FUW A;  3AOE A;  4G3O A;  3TWL A;  1TF0 B;  3LMM A;  4KO8 A;  4DR1 M;  1N34 M;  3E4R A;  1Q39 A;  3CGW A;  2V1C A;  1OKS A;  4RKU F;  3JAM S;  3U6O A;  4OVZ A;  3T1Y M;  4LJ9 A;  2KXE A;  2JY6 B;  2F4V M;  4FVM A;  3T38 A;  1K3W A;  3L28 A;  2DWN A;  2UUB M;  4JI4 M;  2L7I A;  1QVR A;  1C7Y A;  1TTE A;  2VII A;  3EIE A;  3WHK A;  2O5R A;  4CHT B;  3VKH A;  2RKO A;  1VDL A;  3ZH9 B;  2CV0 A;  2J7N A;  4LF6 M;  2KEB A;  3KP1 E;  4B08 A;  3TL4 X;  3FRI A;  4LJ7 A;  2K47 A;  1J5E M;  1J7K A;  3A98 B;  1YUB A;  2G3Q A;  2CEA A;  5FTN A;  4QOS A;  3H4M A;  5EQT A;  2JNH A;  2VF8 A;  1L1Z A;  4CIS A;  4I81 A;  5LMN M;  1GKI A;  1D0K A;  2DWM A;  2LXE A;  4Z8X A;  1SG9 A;  3K9O A;  4LF9 M;  3LCU A;  2DVW B;  3GPU A;  3KFU G;  1HNZ M;  3J2P B;  4L8R C;  1XNR M;  1NJG A;  4II7 A;  3SMS A;  1GJS A;  2KZU A;  2JUJ A;  1S3S A;  4PDI A;  3RGS A;  2Q2E B;  1DGG A;  4AW4 A;  3HZJ A;  4FWG A;  4LJ4 A;  2YNM D;  2UXD M;  2CV2 A;  3ILK A;  3SAS A;  2QSF X;  4GMQ A;  4MM3 B;  4I8O A;  3GRV A;  3KOZ E;  4QHS A;  3SAU A;  2APL A;  2VDB B;  2K6B A;  3QYE A;  2M60 A;  1TH2 A;  4L16 A;  2HWJ A;  4NRV A;  1K3X A;  3TPZ A;  4M0D A;  1HT1 E;  4QOZ C;  2KW0 A;  3HHY A;  5H37 D;  2AHM A;  1I4W A;  4GKJ M;  1HR0 M;  1JR3 D;  2MRO B;  4IIW A;  5EP4 A;  2XEP A;  3B74 A;  4JI0 M;  1DO0 A;  1TR8 A;  3TQS A;  1ZAE A;  1GAB A;  4NSR A;  4Y28 F;  1R2Z A;  3U60 B;  5ITR A;  2KZS A;  2YR0 A;  2N35 A;  2R62 A;  2QEN A;  5FLX S;  4IBI A;  3LQR A;  2HAK A;  4JI1 M;  1C1K A;  3SAV A;  2KDL A;  1E94 E;  1R7R A;  4AKI A;  4LGM A;  3HKP A;  2FOI C;  4IJF A;  4NC6 A;  1LV7 A;  3FD9 A;  3SC3 A;  5ITX A;  4PCZ A;  4IBK A;  4P17 A;  3CF0 A;  4XGI A;  3AL0 C;  3H4J A;  3HU3 A;  1IXZ A;  2DAE A;  4JXJ A;  4KLN A;  1G3I A;  2EO2 A;  2XFS A;  3UK6 A;  3HHX A;  3FUX A;  4DV0 M;  3U6Q A;  2XSZ A;  3IG5 A;  1D0M A;  1DGH B;  1R4G A;  1D0L A;  2X4A A;  2ZBK B;  4NOO B;  2R65 A;  5ITT A;  4LFC M;  2XH9 A;  3T1H M;  3U5Z B;  5KPR A;  3TWK A;  3HWS A;  4OU7 A;  4G4O A;  3C3D A;  4MGI E;  2DHY A;  4AKG A;  2ZTD A;  3U60 A;  2QBY A;  3FTE A;  2KNV A;  1NV9 A;  2Z8Y M;  1YE9 A;  5C18 A;  4P16 A;  3K9P A;  2LTU A;  4QNM A;  3BXW A;  4IBC A;  5KQD A;  3IHP A;  3L25 A;  3T15 A;  3GPP A;  3NBX X;  1PRB A;  2OO9 A;  1KYI A;  1Y8G A;  1L2B A;  3B89 A;  5BPV A;  1N75 A;  4GIP A;  3KOW E;  1IN4 A;  4A3V B;  2EUC