2JQ4A

Complete resonance assignments and solution structure calculation of atc2521 (nesg id: att6) from agrobacterium tumefaciens
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
MNATIREILAKFGQLPTPVDTIADEADLYAAGLSSFASVQLMLGIEEAFDIEFPDNLLNRKSFASIKAIEDTVKLILDGKEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of a protein (ATC2521)of unknown function from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens
molecule tags Structural genomics
molecule keywords Hypothetical protein Atu2571
total genus 23
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2jq4A00
2LIWA 1T8KA 2K93A 2L0QA 4MRTC 2KOSA 1OR5A 3GZLA 2FADA 2KG8A 2KOQA 2K94A 2KGAA 3CE7A 1HY8A 1KLPA 2N98A 3EJEA 4CA3A 1L0IA 2LIUA 2EHSA 2FQ2A 5HV8A 3EJDA 2KG6A 4R0MA 3NY7B 2CG5B 2XZ1C 4DG9A 2AFDA 2QNWA 5EJDA 2FAEA 2FACA 1F80D 2L4BA 2PNGA 3EJBA 3RG2A 4IZ6A 2N6ZA 2K2QA 4HKGA 2MF4A 2N50A 2KGCA 2FVEA 2FHSC 2L9FA 4H2XC 4H2WC 2GDYA 2AF8A 4BPGA 2KR5A 5KP8B 2MD9A 2JU2A 4BPHA 2LPKA 1NQ4A 2LOLA 2JQ4A 2L22A 4BPFA 1HQBA 2MR7A 2MVVA 4PWVB 2XZ0D 4NEOA 1DNYA 2JGPA 1X3OA 1AF8A 2MR8A 2N6YA 2KWLA 2KOOA 2KOPA 3LMOA 2AFEA 2FVFA 1DV5A 2FVAA 2GDXA 2K0YA 5HVCA 2LTEA 2K0XA 2N5IA 5CZDB 2M5RA 2CQ8A 3GZMA 4H2YC 2CGQA 2DNWA 2LL8A 2ROQA 2VSQA 2MY5A 2KG9A 2K92A 2LKIA 2KGEA 2KW2A 2FQ1A 2X2BA 2N5HA 1L0HA 2EHTA 4PXHB 1ACPA 1VKUA 2AVAA 2MVUA 2LMLA 2FQ0A 2JU1A 5KP6B 2CNRA 5KP7B 2KORA 2KGDA 2GDWA
chains in the Genus database with same CATH superfamily
1T8KA 4PH1A 2K93A 3GKLC 4MRTC 3GZLA 2JYLA 3DS3A 2K94A 2KGAA 2KODA 4M0IA 3H4EA 1L0IA 2LIUA 2XXMA 2EHSA 3EJDA 5HGLA 3CCMP 1MZ8A 4WYMA 1K73Q 1Q86Q 1YIJP 1VQPP 3B5IA 2CWOA 1VQ4P 3G1GA 1VQLP 2GZJA 2M8NA 2L4BA 4COPA 3CCVP 3G6EP 1YJWP 2PY8A 4HKGA 3CC4P 2OARA 1CEIA 2VLQA 1E0HA 4H2WC 2VLPA 2AF8A 1W2BO 3CCEP 2PEIA 1M1KQ 2L6EA 3DS1A 2JYGA 2MVVA 3CCJP 4PWVB 4NEOA 3CMEP 4PH0A 2JGPA 2P9XA 2ERHA 1Q82Q 2KOOA 1VQ6P 1N8RQ 2FVFA 1EOQA 4F37A 2BUOA 2K0XA 2N5IA 7CEIA 2PEKA 5BS1A 1IMPA 3CCLP 2XT1A 2VSQA 2DGYA 2KG9A 2QEXP 2KGEA 2M8LA 1RNIA 5KP6B 3DS5A 1Z6MA 1D1DA 2KOSA 1KLPA 1HY8A 1NJIQ 1IUQA 3WBHA 2FQ2A 3G71P 1VQ9P 1UJZA 