2JQ4A

Complete resonance assignments and solution structure calculation of atc2521 (nesg id: att6) from agrobacterium tumefaciens
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
MNATIREILAKFGQLPTPVDTIADEADLYAAGLSSFASVQLMLGIEEAFDIEFPDNLLNRKSFASIKAIEDTVKLILDGKEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Atu2571
publication title Solution Structure of a protein (ATC2521)of unknown function from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens
molecule tags Structural genomics
total genus 23
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2jq4A00
1L0IA 2JU1A 2N98A 2GDXA 2JGPA 4BPHA 5HVCA 2LIUA 4NEOA 1HQBA 2L9FA 4BPGA 2N6ZA 2L4BA 2CGQA 3GZMA 2LPKA 2LIWA 2KG8A 2XZ0D 5EJDA 2N6YA 2KOPA 2KG6A 1AF8A 2FQ2A 2GDYA 4H2XC 4H2WC 4CA3A 2DNWA 1T8KA 2AFDA 1X3OA 3EJEA 2CNRA 2MD9A 2JU2A 2K0XA 3CE7A 2FVFA 2KW2A 5CZDB 2X2BA 1HY8A 2LOLA 2FHSC 3LMOA 4PXHB 2GDWA 2MR7A 3NY7B 1VKUA 2ROQA 1NQ4A 2N50A 4MRTC 2L22A 2LMLA 1L0HA 5KP8B 2KOOA 2CQ8A 2LKIA 4BPFA 1OR5A 2FVEA 2K94A 2KGEA 2JQ4A 2MY5A 2FACA 2CG5B 2KGAA 2QNWA 4R0MA 2FVAA 2N5HA 2MVVA 2LL8A 2FQ1A 2M5RA 2KGCA 1F80D 2FADA 2K0YA 5KP7B 2N5IA 4DG9A 2EHSA 2MF4A 3GZLA 2KOQA 2AVAA 2K92A 2K2QA 2KGDA 2AF8A 2KG9A 4HKGA 2KR5A 5KP6B 2KORA 2MVUA 1KLPA 1ACPA 1DV5A 2MR8A 4PWVB 3EJBA 2FAEA 2XZ1C 2AFEA 2PNGA 2L0QA 2K93A 4H2YC 2EHTA 5HV8A 3EJDA 4IZ6A 2FQ0A 1DNYA 2KOSA 2LTEA 3RG2A 2KWLA 2VSQA
chains in the Genus database with same CATH superfamily
5F2OA 2N98A 2GZEA 4BPHA 5HGMA 3B5IA 2DGYA 2L9FA 4GR2A 4BPGA 2N6ZA 2CGQA 3G4SP 2LIWA 1D1DA 1YJWP 1IUQA 2FQ2A 1S72P 7CEIA 4H2XC 1GXHA 2M8NA 2AFDA 1X3OA 2PENA 1Q81Q 2JBGA 2K0XA 3H47A 5BS2A 4XFXA 1Q82Q 3CMEP 1E6JP 3CPWO 3LRYA 3G0VA 3DTJA 2FHSC 1M90Q 4PXHB 3DS4A 5I4TG 1ZNVA 3NY7B 1NQ4A 2PEKA 2CQ8A 3CCSP 3CCEP 3CCVP 4BPFA 4U0AA 4COPA 2KGEA 3G1GA 2KGAA 3CMAP 2N5HA 2JYLA 2MVVA 3CCJP 1GXGA 2FADA 1VQ6P 2N5IA 4DG9A 2EHSA 3G29A 2MF4A 1M6EX 3GZLA 1YIJP 2K2QA 4HKGA 5KP6B 2MVUA 3GJNA 3OW2O 1DV5A 4PWVB 2KODA 2PEJA 3G26A 2ERHA 2PNGA 2XXMA 2K93A 4H2YC 2GZJA 2KOSA 1M74A 3CCRP 1L0IA 1Q86Q 4WYMA 2JGPA 1JJ2O 1AYIA 2XV6A 