2JPSA

Nab2 n-terminal domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
MSQEQYTENLKVIVAEKLAGIPNFNEDIKYVAEYIVLLIVNGGTVESVVDELASLFDSVSRDTLANVVQTAFFALEALQQGESAENIVSKIRMMNAQSLGQSDIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear polyadenylated RNA-binding protein NAB2
publication title Structure of the N-terminal Mlp1-binding domain of the Saccharomyces cerevisiae mRNA-binding protein, Nab2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 30
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11517 Nab2 Nuclear abundant poly(A) RNA-bind protein 2 (Nab2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.40 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 2jpsA00
2JPSA 3LCNA 2V75A
chains in the Genus database with same CATH superfamily
3IH7A 4DK9A 3D4VA 2H56A 3NNQA 1EBMA 4YOQA 4BDZA 2NOIA 3FSPA 3L2VA 3S3MA 1LWWA 4EA4A 1LWYA 1PU8A 4NZGA 3CW7A 2OFKA 1M3HA 3OGDA 3I0WA 1DIZA 2NOHA 5FRMA 1WEIA 1YQRA 3FHFA 3OYBA 3OYFA 1P59A 4OFEA 4BE1A 3CWSA 1MPGA 3OH6A 5DPKA 3OYNA 4BACA 4E9GA 1P7MA 3OS0A 1KG6A 4OFAA 1N3AA 1XG7A 2JPSA 3OYGA 3OY9A 5CHZA 2OFIA 4E9HA 4EJZA 3OYLA 3CVTA 1LMZA 3OYAA 5KN8A 4BDYA 4YPHA 2XHIA 3L2QA 4EJYA 1PU7A 4AIAA 1MUYA 3OS1A 1MUDA 4B23A 4E7IA 4ZTJA 4PIIA 4EW0A 1FN7A 1VRLA 3VW4A 4OFHA 3OYHA 2W04A 4EVVA 1KG3A 4E9EA 1U84A 3OYMA 4YPRA 3N5NX 3KTUA 1HU0A 1MUNA 4BE0A 1N39A 2NOLA 2NOZA 3CWAA 3S3NA 1YQLA 5KN9A 4E9FA 1KG7A 1KG4A 3F0ZA 4EA5A 3F10A 2JHNA 3S6IA 4BE2A 1PVSA 1M3QA 3G0QA 3OYIA 3OYDA 4B22A 3CWTA 4IKFA 4E7HA 2YG8A 3FHGA 4B24A 3I0XA 4UOBA 3LCNA 4AI5A 2YG9A 3KNTA 3CVSA 1XQOA 1KQJA 1YQMA 4B21A 2NOFA 2W03A 4HSBA 2NOEA 1XQPA 1RRSA 3L2UA 4E7KA 1PU6A 4E7LA 3CWUA 1ORNA 1NKUA 2JHJA 1ORPA 2JG6A 1KG2A 3OS2A 3L2WA 3S3OA 1KO9A 4EW4A 2ABKA 4E7JA 3OYJA 4ZTFA 3R2XC 3OYEA 3OYKA 2NOBA 3N0UA 1YQKA 1WEGA 4UNFA 2I5WA 1N3CA 1LWVA 4AI4A 1RRQA 5FRNA 3IHOA 1NGNA 5FROA 1KEAA 5AN4A 3OYCA 3OH9A 3L2RA 1WEFA 1KG5A 2V75A
chains in the Genus database with same CATH topology
3NNQA 3OS0A 4BE0A 3L2UA 4E7KA 2JPSA 4BDZA 3OYGA 3L2VA 4E7LA 3OY9A 3S3NA 3S3MA 4NZGA 3OS2A 3OYLA 3L2WA 4BE2A 3OYAA 3S3OA 5FRMA 4BDYA 4E7JA 3OYJA 4ZTFA 3OYBA 3OYFA 3L2QA 3OYIA 3OYDA 3OYEA 4IKFA 3OYKA 4BE1A 4E7HA 3OS1A 4E7IA 4ZTJA 3LCNA 3VW4A 5FRNA 3OYHA 2W04A 3OYNA 5FROA 3OYCA 3L2RA 4BACA 2W03A 3OYMA 2V75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JPS A;  3LCN A;  2V75 A; 
