2JPNA

Solution structure of t4 bacteriophage helicase uvsw.1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
GSHMLLEFKQFLYEASIDEFMGKIASCQTLEGLEELEAYYKKRVKETELKDTDDISVRDALAGKRAELEDSDDEVEESF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent DNA helicase uvsW
publication title Crystallographic and NMR Analyses of UvsW and UvsW.1 from Bacteriophage T4
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Hydrolase
total genus 25
structure length 79
sequence length 79
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2007-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11637 UvsW ATP-dependant DNA helicase UvsW
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.210 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2jpnA00
2JPNA
chains in the Genus database with same CATH superfamily
2LF3A 1MMOG 3NAEA 3TAEA 3UO3A 1FS1A 4HCBA 3LD8A 4DU3A 2H4TA 2FYOA 4QNCA 4JS4A 4DTXA 4FJIA 4RL5A 1IH7A 2B7MA 3N1EA 4ADNA 2OYQA 4J2BA 4M3ZA 4FJMA 4M3UA 3QEIA 4KI4A 4KI6A 3QERA 4DTSA 3HGLA 4FK4A 1FZ1E 3E4WA 3RMBA 4FJ5A 3L0MA 3OGLB 3SUNA 3RMCA 3TAGA 2MZWB 1FZ9E 2P1MB 3SUPA 2P5GA 3SQ4A 3LZIA 1WAJA 3SVIA 2ATQA 3BVOA 4B08A 2P1PB 2FW3A 1XVCE 4EPHA 3TABA 1FZ4E 3QNOA 3C95A 2JPNA 2QXFA 2JH9A 4RG8A 5IZ7A 4M3XA 3V7DB 1XU5E 1XU3E 2JHAA 4RNGA 3SQ1A 4M3WA 1N1CA 3QETA 5IREA 4FJ7A 3NHGA 3LDSA 4FJNA 3L1NA 1NEXB 4X5NA 1XMHE 3OGKB 5H37A 3QEXA 1FYZE 4I9LA 2PFVA 1JW2A 1XVGE 4X5MA 3SJJA 2P1NB 3QESA 1IG9A 2DTUA 4FVMA 3UO2A 1FZ3E 2P5OA 3J2PA 2OZSA 4I6JB 1LDKE 4KHUA 2P1QB 4QNDA 4IT5A 4KHQA 2OVQB 4DU4A 3C6PB 2PFTA 3C6NB 3QNNA 3KD5E 4KHWA 1XL3C 3LDBA 3QEVA 3SQ0A 3SCXA 4AKHA 3N1BA 3CQ8A 1FZ0E 1FZ6E 2P1OB 4FJLA 3HP9A 2B8IA 3HGKE 3QEPA 2E32A 3SPZA 4ICGC 4DTRA 3KD1E 3E4YA 1CLQA 3LZJA 4DTPA 3C6OB 4FJ9A 1XVEE 4FK2A 3CFPA 2DY4A 2JH8A 4ADOA 1FZIE 4DTUA 3UIQA 2LF6A 4EP9A 4DTJA 1MHYG 4FK0A 1FZ8E 3WSOA 1MTYG 1XVBE 4KHSA 3J27A 4M3YA 4AKIA 2VJ4A 3L8BA 1MHZG 4FJJA 4FJXA 4DTMA 3SPYA 3RMAA 2OVPB 3NE6A 1XMFE 1XVFE 1Q9YA 2DEBA 2MMBA 4J2EA 4FJKA 4E3SA 3QEWA 4AKGA 2RCUA 4M45A 1FZ7E 4HCCA 4JRQA 4KHYA 2YB5A 3S9HA 3K2OA 5IBKB 1Q9XA 4KHNA 2HD0A 4M41A 2OZMA 4M3RA 3NCIA 4AI6A 4FJHA 2VJ5A 3TL8B 4JRPA 1WAFA 4EYWA 3SUOA 4J2AA 3SNNA 2K5SA 1FXXA 2OVRB 3SI6A 3MKSB 4FJ8A 2B1EA 2VIXA 2JHPA 3TAFA 3SUQA 2MW2A 1FZ5E 1FPOA 4DTNA 3RMDA 4DTOA 4I9QA 1FZ2E 2E31A 4J2DA 3CFOA 3SQ2A 3OGMB 3NDKA 4FJGA 4M42A 3NGIA 4GAMC 3HL8A 4JS5A 2RKHA 4E4BA 3CFRA 3C94A 1XVDE 1P22A 2JHCA 3RWUA 2JQTA 4DU1A 4M3TA 3L2OB 1XMGE 1FZHE 3TJYA