1YITP 4XFZA 4NEOA 2L6EA 2L4BA 2K5XA 3GZMA 1N8RQ 2Z45A 5EJDA 1IMPA 2KG6A 3NTEA 2VLPA 1KD1Q 3DS3A 2DNWA 1BAJA 2VLQA 3I55P 1IMQA 1YI2P 1M1KQ 1QVGO 2PEMA 1HY8A 3CCQP 4U0BA 1K9MQ 4U0FA 2K0DX 2OTJP 1CEIA 1K30A 2ROQA 3WBHA 1FR2A 1RO0A 3P05A 1K8AQ 1OR5A 2Z44A 2JQ4A 2FACA 2CG5B 2FVAA 4UHPB 2FQ1A 2LF4A 2M5RA 5KP7B 3RG6C 2GZIA 5BS1A 3E2DA 2E1MA 1YJ9P 5HGNA 1Z6MA 1YJNP 2K92A 2KGDA 2NO8A 5F2NA 2QEXP 5HGOA 2GZGA 1KLPA 3DS2A 3EJBA 1GPJA 2XZ1C 2AFEA 3CCUP 2GYKA 2L0QA 3CCLP 2EHTA 3M1MA 5DCKA 2JYGA 2FQ0A 2BUOA 4PH0A 2KWLA 2VSQA 3H0DA 1E0HA 2Z46A 2LIUA 3CC7P 2KOPA 1AF8A 2GDYA 1VQ9P 4IPYA 5HGLA 2PEOA 3G28A 3CD6P 2VLOA 2JAZA 2FVFA 2KW2A 5F2KA 1MZ8A 2X2BA 3HYBA 1YHQP 2LOLA 1VQKP 2OTLP 1EOQA 4COCA 3CXCO 4MRTC 2L22A 5KP8B 2CWOA 2KOOA 1VQ8P 2FVEA 3CC4P 3U43A 2LL8A 2P9XA 2KGCA 1ZMBA 3VRLC 2EG5A 2KOQA 4U0CA 4QNBA 5EW5E 2XT1A 2KG9A 2KR5A 2M8LA 2MR8A 2EFJA 2GZFA 3G1IA 1UJZA 1Q7YQ 1A8OA 1VQNP 1QRJA 4GR6A 1EMVA 1W2BO 3GKLC 3DS0A 2LTEA 3RG2A 2PY8A 1AUMA 4PH1A 2JU1A 2GDXA 5HVCA 3G21A 1M6NA 1HQBA 1VQ5P 3I56P 2LPKA 2KG8A 2XZ0D 4U0DA 2N6YA 3MGEA 2ONTA 1RNIA 4H2WC 3HZQA 4CA3A 1T8KA 3CC2P 3EJEA 2CNRA 2MD9A 2JU2A 2OARA 3B4QA 3CE7A 2WPTA 4QKOA 1KC8Q 5CZDB 4M0IA 2JO0A 2QA4P 4U0EA 3LMOA 2GDWA 3Q20A 3H4EA 1VQ7P 2MR7A 3DS5A 1VKUA 2VLNA 3G71P 2N50A 1A43A 2LMLA 1L0HA 4XRQA 2LKIA 1VQMP 1KQSO 4XROA 2K94A 2MY5A 4R0MA 1RO2A 2QNWA 5JPAA 2BHVA 1F80D 1BXIA 2K0YA 1VQ4P 2AVAA 1K73Q 2AF8A 2PEQA 2JB0A 1VQOP 2KORA 3DS1A 3CCMP 1ACPA 1QVFO 1VQPP 2M8PA 2FAEA 3G6EP 1UNKA 2EIAA 1VHNA 4F37A 3DPHA 5HV8A 3EJDA 4IZ6A 1NJIQ 1VQLP 4XFYA 1DNYA 2PEIA 1EIAA
chains in the Genus database with same CATH topology
1L0IA 2JU1A 2N98A 2GDXA 2JGPA 4BPHA 5HVCA 2LIUA 4NEOA 1HQBA 2L9FA 4BPGA 2N6ZA 2L4BA 2CGQA 3GZMA 2LPKA 2LIWA 2KG8A 2XZ0D 5EJDA 2N6YA 2KOPA 2KG6A 1AF8A 2FQ2A 2GDYA 4H2XC 4H2WC 4CA3A 2DNWA 1T8KA 2AFDA 1X3OA 3EJEA 2CNRA 2MD9A 2JU2A 2K0XA 3CE7A 2FVFA 2KW2A 5CZDB 2X2BA 1HY8A 2LOLA 2FHSC 3LMOA 4PXHB 2GDWA 2MR7A 3NY7B 1VKUA 2ROQA 1NQ4A 2N50A 4MRTC 2L22A 2LMLA 1L0HA 5KP8B 2KOOA 2CQ8A 2LKIA 4BPFA 1OR5A 2FVEA 2K94A 2KGEA 2JQ4A 2MY5A 2FACA 2CG5B 