2JP7A

Nmr structure of the mex67 uba domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
57
structure length
57
Chain Sequence
RLNPVQLELLNKLHLETKLNAEYTFMLAEQSNWNYEVAIKGFQSSMNGIPREAFVQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords mRNA export factor MEX67
publication title Coordination of Hpr1 and ubiquitin binding by the UBA domain of the mRNA export factor Mex67
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 17
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2007-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jp7A00
1ZMUA 5DFLA 2JY5A 1GO5A 2DAEA 1G4AE 1OTRA 3K9PA 2DKLA 4DBGB 2KNVA 2OOAA 1WGNA 2EJSA 1R4GA 1VEKA 1HJPA 2DAIA 1WGLA 2JY6B 2JUJA 4F1IA 1NV8A 2MR9A 1IFYA 1MN3A 2DNAA 3GLHE 3FRIA 2LVOC 1E94E 2LVAA 2K0BX 2RRUA 2ZTCA 4HEOA 1HQYE 2L2DA 2LTUA 1BVSA 1KYIA 2JP7A 4UN2B 4WP2A 1XB2B 4R71A 1AIPC 4Q7JA 2EKFA 2QNJA 3IECA 1ZV1A 2BWBA 1ZMVA 3F92A 2HAKA 2OOBA 1G3IA 2DAKA 2O25A 1DO0A 4F2LA 1JR3E 2L4EA 3E21A 1OQYA 1IM2A 1EFUB 3LCVB 1TTEA 2DAMA 1V92A 1VQ1A 2K9DA 3MMPA 1PGYA 3GLGE 1Y8GA 2LBCA 2EKKA 1HT1E 2DENA 2KNZA 5JI2E 2CWBA 1YLAA 3E46A 1C7YA 1VEJA 3GLIE 2B3TA 2L4FA 1WR1B 1WHCA 3LCUA 1VDLA 2MGWA 3FRHA 1DO2A 3IHPA 1SG9A 2QSFX 1DV0A 2CP8A 2G3QA 2LVNC 3H4JA 1P3QQ 1IXSA 1OKSA 1CUKA 2LVQD 2KNAA 2QHOB 1XXHE 2H5XA 1OAIA 1VG5A 3K9OA 2WZJA 1QZEA 2DI0A 2JY8A 1UFZA 3B89A 2JZ1A 2BWEA 1G41A 4GEWA 1A5TA 2JNHA 2KHHA 1HT2E 1NV9A 3GLFE 2MJ5B 2HWJA 1ZMWA 2DAGA 2MROB 2OO9A 2DHYA 1TR8A 2ZTDA 2DZLA 3T6PA 2R0IA 1T6OA 1F4IA 3FE3A 1Q02A 1WJ7A 3BBZA 1T43A 1VEGA 4G3OA 2JY7A 2JZ0A 2LVPC 1WIVA
chains in the Genus database with same CATH superfamily
1QQWA 1R7RA 3Q8GA 1JR3D 5DFLA 1IXSB 3D8LA 2C99A 3C3DA 3SAWA 2AHMA 4B3MM 1OTRA 4X62M 1DGHA 3K8ZA 4MGZE 5C18A 2DWLA 4LCBA 4G4RA 2XFTA 3EIHA 2Q2EB 3CGWA 1SXJB 1IY0A 3RFWA 4DV3M 1OAOC 3KVWA 1HNXM 1OIPA 3VDUA 1D0MA 2CHVA 3FRIA 4DV2M 1E94E 4LJ8A 3SAUA 1HQYE 2L7HA 1UM8A 3KOYE 3TL4X 4LJ9A 2LTUA 4B3RM 1BVSA 3L29A 1IBKM 1TF0B 1XMOM 4WP2A 3L27A 1XB2B 3J80S 3U60B 4OU7A 4R71A 4Q7JA 2JA2A 2R44A 2F5QA 2YQZA 5ITXA 4D81A 2KXEA 3HJQA 2CV0A 1G59A 5KQDA 1MX0A 3R9XB 4IJEA 4IJFA 3T1YM 3FTFA 3VK7A 4JI7M 2F5OA 3GLFA 1T3TA 3J27B 2QQ8A 3B7ZA 3PNVA 5IZ7D 4B7HA 5KPZA 3B7QA 1AUAA 1JR3E 1QUSA 1QYRA 1GKIA 4MM3B 3SASA 2EO2A 2HL7A 2ZBKB 3HU1A 3KSJA 4BB9A 2X4AA 1NNJA 4LF5M 3LCVB 1TTEA 2DAMA 1V92A 1IN7A 1NNUC 1L2BA 8CATA 3SAVA 3GLGE 4G6ZA 2Z3XA 4FCWA 3AL0C 1R2ZA 2DENA 4L6V6 2XEPA 2KZUA 2FOIC 2CWBA 1V33A 3GLIE 3UZUA 2L4FA 3TQSA 1G71A 1IN8A 4NSRA 2UUAM 2MGWA 1DO2A 3IHPA 1H6UA 1SG9A 4PDGA 4JI4M 1DV0A 1E32A 2CP8A 2C5RA 1SXJD 2YR0A 1IBMM 2WSCF 2JXNA 4NSOB 3J2PB 4JI2M 1IXZA 1Q39A 2QENA 3C3EA 3K92A 1QAQA 5EXXA 1IQPA 3B74A 