#chains in the Genus database with same CATH topology
 3IH7 A;  4DK9 A;  3D4V A;  2H56 A;  3NNQ A;  1EBM A;  4YOQ A;  4BDZ A;  2NOI A;  3FSP A;  3L2V A;  3S3M A;  1LWW A;  4EA4 A;  1LWY A;  1PU8 A;  4NZG A;  3CW7 A;  2OFK A;  1M3H A;  3OGD A;  3I0W A;  1DIZ A;  2NOH A;  5FRM A;  1WEI A;  1YQR A;  3FHF A;  3OYB A;  3OYF A;  1P59 A;  4OFE A;  4BE1 A;  3CWS A;  1MPG A;  3OH6 A;  5DPK A;  3OYN A;  4BAC A;  4E9G A;  1P7M A;  3OS0 A;  1KG6 A;  4OFA A;  1N3A A;  1XG7 A;  2JPS A;  3OYG A;  3OY9 A;  5CHZ A;  2OFI A;  4E9H A;  4EJZ A;  3OYL A;  3CVT A;  1LMZ A;  3OYA A;  5KN8 A;  4BDY A;  4YPH A;  2XHI A;  3L2Q A;  4EJY A;  1PU7 A;  4AIA A;  1MUY A;  3OS1 A;  1MUD A;  4B23 A;  4E7I A;  4ZTJ A;  4PII A;  4EW0 A;  1FN7 A;  1VRL A;  3VW4 A;  4OFH A;  3OYH A;  2W04 A;  4EVV A;  1KG3 A;  4E9E A;  1U84 A;  3OYM A;  4YPR A;  3N5N X;  3KTU A;  1HU0 A;  1MUN A;  4BE0 A;  1N39 A;  2NOL A;  2NOZ A;  3CWA A;  3S3N A;  1YQL A;  5KN9 A;  4E9F A;  1KG7 A;  1KG4 A;  3F0Z A;  4EA5 A;  3F10 A;  2JHN A;  3S6I A;  4BE2 A;  1PVS A;  1M3Q A;  3G0Q A;  3OYI A;  3OYD A;  4B22 A;  3CWT A;  4IKF A;  4E7H A;  2YG8 A;  3FHG A;  4B24 A;  3I0X A;  4UOB A;  3LCN A;  4AI5 A;  2YG9 A;  3KNT A;  3CVS A;  1XQO A;  1KQJ A;  1YQM A;  4B21 A;  2NOF A;  2W03 A;  4HSB A;  2NOE A;  1XQP A;  1RRS A;  3L2U A;  4E7K A;  1PU6 A;  4E7L A;  3CWU A;  1ORN A;  1NKU A;  2JHJ A;  1ORP A;  2JG6 A;  1KG2 A;  3OS2 A;  3L2W A;  3S3O A;  1KO9 A;  4EW4 A;  2ABK A;  4E7J A;  3OYJ A;  4ZTF A;  3R2X C;  3OYE A;  3OYK A;  2NOB A;  3N0U A;  1YQK A;  1WEG A;  4UNF A;  2I5W A;  1N3C A;  1LWV A;  4AI4 A;  1RRQ A;  5FRN A;  3IHO A;  1NGN A;  5FRO A;  1KEA A;  5AN4 A;  3OYC A;  3OH9 A;  3L2R A;  1WEF A;  1KG5 A;  2V75 A; 
#chains in the Genus database with same CATH homology
 3NNQ A;  3OS0 A;  4BE0 A;  3L2U A;  4E7K A;  2JPS A;  4BDZ A;  3OYG A;  3L2V A;  4E7L A;  3OY9 A;  3S3N A;  3S3M A;  4NZG A;  3OS2 A;  3OYL A;  3L2W A;  4BE2 A;  3OYA A;  3S3O A;  5FRM A;  4BDY A;  4E7J A;  3OYJ A;  4ZTF A;  3OYB A;  3OYF A;  3L2Q A;  3OYI A;  3OYD A;  3OYE A;  4IKF A;  3OYK A;  4BE1 A;  4E7H A;  3OS1 A;  4E7I A;  4ZTJ A;  3LCN A;  3VW4 A;  5FRN A;  3OYH A;  2W04 A;  3OYN A;  5FRO A;  3OYC A;  3L2R A;  4BAC A;  2W03 A;  3OYM A;  2V75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...