4QKOA 2ONTA 2CG5B 2XZ1C 4DG9A 2Z46A 3HZQA 1VQMP 1GXHA 2FACA 3I55P 3CC2P 2GZEA 2PNGA 1QRJA 3EJBA 1E6JP 3MGEA 3GJNA 2N6ZA 2K2QA 2Z45A 2FVEA 1YJ9P 3CMAP 3CC7P 2PEJA 2PEOA 3G1IA 4BPGA 4BPHA 1GXGA 3CCSP 2MR7A 4U0FA 2XZ0D 1DNYA 5BS2A 1VQKP 1X3OA 5DCKA 3G26A 1JJ2O 2KWLA 1RO2A 2PENA 4U0CA 1AUMA 1DV5A 2GDXA 5F2KA 4U0BA 3G4SP 1IMQA 2JBGA 5HGOA 2LL8A 2PEQA 2KW2A 1K9MQ 2N5HA 3DS0A 1VKUA 2MVUA 2GYKA 5KP7B 2KGDA 1QVGO 3G0VA 2L0QA 1OR5A 2FADA 5F2OA 2KG8A 2KOQA 3CXCO 2N98A 2K0DX 4XFYA 4CA3A 1EMVA 4IPYA 5HV8A 2KG6A 5HGMA 2JO0A 4UHPB 3NY7B 5EW5E 3G29A 2QNWA 2FAEA 1F80D 1YHQP 3DTJA 1M6NA 1VQNP 1YI2P 2N50A 2KGCA 2K5XA 2OTJP 4GR2A 2EIAA 3CCUP 1VHNA 4XROA 4H2XC 5JPAA 2GDYA 1KD1Q 5KP8B 2JU2A 2JB0A 2LOLA 2JQ4A 5HGNA 4BPFA 1BXIA 1HQBA 4GR6A 4U0AA 3CPWO 1M74A 3OW2O 1AF8A 2MR8A 2BHVA 2N6YA 5I4TG 4XRQA 3LMOA 2FVAA 2VLOA 2K0YA 3E2DA 2M5RA 3M1MA 3Q20A 2PEMA 2GZIA 3G28A 3VRLC 2DNWA 2ROQA 2MY5A 2LKIA 1RO0A 2FQ1A 1L0HA 2EHTA 4PXHB 1ZNVA 1K30A 2AVAA 2LMLA 2JU1A 3HYBA 2KORA 2X2BA 3DS4A 4IZ6A 2GDWA 1A8OA 2JAZA 2LIWA 1VQ5P 1M90Q 4QNBA 2LF4A 1VQ7P 2GZGA 3CE7A 3EJEA 1QVFO 4XFZA 2QA4P 5F2NA 2OTLP 1S72P 4R0MA 1EIAA 2VLNA 2AFDA 3H47A 3DS2A 3CCRP 1GPJA 5EJDA 1K8AQ 4U0EA 3RG6C 4XFXA 3I56P 3CCQP 3RG2A 1VQOP 2EFJA 2MF4A 1UNKA 2FHSC 2L9FA 2NO8A 1ZMBA 1BAJA 1KC8Q 1VQ8P 2KR5A 3P05A 2MD9A 3U43A 3G21A 1A43A 4COCA 2LPKA 1NQ4A 1FR2A 2L22A 2EG5A 4U0DA 1Q81Q 3DPHA 2KOPA 2AFEA 3LRYA 3B4QA 5HVCA 1YJNP 3H0DA 2LTEA 1KQSO 5CZDB 1YITP 2CQ8A 2Z44A 1AYIA 3GZMA 4H2YC 2CGQA 2M8PA 2XV6A 1Q7YQ 2WPTA 2K92A 3CD6P 1ACPA 2E1MA 2FQ0A 1M6EX 2GZFA 3NTEA 2CNRA
chains in the Genus database with same CATH topology
2LIWA 1T8KA 2K93A 2L0QA 4MRTC 2KOSA 1OR5A 3GZLA 2FADA 2KG8A 2KOQA 2K94A 2KGAA 3CE7A 1HY8A 1KLPA 2N98A 3EJEA 4CA3A 1L0IA 2LIUA 2EHSA 2FQ2A 5HV8A 3EJDA 2KG6A 4R0MA 3NY7B 2CG5B 2XZ1C 4DG9A 2AFDA 2QNWA 5EJDA 2FAEA 2FACA 1F80D 2L4BA 2PNGA 3EJBA 3RG2A 4IZ6A 2N6ZA 2K2QA 4HKGA 2MF4A 2N50A 2KGCA 2FVEA 2FHSC 2L9FA 4H2XC 4H2WC 2GDYA 2AF8A 4BPGA 2KR5A 5KP8B 2MD9A 2JU2A 4BPHA 2LPKA 1NQ4A 2LOLA 2JQ4A 2L22A 4BPFA 1HQBA 2MR7A 2MVVA 4PWVB 2XZ0D 4NEOA 