2KGAA 2QNWA 4R0MA 2FVAA 2N5HA 2MVVA 2LL8A 2FQ1A 2M5RA 2KGCA 1F80D 2FADA 2K0YA 5KP7B 2N5IA 4DG9A 2EHSA 2MF4A 3GZLA 2KOQA 2AVAA 2K92A 2K2QA 2KGDA 2AF8A 2KG9A 4HKGA 2KR5A 5KP6B 2KORA 2MVUA 1KLPA 1ACPA 1DV5A 2MR8A 4PWVB 3EJBA 2FAEA 2XZ1C 2AFEA 2PNGA 2L0QA 2K93A 4H2YC 2EHTA 5HV8A 3EJDA 4IZ6A 2FQ0A 1DNYA 2KOSA 2LTEA 3RG2A 2KWLA 2VSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0I A;  2JU1 A;  2N98 A;  2GDX A;  2JGP A;  4BPH A;  5HVC A;  2LIU A;  4NEO A;  1HQB A;  2L9F A;  4BPG A;  2N6Z A;  2L4B A;  2CGQ A;  3GZM A;  2LPK A;  2LIW A;  2KG8 A;  2XZ0 D;  5EJD A;  2N6Y A;  2KOP A;  2KG6 A;  1AF8 A;  2FQ2 A;  2GDY A;  4H2X C;  4H2W C;  4CA3 A;  2DNW A;  1T8K A;  2AFD A;  1X3O A;  3EJE A;  2CNR A;  2MD9 A;  2JU2 A;  2K0X A;  3CE7 A;  2FVF A;  2KW2 A;  5CZD B;  2X2B A;  1HY8 A;  2LOL A;  2FHS C;  3LMO A;  4PXH B;  2GDW A;  2MR7 A;  3NY7 B;  1VKU A;  2ROQ A;  1NQ4 A;  2N50 A;  4MRT C;  2L22 A;  2LML A;  1L0H A;  5KP8 B;  2KOO A;  2CQ8 A;  2LKI A;  4BPF A;  1OR5 A;  2FVE A;  2K94 A;  2KGE A;  2JQ4 A;  2MY5 A;  2FAC A;  2CG5 B;  2KGA A;  2QNW A;  4R0M A;  2FVA A;  2N5H A;  2MVV A;  2LL8 A;  2FQ1 A;  2M5R A;  2KGC A;  1F80 D;  2FAD A;  2K0Y A;  5KP7 B;  2N5I A;  4DG9 A;  2EHS A;  2MF4 A;  3GZL A;  2KOQ A;  2AVA A;  2K92 A;  2K2Q A;  2KGD A;  2AF8 A;  2KG9 A;  4HKG A;  2KR5 A;  5KP6 B;  2KOR A;  2MVU A;  1KLP A;  1ACP A;  1DV5 A;  2MR8 A;  4PWV B;  3EJB A;  2FAE A;  2XZ1 C;  2AFE A;  2PNG A;  2L0Q A;  2K93 A;  4H2Y C;  2EHT A;  5HV8 A;  3EJD A;  4IZ6 A;  2FQ0 A;  1DNY A;  2KOS A;  2LTE A;  3RG2 A;  2KWL A;  2VSQ A; 
#chains in the Genus database with same CATH topology
 5F2O A;  2N98 A;  2GZE A;  4BPH A;  5HGM A;  3B5I A;  2DGY A;  2L9F A;  4GR2 A;  4BPG A;  2N6Z A;  2CGQ A;  3G4S P;  2LIW A;  1D1D A;  1YJW P;  1IUQ A;  2FQ2 A;  1S72 P;  7CEI A;  4H2X C;  1GXH A;  2M8N A;  2AFD A;  1X3O A;  2PEN A;  1Q81 Q;  2JBG A;  2K0X A;  3H47 A;  5BS2 A;  4XFX A;  1Q82 Q;  3CME P;  1E6J P;  3CPW O;  3LRY A;  3G0V A;  3DTJ A;  2FHS C;  1M90 Q;  4PXH B;  3DS4 A;  5I4T G;  1ZNV A;  3NY7 B;  1NQ4 A;  