chains in the Genus database with same CATH topology
2LF3A 1MMOG 3NAEA 3TAEA 4HCBA 1FS1A 3LD8A 4DU3A 2H4TA 2FYOA 4QNCA 4JS4A 4DTXA 4FJIA 4RL5A 1IH7A 2B7MA 3N1EA 4ADNA 2OYQA 4J2BA 4M3ZA 4FJMA 4M3UA 3QEIA 4KI4A 4KI6A 3QERA 4DTSA 3HGLA 4FK4A 1FZ1E 3E4WA 3RMBA 4FJ5A 3L0MA 3OGLB 3SUNA 3RMCA 3TAGA 2MZWB 1FZ9E 2P1MB 3SUPA 2P5GA 3SQ4A 3LZIA 1WAJA 3SVIA 2ATQA 4B08A 2P1PB 2FW3A 1XVCE 4EPHA 3TABA 1FZ4E 3QNOA 3C95A 2JPNA 2QXFA 2JH9A 4RG8A 5IZ7A 4M3XA 3V7DB 1XU5E 1XU3E 2JHAA 4RNGA 3SQ1A 4M3WA 3QETA 5IREA 4FJ7A 3NHGA 3LDSA 4FJNA 3L1NA 1NEXB 4X5NA 1XMHE 3OGKB 5H37A 3QEXA 1FYZE 4I9LA 2PFVA 1XVGE 4X5MA 3SJJA 2P1NB 3QESA 1IG9A 2DTUA 4FVMA 1FZ3E 2P5OA 3J2PA 2OZSA 4I6JB 1LDKE 4KHUA 2P1QB 4QNDA 4KHQA 2OVQB 4DU4A 3C6PB 2PFTA 3C6NB 3QNNA 3KD5E 4KHWA 1XL3C 3LDBA 3QEVA 3SQ0A 3SCXA 4AKHA 3N1BA 3CQ8A 1FZ0E 1FZ6E 2P1OB 4FJLA 3HP9A 2B8IA 3HGKE 3QEPA 2E32A 3SPZA 4DTRA 3KD1E 3E4YA 1CLQA 3LZJA 4DTPA 3C6OB 4FJ9A 1XVEE 4FK2A 3CFPA 2DY4A 2JH8A 4ADOA 1FZIE 4DTUA 3UIQA 2LF6A 4EP9A 4DTJA 1MHYG 4FK0A 1FZ8E 3WSOA 1MTYG 1XVBE 4KHSA 3J27A 4M3YA 4AKIA 2VJ4A 3L8BA 1MHZG 4FJJA 4FJXA 4DTMA 3SPYA 3RMAA 2OVPB 3NE6A 1XMFE 1XVFE 1Q9YA 2DEBA 2MMBA 4J2EA 4FJKA 4E3SA 3QEWA 4AKGA 2RCUA 4M45A 1FZ7E 4HCCA 4JRQA 4KHYA 2YB5A 3S9HA 3K2OA 5IBKB 1Q9XA 4KHNA 2HD0A 4M41A 2OZMA 4M3RA 3NCIA 4AI6A 4FJHA 2VJ5A 3TL8B 4JRPA 1WAFA 4EYWA 3SUOA 4J2AA 3SNNA 1FXXA 2OVRB 3SI6A 3MKSB 4FJ8A 2B1EA 2VIXA 2JHPA 3TAFA 3SUQA 1FZ5E 3RMDA 4DTNA 4DTOA 4I9QA 1FZ2E 2E31A 4J2DA 3CFOA 3SQ2A 3OGMB 3NDKA 4FJGA 4M42A 3NGIA 4GAMC 3HL8A 4JS5A 4E4BA 3CFRA 3C94A 1XVDE 1P22A 2JHCA 3RWUA 4DU1A 4M3TA 3L2OB 1XMGE 1FZHE 3TJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JPN A; 
#chains in the Genus database with same CATH topology
 2LF3 A;  1MMO G;  3NAE A;  3TAE A;  3UO3 A;  1FS1 A;  4HCB A;  3LD8 A;  4DU3 A;  2H4T A;  2FYO A;  4QNC A;  4JS4 A;  4DTX A;  4FJI A;  4RL5 A;  1IH7 A;  2B7M A;  3N1E A;  4ADN A;  2OYQ A;  4J2B A;  4M3Z A;  4FJM A;  4M3U A;  3QEI A;  4KI4 A;  4KI6 A;  3QER A;  4DTS A;  3HGL A;  4FK4 A;  1FZ1 E;  3E4W A;  3RMB A;  4FJ5 A;  3L0M