2GNOA 1OKSA 5EXPA 3KFUG 4NC6A 4IBCA 4CJ6A 2QHOB 4DV0M 2NQ8C 1VG5A 1OJLA 1XNRM 4LRSA 3LQQA 3U6QA 5KO3A 4DV4M 1Q3CA 4FD2A 4X64M 1XXHB 2J5YA 4GITA 5FTKA 2JNHA 3VKGA 2KHHA 4IBJA 2XSZD 3A42A 4KLNA 5BPVA 1FNNA 1W5SA 4L15A 3UJNA 2QP9X 4KODA 1Z6TA 1ZMWA 2DAGA 4X65M 2HKJA 2L7IA 3FUWA 4LRTA 3GLIB 4LF9M 2C98A 3A46A 3HHXA 1N77A 1T6OA 1F4IA 1N33M 2VF8A 3FE3A 4AKGA 3W0LB 4B3SM 3GLHA 2LH0A 4WURA 4GIPA 4P16A 1FJGM 3EIEA 3FYDA 2JY7A 2LVPC 1ZMUA 4JN6A 5FTMA 5F3WA 1SXJE 2DAEA 1G4AE 3E4RA 3K9PA 1NHWC 2DKLA 4L16A 4AKHA 2LWXA 2KNVA 2OOAA 3DZDA 2EJSA 2HHHM 4ANRA 4AW4A 7CATA 3CF0A 1VEKA 1HJPA 4QOSA 1YSYA 2VF7A 3OTOM 2X49A 3KW6A 2JUJA 2WSEF 4F1IA 3GQ4A 3GQ3A 2KEBA 4IIWA 1TDHA 4DR1M 3GRVA 3U6CA 3W0FA 4REZA 3WHLA 4L78A 1MJGM 3ZC7B 2BJVA 1MN3A 1J5EM 2KW0A 2DNAA 3LVVA 2C96A 1E9RA 2ZM6M 2LVOC 3QYEA 1D0KA 4RF0A 4XK8F 2K0BX 2ZTCA 3HY5A 2DZOB 4IBGA 4OVZB 4LF8M 4GHLA 3QWLA 4CHTB 2UXBM 3DOAA 2JP7A 1KYIA 4FWDA 4QNMA 3J81S 2G8LA 4IBDA 3KOXE 2DVWB 4KO8A 4EIWA 1QAOA 4II7A 3UGJA 1KFVA 1I94M 3NBIA 3HHYA 3L2AA 3FTEA 3A98B 3E9SA 3U6PA 2D7EA 4M9XA 4A3VB 3U61A 2QNJA 1HR0M 4IBBA 4MB7A 3IECA 3F92A 3U6EA 5EJCA 1TH3A 3SHFA 4TUWA 2Z8YM 1G3IA 1ZAEA 3HZJA 3TE6A 5ITYA 4JV5M 2V1CA 2RKOA 5FTNA 1L2DA 2L4EA 1X37A 2R18A 1XWIA 1N36M 4PT5A 2DWNA 1OQYA 1DGBA 3VLFB 1EFUB 3HWSA 4B7GA 2UXCM 3GPYA 1EIJA 4LJ4A 5EP2A 5KPTA 1VQ1A 1G8PA 3MMPA 3H4MA 4GMQA 2LHGA 2LBCA 3ILKA 1HT1E 4DR6M 2KNZA 4Z6YA 1N78A 1YLAA 2Z4RA 1C7YA 4DR3M 5FSWA 4B3TM 4FWHA 5L8RF 2B3TA 4IBFA 4AG5A 3HGIA 1D2NA 3QYBA 4LZZA 3LCUA 4LF7M 2K47A 2YNMD 3FRHA 4GC5A 4I8OA 4P17A 4M0WA 4L8RC 3BOSA 1NO1A 4GHAA 1R6BX 1TH2A 2N35A 2XGNA 1YUBA 3KOWE 3SC3A 1IY1A 3PXGA 3I51A 2LVNC 3TWMA 4NRVA 3IG5A 5ITRA 3U60A 3WHKA 1P3QQ 3M7GA 3GRRA 1IBLM 3W67A 3U6MA 4NRWA 4GH9A 1NY6A 2LXEA 3VK8A 1K82A 3UMMA 2H1RA 2E5LM 1XXHE 3K9OA 2QBYA 3HU3A 3KDSE 2JY8A 5IREB 4LF4M 3HX3A 4AKIA 3FUUA 2Y0QA 3U6LA 3I04M 4GEWA 3KP1E 1TGUA 2DZNB 4MGHA 3AJIB 1Z5CA 3CTWB 1RU3A 3K2LA 2MJ5B 4JI0M 3NBXX 3JAMS 1ZQ9A 4JI8M 1TR8A 2ZTDA 5E26A 2DWMA 2F4VM 4JI3M 4QHSA 3KSXA 1OFIA 2CFOA 4G4NA 1SXJC 3AOEA 3BBZA 1I4WA 1VEGA 4LJ7A 2CRUA 1QDTA 1TH4A 4CISA 3FYCA 2QZ4A 2JZ0A 5H37D 3W68A 5ITUA 2BJWA 3FUTA 2OPFA 1KSFX 4D80A 2XZUA 1IN5A 4LFCM 2KRUA 4DR5M 3FUVA 3IG8A 1XC8A 3SARA 1WGNA 1GJTA 1NVMA 1R4GA 4FVMA 4GKKM 4FWGA 2Z7JA 1WGLA 2JY6B 2BNKA 2I7NA 5C1BA 5IWAM 1GABA 3VDPA 3LQRA 2UU9M 4AQYM 5FLXS 3DFZA 1JR3A 3J7AS 4FCVA 3DA1A 1IFYA 2J7OA 5JI3E 5GKNA 1PJJA 4RNAA 5EQTA 2D7HA 1MU5A 3HHZA 2LVAA 4HEOA 2XZFA 1GJSA 3LW5F 2FE8A 2L2DA 3BXWA 4LJAA 4Z8XA 1XXHA 2XFSA 1QVRA 2CHGA 4M9SA 3THGA 2WSFF 5ITQA 3PNYA 3GLHB 1QAMA 4ZPXA 3GLGA 4ITQA 4DR7M 1AIPC 2CV2A 1ORYB 4LF6M 2UUBM 4NOOB 3C9PA 2XLJA 4DV1M 5FTLA 2ERCA 3J7BA 