2PEK A;  2CQ8 A;  3CCS P;  3CCE P;  3CCV P;  4BPF A;  4U0A A;  4COP A;  2KGE A;  3G1G A;  2KGA A;  3CMA P;  2N5H A;  2JYL A;  2MVV A;  3CCJ P;  1GXG A;  2FAD A;  1VQ6 P;  2N5I A;  4DG9 A;  2EHS A;  3G29 A;  2MF4 A;  1M6E X;  3GZL A;  1YIJ P;  2K2Q A;  4HKG A;  5KP6 B;  2MVU A;  3GJN A;  3OW2 O;  1DV5 A;  4PWV B;  2KOD A;  2PEJ A;  3G26 A;  2ERH A;  2PNG A;  2XXM A;  2K93 A;  4H2Y C;  2GZJ A;  2KOS A;  1M74 A;  3CCR P;  1L0I A;  1Q86 Q;  4WYM A;  2JGP A;  1JJ2 O;  1AYI A;  2XV6 A;  1YIT P;  4XFZ A;  4NEO A;  2L6E A;  2L4B A;  2K5X A;  3GZM A;  1N8R Q;  2Z45 A;  5EJD A;  1IMP A;  2KG6 A;  3NTE A;  2VLP A;  1KD1 Q;  3DS3 A;  2DNW A;  1BAJ A;  2VLQ A;  3I55 P;  1IMQ A;  1YI2 P;  1M1K Q;  1QVG O;  2PEM A;  1HY8 A;  3CCQ P;  4U0B A;  1K9M Q;  4U0F A;  2K0D X;  2OTJ P;  1CEI A;  1K30 A;  2ROQ A;  3WBH A;  1FR2 A;  1RO0 A;  3P05 A;  1K8A Q;  1OR5 A;  2Z44 A;  2JQ4 A;  2FAC A;  2CG5 B;  2FVA A;  4UHP B;  2FQ1 A;  2LF4 A;  2M5R A;  5KP7 B;  3RG6 C;  2GZI A;  5BS1 A;  3E2D A;  2E1M A;  1YJ9 P;  5HGN A;  1Z6M A;  1YJN P;  2K92 A;  2KGD A;  2NO8 A;  5F2N A;  2QEX P;  5HGO A;  2GZG A;  1KLP A;  3DS2 A;  3EJB A;  1GPJ A;  2XZ1 C;  2AFE A;  3CCU P;  2GYK A;  2L0Q A;  3CCL P;  2EHT A;  3M1M A;  5DCK A;  2JYG A;  2FQ0 A;  2BUO A;  4PH0 A;  2KWL A;  2VSQ A;  3H0D A;  1E0H A;  2Z46 A;  2LIU A;  3CC7 P;  2KOP A;  1AF8 A;  2GDY A;  1VQ9 P;  4IPY A;  5HGL A;  2PEO A;  3G28 A;  3CD6 P;  2VLO A;  2JAZ A;  2FVF A;  2KW2 A;  5F2K A;  1MZ8 A;  2X2B A;  3HYB A;  1YHQ P;  2LOL A;  1VQK P;  2OTL P;  1EOQ A;  4COC A;  3CXC O;  4MRT C;  2L22 A;  5KP8 B;  2CWO A;  2KOO A;  1VQ8 P;  2FVE A;  3CC4 P;  3U43 A;  2LL8 A;  2P9X A;  2KGC A;  1ZMB A;  3VRL C;  2EG5 A;  2KOQ A;  4U0C A;  4QNB A;  5EW5 E;  2XT1 A;  2KG9 A;  2KR5 A;  2M8L A;  2MR8 A;  2EFJ A;  2GZF A;  3G1I A;  1UJZ A;  1Q7Y Q;  1A8O A;  1VQN P;  1QRJ A;  4GR6 A;  1EMV A;  1W2B O;  3GKL C;  3DS0 A;  2LTE A;  3RG2 A;  2PY8 A;  1AUM A;  4PH1 A;  2JU1 A;  2GDX A;  5HVC A;  3G21 A;  1M6N A;  1HQB A;  1VQ5 P;  3I56 P;  2LPK A;  2KG8 A;  2XZ0 D;  4U0D A;  