2JPRA

Joint refinement of the hiv-1 ca-ntd in complex with the assembly inhibitor cap-1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
145
structure length
145
Chain Sequence
b'PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title Structure of the Antiviral Assembly Inhibitor CAP-1 Complex with the HIV-1 CA Protein
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Viral protein
total genus 49
structure length 145
sequence length 145
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2jprA00
2X82A 2WLVB 2X2DD 2X83A 2Y4ZA 4J93A 1AK4C 4XFYA 4PH3A 2PWMA 4DGAC 1G03A 1QRJA 2XGVA 3H47A 2JPRA 2XDEA 4U0FA 1M9CC 1M9XC 1M9DC 1P7NA 2XGYA 4E92A 4B4NA 1EIAA 4DGEC 1GWPA 2M8NA 2GOLB 1L6NA 4WYMA 2PXRC 3MGEA 1M9EC 3P05A 2WLVA 3H4EA 4U0DA 4U0EA 2V4XA 1EM9A 2LF4A 4U0AA 5HGKA 1M9YC 3NTEA 4U0BA 4PH0A 5HGOA 4INBA 1E6JP 4E91A 5JPAA 5HGMA 4XFXA 4HTWA 4PH2A 4XFZA 1AFVA 4QNBA 4XRQA 2GONA 5HGNA 2PWOA 4U0CA 4XROA 1U7KA 2M8LA 4NX4C 2KGFA 1D1DA 4LQWC 2EIAA 2M8PA 3BP9A 2XGUA 1M9FC 5HGLA
chains in the Genus database with same CATH superfamily
2X82A 2WLVB 2X2DD 2X83A 2Y4ZA 4J93A 1AK4C 4XFYA 4PH3A 2PWMA 4DGAC 1G03A 1QRJA 2XGVA 3H47A 2JPRA 2XDEA 4U0FA 1M9CC 1M9XC 1M9DC 1P7NA 2XGYA 4E92A 4B4NA 1EIAA 4DGEC 1GWPA 2M8NA 2GOLB 1L6NA 4WYMA 2PXRC 3MGEA 1M9EC 3P05A 2WLVA 3H4EA 4U0DA 4U0EA 2V4XA 1EM9A 2LF4A 4U0AA 5HGKA 1M9YC 3NTEA 4U0BA 4PH0A 5HGOA 4INBA 1E6JP 4E91A 5JPAA 5HGMA 4XFXA 4HTWA 4PH2A 4XFZA 1AFVA 4QNBA 4XRQA 2GONA 5HGNA 2PWOA 4U0CA 4XROA 1U7KA 2M8LA 4NX4C 2KGFA 1D1DA 4LQWC 2EIAA 2M8PA 3BP9A 2XGUA 1M9FC 5HGLA
chains in the Genus database with same CATH topology
2X82A 2WLVB 2X2DD 2X83A 2Y4ZA 4J93A 1AK4C 4XFYA 4PH3A 2PWMA 4DGAC 1G03A 1QRJA 2XGVA 3H47A 2JPRA 2XDEA 4U0FA 1M9CC 1M9XC 1M9DC 1P7NA 2XGYA 4E92A 4B4NA 1EIAA 4DGEC 1GWPA 2M8NA 2GOLB 1L6NA 4WYMA 2PXRC 3MGEA 1M9EC 3P05A 2WLVA 3H4EA 4U0DA 4U0EA 2V4XA 1EM9A 2LF4A 4U0AA 5HGKA 1M9YC 3NTEA 4U0BA 4PH0A 5HGOA 4INBA 1E6JP 4E91A 5JPAA 5HGMA 4XFXA 4HTWA 4PH2A 4XFZA 1AFVA 4QNBA 4XRQA 2GONA 5HGNA 2PWOA 4U0CA 4XROA 1U7KA 2M8LA 4NX4C 2KGFA 1D1DA 4LQWC 2EIAA 2M8PA 3BP9A 2XGUA 1M9FC 5HGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X82 A;  2WLV B;  2X2D D;  2X83 A;  2Y4Z A;  4J93 A;  1AK4 C;  4XFY A;  4PH3 A;  2PWM A;  4DGA C;  