4GC9A 2GQFA 3GLIA 3AOEC 2J7NA 2BWBA 1ZMVA 2FFJA 4FW9A 4XBOA 2A5YB 4B08A 1IN4A 4JYAM 3AFHA 2O25A 5E6JA 2MH8A 3SFZA 1E9SA 2Z4SA 3I01M 4Y28F 3SMPA 3GPUA 1PJSA 3FUXA 4M9ZA 3U6SA 2CUZA 3U5ZB 1D0LA 3I4YA 1K3XA 4GRIA 4DV5M 3CF6E 2K9DA 4W5WA 1PGYA 1V34A 3D8BA 4S12A 4KT0F 3SMSA 4PCZA 3GQ5A 1Y8GA 5LMUM 2F5PA 2CHQA 3KS4A 2EKKA 3AV0A 5KQ8A 2R46A 4LGYA 5A2QS 1R5LA 3LMMA 2VQEM 3E46A 4JI5M 2EA0A 4MGIE 3UK6A 1VDLA 2FNAA 4R7GA 1DGHB 3L28A 4OVZA 4BLCA 4PD2A 4BBAA 1EE8A 3H4JA 3GO8A 1HNZM 2R4EA 2XF3A 3KOZE 3CF2A 1IXSA 4AI6A 5DNYA 2CE7A 3L26A 2L6OA 2KNAA 1NSFA 2JWSA 3FD9A 2H5XA 4HL4A 3R8FA 3RE8A 4MGYE 2QPAA 2DWZB 2KRKA 2P5TA 2WZJA 1SXJA 2DI0A 3B7NA 1UFZA 3MK6A 2KDLA 3B89A 3KS8A 1TDZA 2JZ1A 4QOZC 2VDBB 4G4OA 1G41A 2W82A 1Z5AA 1A5TA 3ZQJA 1S3SA 3VFDA 1HT2E 1NV9A 3T38A 4L4UA 4LFAM 3MHVC 1L1TA 2DXIA 2HWJA 4LJ6A 2OO9A 3LVWA 3RGPA 4G4QA 3SBJA 1DGFA 1HQCA 4LG2A 2R4JA 3HJSA 4M0DA 4AZFA 1JB0F 1OIZA 4DV6M 1L8QA 5BR8M 3GRUA 3Q8XA 3QAUA 3GLFB 1WXQA 1JQJC 1T43A 2V6ZM 4G3OA 1GL6A 2F5SA 1DGGA 2Y21A 2I7PA 1N34M 3L25A 1XHBA 2XSZA 4DUYM 1IN6A 3VKHA 2JY5A 2V1UA 3RGSA 1NHGC 2KZSA 4AG6A 1PRBA 4CGYB 1GO5A 2R6FA 3GRYA 4QNRA 3PVSA 2ZAMA 4QHTA 4DBGB 4DUZM 2UXDM 4FCTA 4I5SA 2FS1A 2QCUA 2QBYB 3SATA 5EXSA 2DAIA 1L1ZA 1NV8A 4IBIA 2MR9A 2VIIA 4NXMM 1YE9A 3TWKA 4NL4H 1NJGA 1NJFA 1C1KA 4RKUF 1HNWM 3GLHE 4B7FA 3TWLA 4X66M 4LY6A 2RRUA 2OQ4A 5KPRA 3FTCA 2DHRA 1PJTA 3AOGA 1J7KA 5DYGA 5FTJA 2RGOA 4UN2B 5DYIA 4XGIA 3KXEC 2R45A 4PDIA 1Q3BA 4KHPM 3M0EA 2M5ZA 4K0KM 4YHHM 2EKFA 5EP4A 3HU2A 3SHGB 3AKZA 4JXJA 1ZV1A 3HJ8A 3JR5A 3PFIA 2HAKA 2G5GX 2OOBA 1XMQM 1PM5A 1PJIA 2C9OA 1GL7A 2L09A 4DR4M 2DAKA 4LGMA 1DO0A 4F2LA 3E21A 1QUTA 3GPPA 1IM2A 4I4LA 3U6OA 1K3WA 4YY3M 2M60A 1Z5BA 3SYLA 1OFHA 2LHCA 4DR2M 1IXRC 1R2YA 2RGHA 4MH0E 2D7GA 2EUCA 5JI2E 4LJ5A 3TPZA 3U6DA 1VEJA 1Z59A 3K1JA 4OW0A 3GLGB 4LFBM 1WR1B 1WHCA 4HLQA 1QANA 1W5TA 2APLA 1L2CA 1QDRA 3NWLA 4RF1A 4NXNM 2YFQA 2QSFX 4R3DA 5EXTA 2Y20A 2C9CA 5ITTA 4MGKE 2G3QA 2R65A 2CV1A 4GKJM 2XH9A 1XNQM 2K6BA 3T1HM 3V76A 2KA6B 1PJQA 1GLNA 1GVNA 1CUKA 2FH0A 3B9PA 2LVQD 3HHWA 1LTMA 2LNHC 5EP3A 1OAIA 4D82A 1LV7A 2O5RA 1N32M 2ZANA 1QZEA 3FTDA 1NY5A 4JI6M 2HCBA 3T15A 1IY2A 2BWEA 5ITXE 2Y0TA 4IBKA 1N75A 1VDDA 2O01F 4IBEA 3GLFE 4WW0A 3U5ZA 2F5NA 2UUCM 4LZJA 2MROB 3FKEA 3M6AA 2DHYA 2X8AA 3GP1A 3C58A 3U61B 2DZLA 4I81A 5EP1A 3T6PA 4CIZA 2ZAOA 2R0IA 1J09A 5IT9S 3MJ5A 3SYKA 4JI1M 2R62A 1Q02A 3ZCBB 3ZH9B 1WJ7A 4DV7M 2CEAA 3A45A 3HKPA 3I4VA 3KP0E 3GPXA 1QZMA 5LMNM 4OX9M 3JR4A 2VQFM 1WIVA
chains in the Genus database with same CATH topology