2N6Y A;  3MGE A;  2ONT A;  1RNI A;  4H2W C;  3HZQ A;  4CA3 A;  1T8K A;  3CC2 P;  3EJE A;  2CNR A;  2MD9 A;  2JU2 A;  2OAR A;  3B4Q A;  3CE7 A;  2WPT A;  4QKO A;  1KC8 Q;  5CZD B;  4M0I A;  2JO0 A;  2QA4 P;  4U0E A;  3LMO A;  2GDW A;  3Q20 A;  3H4E A;  1VQ7 P;  2MR7 A;  3DS5 A;  1VKU A;  2VLN A;  3G71 P;  2N50 A;  1A43 A;  2LML A;  1L0H A;  4XRQ A;  2LKI A;  1VQM P;  1KQS O;  4XRO A;  2K94 A;  2MY5 A;  4R0M A;  1RO2 A;  2QNW A;  5JPA A;  2BHV A;  1F80 D;  1BXI A;  2K0Y A;  1VQ4 P;  2AVA A;  1K73 Q;  2AF8 A;  2PEQ A;  2JB0 A;  1VQO P;  2KOR A;  3DS1 A;  3CCM P;  1ACP A;  1QVF O;  1VQP P;  2M8P A;  2FAE A;  3G6E P;  1UNK A;  2EIA A;  1VHN A;  4F37 A;  3DPH A;  5HV8 A;  3EJD A;  4IZ6 A;  1NJI Q;  1VQL P;  4XFY A;  1DNY A;  2PEI A;  1EIA A; 
#chains in the Genus database with same CATH homology
 1L0I A;  2JU1 A;  2N98 A;  2GDX A;  2JGP A;  4BPH A;  5HVC A;  2LIU A;  4NEO A;  1HQB A;  2L9F A;  4BPG A;  2N6Z A;  2L4B A;  2CGQ A;  3GZM A;  2LPK A;  2LIW A;  2KG8 A;  2XZ0 D;  5EJD A;  2N6Y A;  2KOP A;  2KG6 A;  1AF8 A;  2FQ2 A;  2GDY A;  4H2X C;  4H2W C;  4CA3 A;  2DNW A;  1T8K A;  2AFD A;  1X3O A;  3EJE A;  2CNR A;  2MD9 A;  2JU2 A;  2K0X A;  3CE7 A;  2FVF A;  2KW2 A;  5CZD B;  2X2B A;  1HY8 A;  2LOL A;  2FHS C;  3LMO A;  4PXH B;  2GDW A;  2MR7 A;  3NY7 B;  1VKU A;  2ROQ A;  1NQ4 A;  2N50 A;  4MRT C;  2L22 A;  2LML A;  1L0H A;  5KP8 B;  2KOO A;  2CQ8 A;  2LKI A;  4BPF A;  1OR5 A;  2FVE A;  2K94 A;  2KGE A;  2JQ4 A;  2MY5 A;  2FAC A;  2CG5 B;  2KGA A;  2QNW A;  4R0M A;  2FVA A;  2N5H A;  2MVV A;  2LL8 A;  2FQ1 A;  2M5R A;  2KGC A;  1F80 D;  2FAD A;  2K0Y A;  5KP7 B;  2N5I A;  4DG9 A;  2EHS A;  2MF4 A;  3GZL A;  2KOQ A;  2AVA A;  2K92 A;  2K2Q A;  2KGD A;  2AF8 A;  2KG9 A;  4HKG A;  2KR5 A;  5KP6 B;  2KOR A;  2MVU A;  1KLP A;  1ACP A;  1DV5 A;  2MR8 A;  4PWV B;  3EJB A;  2FAE A;  2XZ1 C;  2AFE A;  2PNG A;  2L0Q A;  2K93 A;  4H2Y C;  2EHT A;  5HV8 A;  3EJD A;  4IZ6 A;  2FQ0 A;  1DNY A;  2KOS A;  2LTE A;  3RG2 A;  2KWL A;  2VSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...