1DNYA 2JGPA 1X3OA 1AF8A 2MR8A 2N6YA 2KWLA 2KOOA 2KOPA 3LMOA 2AFEA 2FVFA 1DV5A 2FVAA 2GDXA 2K0YA 5HVCA 2LTEA 2K0XA 2N5IA 5CZDB 2M5RA 2CQ8A 3GZMA 4H2YC 2CGQA 2DNWA 2LL8A 2ROQA 2VSQA 2MY5A 2KG9A 2K92A 2LKIA 2KGEA 2KW2A 2FQ1A 2X2BA 2N5HA 1L0HA 2EHTA 4PXHB 1ACPA 1VKUA 2AVAA 2MVUA 2LMLA 2FQ0A 2JU1A 5KP6B 2CNRA 5KP7B 2KORA 2KGDA 2GDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LIW A;  1T8K A;  2K93 A;  2L0Q A;  4MRT C;  2KOS A;  1OR5 A;  3GZL A;  2FAD A;  2KG8 A;  2KOQ A;  2K94 A;  2KGA A;  3CE7 A;  1HY8 A;  1KLP A;  2N98 A;  3EJE A;  4CA3 A;  1L0I A;  2LIU A;  2EHS A;  2FQ2 A;  5HV8 A;  3EJD A;  2KG6 A;  4R0M A;  3NY7 B;  2CG5 B;  2XZ1 C;  4DG9 A;  2AFD A;  2QNW A;  5EJD A;  2FAE A;  2FAC A;  1F80 D;  2L4B A;  2PNG A;  3EJB A;  3RG2 A;  4IZ6 A;  2N6Z A;  2K2Q A;  4HKG A;  2MF4 A;  2N50 A;  2KGC A;  2FVE A;  2FHS C;  2L9F A;  4H2X C;  4H2W C;  2GDY A;  2AF8 A;  4BPG A;  2KR5 A;  5KP8 B;  2MD9 A;  2JU2 A;  4BPH A;  2LPK A;  1NQ4 A;  2LOL A;  2JQ4 A;  2L22 A;  4BPF A;  1HQB A;  2MR7 A;  2MVV A;  4PWV B;  2XZ0 D;  4NEO A;  1DNY A;  2JGP A;  1X3O A;  1AF8 A;  2MR8 A;  2N6Y A;  2KWL A;  2KOO A;  2KOP A;  3LMO A;  2AFE A;  2FVF A;  1DV5 A;  2FVA A;  2GDX A;  2K0Y A;  5HVC A;  2LTE A;  2K0X A;  2N5I A;  5CZD B;  2M5R A;  2CQ8 A;  3GZM A;  4H2Y C;  2CGQ A;  2DNW A;  2LL8 A;  2ROQ A;  2VSQ A;  2MY5 A;  2KG9 A;  2K92 A;  2LKI A;  2KGE A;  2KW2 A;  2FQ1 A;  2X2B A;  2N5H A;  1L0H A;  2EHT A;  4PXH B;  1ACP A;  1VKU A;  2AVA A;  2MVU A;  2LML A;  2FQ0 A;  2JU1 A;  5KP6 B;  2CNR A;  5KP7 B;  2KOR A;  2KGD A;  2GDW A; 
#chains in the Genus database with same CATH topology
 1T8K A;  4PH1 A;  2K93 A;  3GKL C;  4MRT C;  3GZL A;  2JYL A;  3DS3 A;  2K94 A;  2KGA A;  2KOD A;  4M0I A;  3H4E A;  1L0I A;  2LIU A;  2XXM A;  2EHS A;  3EJD A;  5HGL A;  3CCM P;  1MZ8 A;  4WYM A;  1K73 Q;  1Q86 Q;  1YIJ P;  1VQP P;  3B5I A;  2CWO A;  1VQ4 P;  3G1G A;  1VQL P;  2GZJ A;  2M8N A;  2L4B A;  4COP A;  3CCV P;  3G6E P;  1YJW P;  2PY8 A;  4HKG A;  3CC4 P;  2OAR A;  1CEI A;  2VLQ A;  1E0H A;  4H2W C;  2VLP A;  