1ZMUA 5DFLA 2JY5A 1GO5A 2DAEA 1G4AE 1OTRA 3K9PA 2DKLA 4DBGB 2KNVA 2OOAA 1WGNA 2EJSA 1R4GA 1VEKA 1HJPA 2DAIA 1WGLA 2JY6B 2JUJA 4F1IA 1NV8A 2MR9A 1IFYA 1MN3A 2DNAA 3GLHE 3FRIA 2LVOC 1E94E 2LVAA 2K0BX 2RRUA 2ZTCA 4HEOA 1HQYE 2L2DA 2LTUA 1BVSA 1KYIA 2JP7A 4UN2B 4WP2A 1XB2B 4R71A 1AIPC 4Q7JA 2EKFA 2QNJA 3IECA 1ZV1A 2BWBA 1ZMVA 3F92A 2HAKA 2OOBA 1G3IA 2DAKA 2O25A 1DO0A 4F2LA 1JR3E 2L4EA 3E21A 1OQYA 1IM2A 1EFUB 3LCVB 1TTEA 2DAMA 1V92A 1VQ1A 2K9DA 3MMPA 1PGYA 3GLGE 1Y8GA 2LBCA 2EKKA 1HT1E 2DENA 2KNZA 5JI2E 2CWBA 1YLAA 3E46A 1C7YA 1VEJA 3GLIE 2B3TA 2L4FA 1WR1B 1WHCA 3LCUA 1VDLA 2MGWA 3FRHA 1DO2A 3IHPA 1SG9A 2QSFX 1DV0A 2CP8A 2G3QA 2LVNC 3H4JA 1P3QQ 1IXSA 1OKSA 1CUKA 2LVQD 2KNAA 2QHOB 1XXHE 2H5XA 1OAIA 1VG5A 3K9OA 2WZJA 1QZEA 2DI0A 2JY8A 1UFZA 3B89A 2JZ1A 2BWEA 1G41A 4GEWA 1A5TA 2JNHA 2KHHA 1HT2E 1NV9A 3GLFE 2MJ5B 2HWJA 1ZMWA 2DAGA 2MROB 2OO9A 2DHYA 1TR8A 2ZTDA 2DZLA 3T6PA 2R0IA 1T6OA 1F4IA 3FE3A 1Q02A 1WJ7A 3BBZA 1T43A 1VEGA 4G3OA 2JY7A 2JZ0A 2LVPC 1WIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZMU A;  5DFL A;  2JY5 A;  1GO5 A;  2DAE A;  1G4A E;  1OTR A;  3K9P A;  2DKL A;  4DBG B;  2KNV A;  2OOA A;  1WGN A;  2EJS A;  1R4G A;  1VEK A;  1HJP A;  2DAI A;  1WGL A;  2JY6 B;  2JUJ A;  4F1I A;  1NV8 A;  2MR9 A;  1IFY A;  1MN3 A;  2DNA A;  3GLH E;  3FRI A;  2LVO C;  1E94 E;  2LVA A;  2K0B X;  2RRU A;  2ZTC A;  4HEO A;  1HQY E;  2L2D A;  2LTU A;  1BVS A;  1KYI A;  2JP7 A;  4UN2 B;  4WP2 A;  1XB2 B;  4R71 A;  1AIP C;  4Q7J A;  2EKF A;  2QNJ A;  3IEC A;  1ZV1 A;  2BWB A;  1ZMV A;  3F92 A;  2HAK A;  2OOB A;  1G3I A;  2DAK A;  2O25 A;  1DO0 A;  4F2L A;  1JR3 E;  2L4E A;  3E21 A;  1OQY A;  1IM2 A;  1EFU B;  3LCV B;  1TTE A;  2DAM A;  1V92 A;  1VQ1 A;  2K9D A;  3MMP A;  1PGY A;  3GLG E;  1Y8G A;  2LBC A;  2EKK A;  1HT1 E;  2DEN A;  2KNZ A;  5JI2 E;  2CWB A;  1YLA A;  3E46 A;  1C7Y A;  1VEJ A;  3GLI E;  2B3T A;  2L4F A;  1WR1 B;  1WHC A;  3LCU A;  1VDL A;  2MGW A;  3FRH A;  1DO2 A;  3IHP A;  1SG9 A;  2QSF X;  1DV0 A;  2CP8 A;  2G3Q A;  2LVN C;  3H4J A;  1P3Q Q;  1IXS A;  1OKS A;  1CUK A;  2LVQ D;  2KNA A;  2QHO B;  1XXH E;  2H5X A;  1OAI A;  1VG5 A;  3K9O A;  2WZJ A;  1QZE A;  2DI0 A;  2JY8 A;  1UFZ A;  3B89 A;  2JZ1 A;  2BWE A;  1G41 A;  4GEW A;  1A5T A;  2JNH A;  2KHH A;  1HT2 E;  1NV9 A;  3GLF E;  2MJ5 B;  2HWJ A;  1ZMW A;  2DAG A;  2MRO B;  2OO9 A;  2DHY A;  1TR8 A;  2ZTD A;  2DZL A;  3T6P A;  2R0I A;  1T6O A;  1F4I A;  3FE3 A;  1Q02 A;  1WJ7 A;  3BBZ A;  1T43 A;  1VEG A;  4G3O A;  2JY7 A;  2JZ0 A;  2LVP C;  1WIV A; 
#chains in the Genus database with same CATH topology