1G03 A;  1QRJ A;  2XGV A;  3H47 A;  2JPR A;  2XDE A;  4U0F A;  1M9C C;  1M9X C;  1M9D C;  1P7N A;  2XGY A;  4E92 A;  4B4N A;  1EIA A;  4DGE C;  1GWP A;  2M8N A;  2GOL B;  1L6N A;  4WYM A;  2PXR C;  3MGE A;  1M9E C;  3P05 A;  2WLV A;  3H4E A;  4U0D A;  4U0E A;  2V4X A;  1EM9 A;  2LF4 A;  4U0A A;  5HGK A;  1M9Y C;  3NTE A;  4U0B A;  4PH0 A;  5HGO A;  4INB A;  1E6J P;  4E91 A;  5JPA A;  5HGM A;  4XFX A;  4HTW A;  4PH2 A;  4XFZ A;  1AFV A;  4QNB A;  4XRQ A;  2GON A;  5HGN A;  2PWO A;  4U0C A;  4XRO A;  1U7K A;  2M8L A;  4NX4 C;  2KGF A;  1D1D A;  4LQW C;  2EIA A;  2M8P A;  3BP9 A;  2XGU A;  1M9F C;  5HGL A; 
#chains in the Genus database with same CATH topology
 2X82 A;  2WLV B;  2X2D D;  2X83 A;  2Y4Z A;  4J93 A;  1AK4 C;  4XFY A;  4PH3 A;  2PWM A;  4DGA C;  1G03 A;  1QRJ A;  2XGV A;  3H47 A;  2JPR A;  2XDE A;  4U0F A;  1M9C C;  1M9X C;  1M9D C;  1P7N A;  2XGY A;  4E92 A;  4B4N A;  1EIA A;  4DGE C;  1GWP A;  2M8N A;  2GOL B;  1L6N A;  4WYM A;  2PXR C;  3MGE A;  1M9E C;  3P05 A;  2WLV A;  3H4E A;  4U0D A;  4U0E A;  2V4X A;  1EM9 A;  2LF4 A;  4U0A A;  5HGK A;  1M9Y C;  3NTE A;  4U0B A;  4PH0 A;  5HGO A;  4INB A;  1E6J P;  4E91 A;  5JPA A;  5HGM A;  4XFX A;  4HTW A;  4PH2 A;  4XFZ A;  1AFV A;  4QNB A;  4XRQ A;  2GON A;  5HGN A;  2PWO A;  4U0C A;  4XRO A;  1U7K A;  2M8L A;  4NX4 C;  2KGF A;  1D1D A;  4LQW C;  2EIA A;  2M8P A;  3BP9 A;  2XGU A;  1M9F C;  5HGL A; 
#chains in the Genus database with same CATH homology
 2X82 A;  2WLV B;  2X2D D;  2X83 A;  2Y4Z A;  4J93 A;  1AK4 C;  4XFY A;  4PH3 A;  2PWM A;  4DGA C;  1G03 A;  1QRJ A;  2XGV A;  3H47 A;  2JPR A;  2XDE A;  4U0F A;  1M9C C;  1M9X C;  1M9D C;  1P7N A;  2XGY A;  4E92 A;  4B4N A;  1EIA A;  4DGE C;  1GWP A;  2M8N A;  2GOL B;  1L6N A;  4WYM A;  2PXR C;  3MGE A;  1M9E C;  3P05 A;  2WLV A;  3H4E A;  4U0D A;  4U0E A;  2V4X A;  1EM9 A;  2LF4 A;  4U0A A;  5HGK A;  1M9Y C;  3NTE A;  4U0B A;  4PH0 A;  5HGO A;  4INB A;  1E6J P;  4E91 A;  5JPA A;  5HGM A;  4XFX A;  4HTW A;  4PH2 A;  4XFZ A;  1AFV A;  4QNB A;  4XRQ A;  2GON A;  5HGN A;  2PWO A;  4U0C A;  4XRO A;  1U7K A;  2M8L A;  4NX4 C;  2KGF A;  1D1D A;  4LQW C;  2EIA A;  2M8P A;  3BP9 A;  2XGU A;  1M9F C;  5HGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...