A;  4EIW A;  2JY8 A;  3CF6 E;  4FD2 A;  1PJS A;  4BLC A;  5FTL A;  3Q8G A;  4MB7 A;  3Q8X A;  3GLF B;  1DGH A;  2L09 A;  1IY0 A;  4G6Z A;  3U5Z A;  3C58 A;  2XLJ A;  2EKK A;  3J80 S;  4GH9 A;  4LCB A;  1PJI A;  1G59 A;  1J09 A;  4LJ8 A;  1JQJ C;  2HKJ A;  3FUU A;  3AOG A;  4IBJ A;  3A42 A;  1QQW A;  1H6U A;  1HJP A;  2K0B X;  2FH0 A;  2JZ1 A;  2OOB A;  3QYB A;  1IFY A;  4JI3 M;  2KRK A;  1FNN A;  1IM2 A;  3KOX E;  1R6B X;  5E6J A;  1PM5 A;  3VKG A;  1QAN A;  4DUY M;  2XZU A;  3HU2 A;  2CV1 A;  5IT9 S;  2L2D A;  3KVW A;  2DZN B;  2Y0T A;  1R2Y A;  4NSO B;  4GC5 A;  4DUZ M;  5IRE B;  4G4N A;  2BNK A;  1IN5 A;  2Y20 A;  3IG8 A;  4FCV A;  1OTR A;  2QPA A;  5KPZ A;  4TUW A;  4AG6 A;  2R46 A;  3SAT A;  2H1R A;  1XWI A;  5FTK A;  2VQF M;  4CGY B;  2HHH M;  3FTC A;  4R3D A;  4DV7 M;  4JYA M;  2I7P A;  4GRI A;  1EE8 A;  1OIZ A;  3GLI A;  4JI7 M;  1XHB A;  3DZD A;  3T6P A;  1XMQ M;  2CUZ A;  3VK8 A;  4DV6 M;  3VK7 A;  4M9X A;  2DHR A;  3KS8 A;  2UUA M;  1Z5B A;  4W5W A;  3J7A S;  2FNA A;  5ITQ A;  2E5L M;  1OAO C;  4F1I A;  1XB2 B;  3KSX A;  3L2A A;  2RGO A;  1ZV1 A;  4G4R A;  1Z59 A;  1PJT A;  4LF4 M;  1EIJ A;  2LVO C;  3HJ8 A;  2BWB A;  4FW9 A;  1TDH A;  4MGZ E;  2MGW A;  5EXX A;  3MHV C;  2CE7 A;  2LBC A;  2LHC A;  2FFJ A;  2DWL A;  1MX0 A;  3KDS E;  1GVN A;  4L78 A;  2X49 A;  1HT2 E;  2LNH C;  4LZZ A;  3KOY E;  4MGH A;  3C3E A;  1HQY E;  2C96 A;  1TGU A;  1FJG M;  2K9D A;  1GJT A;  3W0L B;  1K82 A;  2D7H A;  3ZC7 B;  2J7O A;  4OX9 M;  2Y21 A;  4NRW A;  2C9O A;  2P5T A;  4GIT A;  1T6O A;  1NNU C;  1SXJ C;  1G71 A;  2ZAM A;  3U6S A;  3GPX A;  4MGY E;  3UZU A;  3SAR A;  3FRH A;  1IBK M;  4AG5 A;  4L15 A;  2F5Q A;  4B3T M;  3D8L A;  3FE3 A;  5JI2 E;  3KXE C;  3ZQJ A;  3CF2 A;  1WIV A;  4QHT A;  3D8B A;  2EA0 A;  4LY6 A;  4X64 M;  3K92 A;  2VQE M;  3HY5 A;  1T3T A;  4LRT A;  2LH0 A;  2OPF A;  4B7F A;  3V76 A;  3JR5 A;  2R4E A;  2X8A A;  3B9P A;  3BOS A;  4LF7 M;  2CWB A;  4XK8 F;  3LCV B;  3KP0 E;  1NO1 A;  3QWL A;  1YSY A;  4ZPX A;  2J5Y A;  1V92 A;  3R8F A;  5EXT A;  3SBJ A;  2EJS A;  3E46 A;  1JR3 E;  2KA6 B;  3J81 S;  2G5G X;  4LRS A;  3RFW A;  1SXJ D;  2DAG A;  2DZO B;  2QHO B;  2Z4S A;  1VDD A;  1X37 A;  3B7Q A;  3DFZ A;  4DV3 M;  1ZMV A;  2CP8 A;  5KQ8 A;  2NQ8 C;  1HNX M;  1IN8 A;  3GLH B;  3MJ5 A;  1N78 A;  1MN3 A;  5EP2 A;  3FUV A;  2XSZ D;  4KOD A;  4DR6 M;  2XF3 A;  1DV0 A;  1G4A E;  3MK6 A;  1GL7 A;  4Z6Y A;  1XXH B;  1VEJ A;  1TH3 A;  1JB0 F;  3GLH E;  5L8R F;  2ZTC A;  4MGK E;  3U6C A;  2MR9 A;  5F3W A;  4LF5 M;  4DV5 M;  2OQ4 A;  1NHW C;  1L1T A;  2R6F A;  3W0F A;  5IWA M;  3AV0 A;  4UN2 B;  3UMM A;  4K0K M;  1XXH E;  3BBZ A;  1G41 A;  3U6M A;  1JR3 A;  1OJL A;  1OQY A;  4KT0 F;  2Z7J A;  3I01 M;  2M5Z A;  3PNY A;  4GHL A;  4LJ5 A;  4FWD A;  2L7H A;  2LVN C;  3RGP A;  3HX3 A;  2MH8 A;  3VLF B;  4HEO A;  4G4Q A;  3GRR A;  3GLH A;  3SYK A;  2CFO A;  3AOE C;  1Q3C A;  2QZ4 A;  3DA1 A;  3QAU A;  4JI2 M;  4BB9 A;  3FYC A;  4R71 A;  3B7Z A;  1IXS B;  1XXH A;  5ITY A;  4I4L A;  5FSW A;  2H5X A;  3M7G A;  1NY6 A;  2JA2 A;  4LZJ A;  4S12 A;  1VEG A;  2O25 A; 
#chains in the Genus database with same CATH homology
 2OOA A;  2EKF A;  1VEK A;  3MMP A;  2DEN A;  1WGL A;  1DO2 A;  2LVP C;  3GLF E;  3T6P A;  2WZJ A;  2MJ5 B;  2QSF X;  2L4E A;  2LVA A;  1ZMU A;  4F1I A;  1XB2 B;  2HWJ A;  1AIP C;  2DAM A;  1HT1 E;  1ZV1 A;  2LVO C;  1OAI A;  2BWB A;  2MRO B;  2JZ0 A;  2MGW A;  1F4I A;  2KHH A;  2LBC A;  2QNJ A;  1DO0 A;  1HT2 E;  1TR8 A;  1WJ7 A;  1HQY E;  2K9D A;  2BWE A;  2B3T A;  2R0I A;  1GO5 A;  4Q7J A;  1T6O A;  2RRU A;  2HAK A;  1UFZ A;  1BVS A;  1E94 E;  2JP7 A;  1NV8 A;  3FRH A;  1CUK A;  2JY7 A;  4GEW A;  3FE3 A;  5JI2 E;  5DFL A;  2LVQ D;  1WIV A;  3H4J A;  2DZL A;  2DAE A;  2DAI A;  2JY5 A;  1IXS A;  1G3I A;  2DNA A;  1QZE A;  1DV0 A;  2DAK A;  1T43 A;  4F2L A;  1R4G A;  1VQ1 A;  2CWB A;  3LCV B;  2KNZ A;  2DHY A;  3F92 A;  2ZTD A;  1V92 A;  2KNA A;  2KNV A;  1NV9 A;  2EJS A;  3E46 A;  3K9P A;  1JR3 E;  2LTU A;  3IHP A;  2DAG A;  2QHO B;  1WGN A;  3GLI E;  2OO9 A;  1ZMV A;  1WHC A;  3E21 A;  2CP8 A;  1KYI A;  1Y8G A;  1MN3 A;  3B89 A;  1VG5 A;  1ZMW A;  1Q02 A;  2JUJ A;  2DKL A;  1G4A E;  2L4F A;  4WP2 A;  1VEJ A;  2JY8 A;  3GLH E;  2ZTC A;  4G3O A;  2MR9 A;  4UN2 B;  1OKS A;  1XXH E;  3BBZ A;  1G41 A;  1OQY A;  2EKK A;  2JY6 B;  3GLG E;  1PGY A;  1C7Y A;  1TTE A;  1EFU B;  1VDL A;  1HJP A;  2DI0 A;  3IEC A;  2K0B X;  2LVN C;  1A5T A;  2JZ1 A;  2OOB A;  3FRI A;  1IFY A;  4HEO A;  2G3Q A;  1IM2 A;  2JNH A;  2L2D A;  1YLA A;  4R71 A;  1WR1 B;  1SG9 A;  3K9O A;  2H5X A;  3LCU A;  4DBG B;  1OTR A;  1VEG A;  1P3Q Q;  2O25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...