 1QQW A;  1R7R A;  3Q8G A;  1JR3 D;  5DFL A;  1IXS B;  3D8L A;  2C99 A;  3C3D A;  3SAW A;  2AHM A;  4B3M M;  1OTR A;  4X62 M;  1DGH A;  3K8Z A;  4MGZ E;  5C18 A;  2DWL A;  4LCB A;  4G4R A;  2XFT A;  3EIH A;  2Q2E B;  3CGW A;  1SXJ B;  1IY0 A;  3RFW A;  4DV3 M;  1OAO C;  3KVW A;  1HNX M;  1OIP A;  3VDU A;  1D0M A;  2CHV A;  3FRI A;  4DV2 M;  1E94 E;  4LJ8 A;  3SAU A;  1HQY E;  2L7H A;  1UM8 A;  3KOY E;  3TL4 X;  4LJ9 A;  2LTU A;  4B3R M;  1BVS A;  3L29 A;  1IBK M;  1TF0 B;  1XMO M;  4WP2 A;  3L27 A;  1XB2 B;  3J80 S;  3U60 B;  4OU7 A;  4R71 A;  4Q7J A;  2JA2 A;  2R44 A;  2F5Q A;  2YQZ A;  5ITX A;  4D81 A;  2KXE A;  3HJQ A;  2CV0 A;  1G59 A;  5KQD A;  1MX0 A;  3R9X B;  4IJE A;  4IJF A;  3T1Y M;  3FTF A;  3VK7 A;  4JI7 M;  2F5O A;  3GLF A;  1T3T A;  3J27 B;  2QQ8 A;  3B7Z A;  3PNV A;  5IZ7 D;  4B7H A;  5KPZ A;  3B7Q A;  1AUA A;  1JR3 E;  1QUS A;  1QYR A;  1GKI A;  4MM3 B;  3SAS A;  2EO2 A;  2HL7 A;  2ZBK B;  3HU1 A;  3KSJ A;  4BB9 A;  2X4A A;  1NNJ A;  4LF5 M;  3LCV B;  1TTE A;  2DAM A;  1V92 A;  1IN7 A;  1NNU C;  1L2B A;  8CAT A;  3SAV A;  3GLG E;  4G6Z A;  2Z3X A;  4FCW A;  3AL0 C;  1R2Z A;  2DEN A;  4L6V 6;  2XEP A;  2KZU A;  2FOI C;  2CWB A;  1V33 A;  3GLI E;  3UZU A;  2L4F A;  3TQS A;  1G71 A;  1IN8 A;  4NSR A;  2UUA M;  2MGW A;  1DO2 A;  3IHP A;  1H6U A;  1SG9 A;  4PDG A;  4JI4 M;  1DV0 A;  1E32 A;  2CP8 A;  2C5R A;  1SXJ D;  2YR0 A;  1IBM M;  2WSC F;  2JXN A;  4NSO B;  3J2P B;  4JI2 M;  1IXZ A;  1Q39 A;  2QEN A;  3C3E A;  3K92 A;  1QAQ A;  5EXX A;  1IQP A;  3B74 A;  2GNO A;  1OKS A;  5EXP A;  3KFU G;  4NC6 A;  4IBC A;  4CJ6 A;  2QHO B;  4DV0 M;  2NQ8 C;  1VG5 A;  1OJL A;  1XNR M;  4LRS A;  3LQQ A;  3U6Q A;  5KO3 A;  4DV4 M;  1Q3C A;  4FD2 A;  4X64 M;  1XXH B;  2J5Y A;  4GIT A;  5FTK A;  2JNH A;  3VKG A;  2KHH A;  4IBJ A;  2XSZ D;  3A42 A;  4KLN A;  5BPV A;  1FNN A;  1W5S A;  4L15 A;  3UJN A;  2QP9 X;  4KOD A;  1Z6T A;  1ZMW A;  2DAG A;  4X65 M;  2HKJ A;  2L7I A;  3FUW A;  4LRT A;  3GLI B;  4LF9 M;  2C98 A;  3A46 A;  3HHX A;  1N77 A;  1T6O A;  1F4I A;  1N33 M;  2VF8 A;  3FE3 A;  4AKG A;  3W0L B;  4B3S M;  3GLH A;  2LH0 A;  4WUR A;  4GIP A;  4P16 A;  1FJG M;  3EIE A;  3FYD A;  2JY7 A;  2LVP C;  1ZMU A;  4JN6 A;  5FTM A;  5F3W A;  1SXJ E;  2DAE A;  1G4A E;  3E4R A;  3K9P A;  1NHW C;  2DKL A;  4L16 A;  4AKH A;  2LWX A;  2KNV A;  2OOA A;  3DZD A;  2EJS A;  2HHH M;  4ANR A;  4AW4 A;  7CAT A;  3CF0 A;  1VEK A;  1HJP A;  4QOS A;  1YSY A;  2VF7 A;  3OTO M;  2X49 A;  3KW6 A;  2JUJ A;  2WSE F;  4F1I A;  3GQ4 A;  3GQ3 A;  2KEB A;  4IIW A;  1TDH A;  4DR1 M;  3GRV A;  3U6C A;  3W0F A;  4REZ A;  3WHL A;  4L78 A;  1MJG M;  3ZC7 B;  2BJV A;  1MN3 A;  1J5E M;  2KW0 A;  2DNA A;  3LVV A;  2C96 A;  1E9R A;  2ZM6 M;  2LVO C;  3QYE A;  1D0K A;  4RF0 A;  4XK8 F;  2K0B X;  2ZTC A;  3HY5 A;  2DZO B;  4IBG A;  4OVZ B;  4LF8 M;  4GHL A;  3QWL