A;  3OGL B;  3SUN A;  3RMC A;  3TAG A;  2MZW B;  1FZ9 E;  2P1M B;  3SUP A;  2P5G A;  3SQ4 A;  3LZI A;  1WAJ A;  3SVI A;  2ATQ A;  3BVO A;  4B08 A;  2P1P B;  2FW3 A;  1XVC E;  4EPH A;  3TAB A;  1FZ4 E;  3QNO A;  3C95 A;  2JPN A;  2QXF A;  2JH9 A;  4RG8 A;  5IZ7 A;  4M3X A;  3V7D B;  1XU5 E;  1XU3 E;  2JHA A;  4RNG A;  3SQ1 A;  4M3W A;  1N1C A;  3QET A;  5IRE A;  4FJ7 A;  3NHG A;  3LDS A;  4FJN A;  3L1N A;  1NEX B;  4X5N A;  1XMH E;  3OGK B;  5H37 A;  3QEX A;  1FYZ E;  4I9L A;  2PFV A;  1JW2 A;  1XVG E;  4X5M A;  3SJJ A;  2P1N B;  3QES A;  1IG9 A;  2DTU A;  4FVM A;  3UO2 A;  1FZ3 E;  2P5O A;  3J2P A;  2OZS A;  4I6J B;  1LDK E;  4KHU A;  2P1Q B;  4QND A;  4IT5 A;  4KHQ A;  2OVQ B;  4DU4 A;  3C6P B;  2PFT A;  3C6N B;  3QNN A;  3KD5 E;  4KHW A;  1XL3 C;  3LDB A;  3QEV A;  3SQ0 A;  3SCX A;  4AKH A;  3N1B A;  3CQ8 A;  1FZ0 E;  1FZ6 E;  2P1O B;  4FJL A;  3HP9 A;  2B8I A;  3HGK E;  3QEP A;  2E32 A;  3SPZ A;  4ICG C;  4DTR A;  3KD1 E;  3E4Y A;  1CLQ A;  3LZJ A;  4DTP A;  3C6O B;  4FJ9 A;  1XVE E;  4FK2 A;  3CFP A;  2DY4 A;  2JH8 A;  4ADO A;  1FZI E;  4DTU A;  3UIQ A;  2LF6 A;  4EP9 A;  4DTJ A;  1MHY G;  4FK0 A;  1FZ8 E;  3WSO A;  1MTY G;  1XVB E;  4KHS A;  3J27 A;  4M3Y A;  4AKI A;  2VJ4 A;  3L8B A;  1MHZ G;  4FJJ A;  4FJX A;  4DTM A;  3SPY A;  3RMA A;  2OVP B;  3NE6 A;  1XMF E;  1XVF E;  1Q9Y A;  2DEB A;  2MMB A;  4J2E A;  4FJK A;  4E3S A;  3QEW A;  4AKG A;  2RCU A;  4M45 A;  1FZ7 E;  4HCC A;  4JRQ A;  4KHY A;  2YB5 A;  3S9H A;  3K2O A;  5IBK B;  1Q9X A;  4KHN A;  2HD0 A;  4M41 A;  2OZM A;  4M3R A;  3NCI A;  4AI6 A;  4FJH A;  2VJ5 A;  3TL8 B;  4JRP A;  1WAF A;  4EYW A;  3SUO A;  4J2A A;  3SNN A;  2K5S A;  1FXX A;  2OVR B;  3SI6 A;  3MKS B;  4FJ8 A;  2B1E A;  2VIX A;  2JHP A;  3TAF A;  3SUQ A;  2MW2 A;  1FZ5 E;  1FPO A;  4DTN A;  3RMD A;  4DTO A;  4I9Q A;  1FZ2 E;  2E31 A;  4J2D A;  3CFO A;  3SQ2 A;  3OGM B;  3NDK A;  4FJG A;  4M42 A;  3NGI A;  4GAM C;  3HL8 A;  4JS5 A;  2RKH A;  4E4B A;  3CFR A;  3C94 A;  1XVD E;  1P22 A;  2JHC A;  3RWU A;  2JQT A;  4DU1 A;  4M3T A;  3L2O B;  1XMG E;  1FZH E;  3TJY A; 
#chains in the Genus database with same CATH homology