2AF8 A;  1W2B O;  3CCE P;  2PEI A;  1M1K Q;  2L6E A;  3DS1 A;  2JYG A;  2MVV A;  3CCJ P;  4PWV B;  4NEO A;  3CME P;  4PH0 A;  2JGP A;  2P9X A;  2ERH A;  1Q82 Q;  2KOO A;  1VQ6 P;  1N8R Q;  2FVF A;  1EOQ A;  4F37 A;  2BUO A;  2K0X A;  2N5I A;  7CEI A;  2PEK A;  5BS1 A;  1IMP A;  3CCL P;  2XT1 A;  2VSQ A;  2DGY A;  2KG9 A;  2QEX P;  2KGE A;  2M8L A;  1RNI A;  5KP6 B;  3DS5 A;  1Z6M A;  1D1D A;  2KOS A;  1KLP A;  1HY8 A;  1NJI Q;  1IUQ A;  3WBH A;  2FQ2 A;  3G71 P;  1VQ9 P;  1UJZ A;  4QKO A;  2ONT A;  2CG5 B;  2XZ1 C;  4DG9 A;  2Z46 A;  3HZQ A;  1VQM P;  1GXH A;  2FAC A;  3I55 P;  3CC2 P;  2GZE A;  2PNG A;  1QRJ A;  3EJB A;  1E6J P;  3MGE A;  3GJN A;  2N6Z A;  2K2Q A;  2Z45 A;  2FVE A;  1YJ9 P;  3CMA P;  3CC7 P;  2PEJ A;  2PEO A;  3G1I A;  4BPG A;  4BPH A;  1GXG A;  3CCS P;  2MR7 A;  4U0F A;  2XZ0 D;  1DNY A;  5BS2 A;  1VQK P;  1X3O A;  5DCK A;  3G26 A;  1JJ2 O;  2KWL A;  1RO2 A;  2PEN A;  4U0C A;  1AUM A;  1DV5 A;  2GDX A;  5F2K A;  4U0B A;  3G4S P;  1IMQ A;  2JBG A;  5HGO A;  2LL8 A;  2PEQ A;  2KW2 A;  1K9M Q;  2N5H A;  3DS0 A;  1VKU A;  2MVU A;  2GYK A;  5KP7 B;  2KGD A;  1QVG O;  3G0V A;  2L0Q A;  1OR5 A;  2FAD A;  5F2O A;  2KG8 A;  2KOQ A;  3CXC O;  2N98 A;  2K0D X;  4XFY A;  4CA3 A;  1EMV A;  4IPY A;  5HV8 A;  2KG6 A;  5HGM A;  2JO0 A;  4UHP B;  3NY7 B;  5EW5 E;  3G29 A;  2QNW A;  2FAE A;  1F80 D;  1YHQ P;  3DTJ A;  1M6N A;  1VQN P;  1YI2 P;  2N50 A;  2KGC A;  2K5X A;  2OTJ P;  4GR2 A;  2EIA A;  3CCU P;  1VHN A;  4XRO A;  4H2X C;  5JPA A;  2GDY A;  1KD1 Q;  5KP8 B;  2JU2 A;  2JB0 A;  2LOL A;  2JQ4 A;  5HGN A;  4BPF A;  1BXI A;  1HQB A;  4GR6 A;  4U0A A;  3CPW O;  1M74 A;  3OW2 O;  1AF8 A;  2MR8 A;  2BHV A;  2N6Y A;  5I4T G;  4XRQ A;  3LMO A;  2FVA A;  2VLO A;  2K0Y A;  3E2D A;  2M5R A;  3M1M A;  3Q20 A;  2PEM A;  2GZI A;  3G28 A;  3VRL C;  2DNW A;  2ROQ A;  2MY5 A;  2LKI A;  1RO0 A;  2FQ1 A;  1L0H A;  2EHT A;  4PXH B;  1ZNV A;  1K30 A;  2AVA A;  2LML A;  2JU1 A;  3HYB A;  2KOR A;  2X2B A;  3DS4 A;  4IZ6 A;  2GDW A;  1A8O A;  2JAZ A;  2LIW A;  1VQ5 P;  1M90 Q;  4QNB