A;  4CHT B;  2UXB M;  3DOA A;  2JP7 A;  1KYI A;  4FWD A;  4QNM A;  3J81 S;  2G8L A;  4IBD A;  3KOX E;  2DVW B;  4KO8 A;  4EIW A;  1QAO A;  4II7 A;  3UGJ A;  1KFV A;  1I94 M;  3NBI A;  3HHY A;  3L2A A;  3FTE A;  3A98 B;  3E9S A;  3U6P A;  2D7E A;  4M9X A;  4A3V B;  3U61 A;  2QNJ A;  1HR0 M;  4IBB A;  4MB7 A;  3IEC A;  3F92 A;  3U6E A;  5EJC A;  1TH3 A;  3SHF A;  4TUW A;  2Z8Y M;  1G3I A;  1ZAE A;  3HZJ A;  3TE6 A;  5ITY A;  4JV5 M;  2V1C A;  2RKO A;  5FTN A;  1L2D A;  2L4E A;  1X37 A;  2R18 A;  1XWI A;  1N36 M;  4PT5 A;  2DWN A;  1OQY A;  1DGB A;  3VLF B;  1EFU B;  3HWS A;  4B7G A;  2UXC M;  3GPY A;  1EIJ A;  4LJ4 A;  5EP2 A;  5KPT A;  1VQ1 A;  1G8P A;  3MMP A;  3H4M A;  4GMQ A;  2LHG A;  2LBC A;  3ILK A;  1HT1 E;  4DR6 M;  2KNZ A;  4Z6Y A;  1N78 A;  1YLA A;  2Z4R A;  1C7Y A;  4DR3 M;  5FSW A;  4B3T M;  4FWH A;  5L8R F;  2B3T A;  4IBF A;  4AG5 A;  3HGI A;  1D2N A;  3QYB A;  4LZZ A;  3LCU A;  4LF7 M;  2K47 A;  2YNM D;  3FRH A;  4GC5 A;  4I8O A;  4P17 A;  4M0W A;  4L8R C;  3BOS A;  1NO1 A;  4GHA A;  1R6B X;  1TH2 A;  2N35 A;  2XGN A;  1YUB A;  3KOW E;  3SC3 A;  1IY1 A;  3PXG A;  3I51 A;  2LVN C;  3TWM A;  4NRV A;  3IG5 A;  5ITR A;  3U60 A;  3WHK A;  1P3Q Q;  3M7G A;  3GRR A;  1IBL M;  3W67 A;  3U6M A;  4NRW A;  4GH9 A;  1NY6 A;  2LXE A;  3VK8 A;  1K82 A;  3UMM A;  2H1R A;  2E5L M;  1XXH E;  3K9O A;  2QBY A;  3HU3 A;  3KDS E;  2JY8 A;  5IRE B;  4LF4 M;  3HX3 A;  4AKI A;  3FUU A;  2Y0Q A;  3U6L A;  3I04 M;  4GEW A;  3KP1 E;  1TGU A;  2DZN B;  4MGH A;  3AJI B;  1Z5C A;  3CTW B;  1RU3 A;  3K2L A;  2MJ5 B;  4JI0 M;  3NBX X;  3JAM S;  1ZQ9 A;  4JI8 M;  1TR8 A;  2ZTD A;  5E26 A;  2DWM A;  2F4V M;  4JI3 M;  4QHS A;  3KSX A;  1OFI A;  2CFO A;  4G4N A;  1SXJ C;  3AOE A;  3BBZ A;  1I4W A;  1VEG A;  4LJ7 A;  2CRU A;  1QDT A;  1TH4 A;  4CIS A;  3FYC A;  2QZ4 A;  2JZ0 A;  5H37 D;  3W68 A;  5ITU A;  2BJW A;  3FUT A;  2OPF A;  1KSF X;  4D80 A;  2XZU A;  1IN5 A;  4LFC M;  2KRU A;  4DR5 M;  3FUV A;  3IG8 A;  1XC8 A;  3SAR A;  1WGN A;  1GJT A;  1NVM A;  1R4G A;  4FVM A;  4GKK M;  4FWG A;  2Z7J A;  1WGL A;  2JY6 B;  2BNK A;  2I7N A;  5C1B A;  5IWA M;  1GAB A;  3VDP A;  3LQR A;  2UU9 M;  4AQY M;  5FLX S;  3DFZ A;  1JR3 A;  3J7A S;  4FCV A;  3DA1 A;  1IFY A;  2J7O A;  5JI3 E;  5GKN A;  1PJJ A;  4RNA A;  5EQT A;  2D7H A;  1MU5 A;  3HHZ A;  2LVA A;  4HEO A;  2XZF A;  1GJS A;  3LW5 F;  2FE8 A;  2L2D A;  3BXW A;  4LJA A;  4Z8X A;  1XXH A;  2XFS A;  1QVR A;  2CHG A;  4M9S A;  3THG A;  2WSF F;  5ITQ A;  3PNY A;  3GLH B;  1QAM A;  4ZPX A;  3GLG A;  4ITQ A;  4DR7 M;  1AIP C;  2CV2 A;  1ORY B;  4LF6 M;  2UUB M;  4NOO B;  3C9P A;  2XLJ A;  4DV1 M;  5FTL A;  