 2LF3 A;  1MMO G;  3NAE A;  3TAE A;  4HCB A;  1FS1 A;  3LD8 A;  4DU3 A;  2H4T A;  2FYO A;  4QNC A;  4JS4 A;  4DTX A;  4FJI A;  4RL5 A;  1IH7 A;  2B7M A;  3N1E A;  4ADN A;  2OYQ A;  4J2B A;  4M3Z A;  4FJM A;  4M3U A;  3QEI A;  4KI4 A;  4KI6 A;  3QER A;  4DTS A;  3HGL A;  4FK4 A;  1FZ1 E;  3E4W A;  3RMB A;  4FJ5 A;  3L0M A;  3OGL B;  3SUN A;  3RMC A;  3TAG A;  2MZW B;  1FZ9 E;  2P1M B;  3SUP A;  2P5G A;  3SQ4 A;  3LZI A;  1WAJ A;  3SVI A;  2ATQ A;  4B08 A;  2P1P B;  2FW3 A;  1XVC E;  4EPH A;  3TAB A;  1FZ4 E;  3QNO A;  3C95 A;  2JPN A;  2QXF A;  2JH9 A;  4RG8 A;  5IZ7 A;  4M3X A;  3V7D B;  1XU5 E;  1XU3 E;  2JHA A;  4RNG A;  3SQ1 A;  4M3W A;  3QET A;  5IRE A;  4FJ7 A;  3NHG A;  3LDS A;  4FJN A;  3L1N A;  1NEX B;  4X5N A;  1XMH E;  3OGK B;  5H37 A;  3QEX A;  1FYZ E;  4I9L A;  2PFV A;  1XVG E;  4X5M A;  3SJJ A;  2P1N B;  3QES A;  1IG9 A;  2DTU A;  4FVM A;  1FZ3 E;  2P5O A;  3J2P A;  2OZS A;  4I6J B;  1LDK E;  4KHU A;  2P1Q B;  4QND A;  4KHQ A;  2OVQ B;  4DU4 A;  3C6P B;  2PFT A;  3C6N B;  3QNN A;  3KD5 E;  4KHW A;  1XL3 C;  3LDB A;  3QEV A;  3SQ0 A;  3SCX A;  4AKH A;  3N1B A;  3CQ8 A;  1FZ0 E;  1FZ6 E;  2P1O B;  4FJL A;  3HP9 A;  2B8I A;  3HGK E;  3QEP A;  2E32 A;  3SPZ A;  4DTR A;  3KD1 E;  3E4Y A;  1CLQ A;  3LZJ A;  4DTP A;  3C6O B;  4FJ9 A;  1XVE E;  4FK2 A;  3CFP A;  2DY4 A;  2JH8 A;  4ADO A;  1FZI E;  4DTU A;  3UIQ A;  2LF6 A;  4EP9 A;  4DTJ A;  1MHY G;  4FK0 A;  1FZ8 E;  3WSO A;  1MTY G;  1XVB E;  4KHS A;  3J27 A;  4M3Y A;  4AKI A;  2VJ4 A;  3L8B A;  1MHZ G;  4FJJ A;  4FJX A;  4DTM A;  3SPY A;  3RMA A;  2OVP B;  3NE6 A;  1XMF E;  1XVF E;  1Q9Y A;  2DEB A;  2MMB A;  4J2E A;  4FJK A;  4E3S A;  3QEW A;  4AKG A;  2RCU A;  4M45 A;  1FZ7 E;  4HCC A;  4JRQ A;  4KHY A;  2YB5 A;  3S9H A;  3K2O A;  5IBK B;  1Q9X A;  4KHN A;  2HD0 A;  4M41 A;  2OZM A;  4M3R A;  3NCI A;  4AI6 A;  4FJH A;  2VJ5 A;  3TL8 B;  4JRP A;  1WAF A;  4EYW A;  3SUO A;  4J2A A;  3SNN A;  1FXX A;  2OVR B;  3SI6 A;  3MKS B;  4FJ8 A;  2B1E A;  2VIX A;  2JHP A;  3TAF A;  3SUQ A;  1FZ5 E;  3RMD A;  4DTN A;  4DTO A;  4I9Q A;  1FZ2 E;  2E31 A;  4J2D A;  3CFO A;  3SQ2 A;  3OGM B;  3NDK A;  4FJG A;  4M42 A;  3NGI A;  4GAM C;  3HL8 A;  4JS5 A;  4E4B A;  3CFR A;  3C94 A;  1XVD E;  1P22 A;  2JHC A;  3RWU A;  4DU1 A;  4M3T A;  3L2O B;  1XMG E;  1FZH E;  3TJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...