A;  2LF4 A;  1VQ7 P;  2GZG A;  3CE7 A;  3EJE A;  1QVF O;  4XFZ A;  2QA4 P;  5F2N A;  2OTL P;  1S72 P;  4R0M A;  1EIA A;  2VLN A;  2AFD A;  3H47 A;  3DS2 A;  3CCR P;  1GPJ A;  5EJD A;  1K8A Q;  4U0E A;  3RG6 C;  4XFX A;  3I56 P;  3CCQ P;  3RG2 A;  1VQO P;  2EFJ A;  2MF4 A;  1UNK A;  2FHS C;  2L9F A;  2NO8 A;  1ZMB A;  1BAJ A;  1KC8 Q;  1VQ8 P;  2KR5 A;  3P05 A;  2MD9 A;  3U43 A;  3G21 A;  1A43 A;  4COC A;  2LPK A;  1NQ4 A;  1FR2 A;  2L22 A;  2EG5 A;  4U0D A;  1Q81 Q;  3DPH A;  2KOP A;  2AFE A;  3LRY A;  3B4Q A;  5HVC A;  1YJN P;  3H0D A;  2LTE A;  1KQS O;  5CZD B;  1YIT P;  2CQ8 A;  2Z44 A;  1AYI A;  3GZM A;  4H2Y C;  2CGQ A;  2M8P A;  2XV6 A;  1Q7Y Q;  2WPT A;  2K92 A;  3CD6 P;  1ACP A;  2E1M A;  2FQ0 A;  1M6E X;  2GZF A;  3NTE A;  2CNR A; 
#chains in the Genus database with same CATH homology
 2LIW A;  1T8K A;  2K93 A;  2L0Q A;  4MRT C;  2KOS A;  1OR5 A;  3GZL A;  2FAD A;  2KG8 A;  2KOQ A;  2K94 A;  2KGA A;  3CE7 A;  1HY8 A;  1KLP A;  2N98 A;  3EJE A;  4CA3 A;  1L0I A;  2LIU A;  2EHS A;  2FQ2 A;  5HV8 A;  3EJD A;  2KG6 A;  4R0M A;  3NY7 B;  2CG5 B;  2XZ1 C;  4DG9 A;  2AFD A;  2QNW A;  5EJD A;  2FAE A;  2FAC A;  1F80 D;  2L4B A;  2PNG A;  3EJB A;  3RG2 A;  4IZ6 A;  2N6Z A;  2K2Q A;  4HKG A;  2MF4 A;  2N50 A;  2KGC A;  2FVE A;  2FHS C;  2L9F A;  4H2X C;  4H2W C;  2GDY A;  2AF8 A;  4BPG A;  2KR5 A;  5KP8 B;  2MD9 A;  2JU2 A;  4BPH A;  2LPK A;  1NQ4 A;  2LOL A;  2JQ4 A;  2L22 A;  4BPF A;  1HQB A;  2MR7 A;  2MVV A;  4PWV B;  2XZ0 D;  4NEO A;  1DNY A;  2JGP A;  1X3O A;  1AF8 A;  2MR8 A;  2N6Y A;  2KWL A;  2KOO A;  2KOP A;  3LMO A;  2AFE A;  2FVF A;  1DV5 A;  2FVA A;  2GDX A;  2K0Y A;  5HVC A;  2LTE A;  2K0X A;  2N5I A;  5CZD B;  2M5R A;  2CQ8 A;  3GZM A;  4H2Y C;  2CGQ A;  2DNW A;  2LL8 A;  2ROQ A;  2VSQ A;  2MY5 A;  2KG9 A;  2K92 A;  2LKI A;  2KGE A;  2KW2 A;  2FQ1 A;  2X2B A;  2N5H A;  1L0H A;  2EHT A;  4PXH B;  1ACP A;  1VKU A;  2AVA A;  2MVU A;  2LML A;  2FQ0 A;  2JU1 A;  5KP6 B;  2CNR A;  5KP7 B;  2KOR A;  2KGD A;  2GDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...