2ERC A;  3J7B A;  4GC9 A;  2GQF A;  3GLI A;  3AOE C;  2J7N A;  2BWB A;  1ZMV A;  2FFJ A;  4FW9 A;  4XBO A;  2A5Y B;  4B08 A;  1IN4 A;  4JYA M;  3AFH A;  2O25 A;  5E6J A;  2MH8 A;  3SFZ A;  1E9S A;  2Z4S A;  3I01 M;  4Y28 F;  3SMP A;  3GPU A;  1PJS A;  3FUX A;  4M9Z A;  3U6S A;  2CUZ A;  3U5Z B;  1D0L A;  3I4Y A;  1K3X A;  4GRI A;  4DV5 M;  3CF6 E;  2K9D A;  4W5W A;  1PGY A;  1V34 A;  3D8B A;  4S12 A;  4KT0 F;  3SMS A;  4PCZ A;  3GQ5 A;  1Y8G A;  5LMU M;  2F5P A;  2CHQ A;  3KS4 A;  2EKK A;  3AV0 A;  5KQ8 A;  2R46 A;  4LGY A;  5A2Q S;  1R5L A;  3LMM A;  2VQE M;  3E46 A;  4JI5 M;  2EA0 A;  4MGI E;  3UK6 A;  1VDL A;  2FNA A;  4R7G A;  1DGH B;  3L28 A;  4OVZ A;  4BLC A;  4PD2 A;  4BBA A;  1EE8 A;  3H4J A;  3GO8 A;  1HNZ M;  2R4E A;  2XF3 A;  3KOZ E;  3CF2 A;  1IXS A;  4AI6 A;  5DNY A;  2CE7 A;  3L26 A;  2L6O A;  2KNA A;  1NSF A;  2JWS A;  3FD9 A;  2H5X A;  4HL4 A;  3R8F A;  3RE8 A;  4MGY E;  2QPA A;  2DWZ B;  2KRK A;  2P5T A;  2WZJ A;  1SXJ A;  2DI0 A;  3B7N A;  1UFZ A;  3MK6 A;  2KDL A;  3B89 A;  3KS8 A;  1TDZ A;  2JZ1 A;  4QOZ C;  2VDB B;  4G4O A;  1G41 A;  2W82 A;  1Z5A A;  1A5T A;  3ZQJ A;  1S3S A;  3VFD A;  1HT2 E;  1NV9 A;  3T38 A;  4L4U A;  4LFA M;  3MHV C;  1L1T A;  2DXI A;  2HWJ A;  4LJ6 A;  2OO9 A;  3LVW A;  3RGP A;  4G4Q A;  3SBJ A;  1DGF A;  1HQC A;  4LG2 A;  2R4J A;  3HJS A;  4M0D A;  4AZF A;  1JB0 F;  1OIZ A;  4DV6 M;  1L8Q A;  5BR8 M;  3GRU A;  3Q8X A;  3QAU A;  3GLF B;  1WXQ A;  1JQJ C;  1T43 A;  2V6Z M;  4G3O A;  1GL6 A;  2F5S A;  1DGG A;  2Y21 A;  2I7P A;  1N34 M;  3L25 A;  1XHB A;  2XSZ A;  4DUY M;  1IN6 A;  3VKH A;  2JY5 A;  2V1U A;  3RGS A;  1NHG C;  2KZS A;  4AG6 A;  1PRB A;  4CGY B;  1GO5 A;  2R6F A;  3GRY A;  4QNR A;  3PVS A;  2ZAM A;  4QHT A;  4DBG B;  4DUZ M;  2UXD M;  4FCT A;  4I5S A;  2FS1 A;  2QCU A;  2QBY B;  3SAT A;  5EXS A;  2DAI A;  1L1Z A;  1NV8 A;  4IBI A;  2MR9 A;  2VII A;  4NXM M;  1YE9 A;  3TWK A;  4NL4 H;  1NJG A;  1NJF A;  1C1K A;  4RKU F;  1HNW M;  3GLH E;  4B7F A;  3TWL A;  4X66 M;  4LY6 A;  2RRU A;  2OQ4 A;  5KPR A;  3FTC A;  2DHR A;  1PJT A;  3AOG A;  1J7K A;  5DYG A;  5FTJ A;  2RGO A;  4UN2 B;  5DYI A;  4XGI A;  3KXE C;  2R45 A;  4PDI A;  1Q3B A;  4KHP M;  3M0E A;  2M5Z A;  4K0K M;  4YHH M;  2EKF A;  5EP4 A;  3HU2 A;  3SHG B;  3AKZ A;  4JXJ A;  1ZV1 A;  3HJ8 A;  3JR5 A;  3PFI A;  2HAK A;  2G5G X;  2OOB A;  1XMQ M;  1PM5 A;  1PJI A;  2C9O A;  1GL7 A;  2L09 A;  4DR4 M;  2DAK A;  4LGM A;  1DO0 A;  4F2L A;  3E21 A;  1QUT A;  3GPP A;  1IM2 A;  4I4L A;  3U6O A;  1K3W A;  4YY3 M;  2M60 A;  1Z5B A;  3SYL A;  1OFH A;  2LHC A;  4DR2 M;  1IXR C;  1R2Y A;  2RGH A;  4MH0 E;  2D7G A;  2EUC A;  5JI2 E;  4LJ5 A;  3TPZ A;  3U6D A;  1VEJ A;  1Z59 A;  3K1J A;  4OW0 A;  3GLG B;  4LFB M;  1WR1 B;  1WHC A;  4HLQ A;  1QAN A;  1W5T A;  2APL A;  1L2C A;  1QDR A;  3NWL A;  4RF1 A;  4NXN M;  2YFQ A;  2QSF X;  4R3D A;  5EXT A;  2Y20 A;  2C9C A;  5ITT A;  4MGK E;  2G3Q A;  2R65 A;  2CV1 A;  4GKJ M;  2XH9 A;  1XNQ M;  2K6B A;  3T1H M;  3V76 A;  2KA6 B;  1PJQ A;  1GLN A;  1GVN A;  1CUK A;  2FH0 A;  3B9P A;  2LVQ D;  3HHW A;  1LTM A;  2LNH C;  5EP3 A;  1OAI A;  4D82 A;  1LV7 A;  2O5R A;  1N32 M;  2ZAN A;  1QZE A;  3FTD A;  1NY5 A;  4JI6 M;  2HCB A;  3T15 A;  1IY2 A;  2BWE A;  5ITX E;  2Y0T A;  4IBK A;  1N75 A;  1VDD A;  2O01 F;  4IBE A;  3GLF E;  4WW0 A;  3U5Z A;  2F5N A;  2UUC M;  4LZJ A;  2MRO B;  3FKE A;  3M6A A;  2DHY A;  2X8A A;  3GP1 A;  3C58 A;  3U61 B;  2DZL A;  4I81 A;  5EP1 A;  3T6P A;  4CIZ A;  2ZAO A;  2R0I A;  1J09 A;  5IT9 S;  3MJ5 A;  3SYK A;  4JI1 M;  2R62 A;  1Q02 A;  3ZCB B;  3ZH9 B;  1WJ7 A;  4DV7 M;  2CEA A;  3A45 A;  3HKP A;  3I4V A;  3KP0 E;  3GPX A;  1QZM A;  5LMN M;  4OX9 M;  3JR4 A;  2VQF M;  1WIV A; 
#chains in the Genus database with same CATH homology
 1ZMU A;  5DFL A;  2JY5 A;  1GO5 A;  2DAE A;  1G4A E;  1OTR A;  3K9P A;  2DKL A;  4DBG B;  2KNV A;  2OOA A;  1WGN A;  2EJS A;  1R4G A;  1VEK A;  1HJP A;  2DAI A;  1WGL A;  2JY6 B;  2JUJ A;  4F1I A;  1NV8 A;  2MR9 A;  1IFY A;  1MN3 A;  2DNA A;  3GLH E;  3FRI A;  2LVO C;  1E94 E;  2LVA A;  2K0B X;  2RRU A;  2ZTC A;  4HEO A;  1HQY E;  2L2D A;  2LTU A;  1BVS A;  1KYI A;  2JP7 A;  4UN2 B;  4WP2 A;  1XB2 B;  4R71 A;  1AIP C;  4Q7J A;  2EKF A;  2QNJ A;  3IEC A;  1ZV1 A;  2BWB A;  1ZMV A;  3F92 A;  2HAK A;  2OOB A;  1G3I A;  2DAK A;  2O25 A;  1DO0 A;  4F2L A;  1JR3 E;  2L4E A;  3E21 A;  1OQY A;  1IM2 A;  1EFU B;  3LCV B;  1TTE A;  2DAM A;  1V92 A;  1VQ1 A;  2K9D A;  3MMP A;  1PGY A;  3GLG E;  1Y8G A;  2LBC A;  2EKK A;  1HT1 E;  2DEN A;  2KNZ A;  5JI2 E;  2CWB A;  1YLA A;  3E46 A;  1C7Y A;  1VEJ A;  3GLI E;  2B3T A;  2L4F A;  1WR1 B;  1WHC A;  3LCU A;  1VDL A;  2MGW A;  3FRH A;  1DO2 A;  3IHP A;  1SG9 A;  2QSF X;  1DV0 A;  2CP8 A;  2G3Q A;  2LVN C;  3H4J A;  1P3Q Q;  1IXS A;  1OKS A;  1CUK A;  2LVQ D;  2KNA A;  2QHO B;  1XXH E;  2H5X A;  1OAI A;  1VG5 A;  3K9O A;  2WZJ A;  1QZE A;  2DI0 A;  2JY8 A;  1UFZ A;  3B89 A;  2JZ1 A;  2BWE A;  1G41 A;  4GEW A;  1A5T A;  2JNH A;  2KHH A;  1HT2 E;  1NV9 A;  3GLF E;  2MJ5 B;  2HWJ A;  1ZMW A;  2DAG A;  2MRO B;  2OO9 A;  2DHY A;  1TR8 A;  2ZTD A;  2DZL A;  3T6P A;  2R0I A;  1T6O A;  1F4I A;  3FE3 A;  1Q02 A;  1WJ7 A;  3BBZ A;  1T43 A;  1VEG A;  4G3O A;  2JY7 A;  2JZ0 A;  2LVP C;  1WIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...