2JQAA

Solution structure of apo-dr1885 from deinococcus radiodurans
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
149
structure length
149
Chain Sequence
b'MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
molecule tags Metal binding protein
source organism Deinococcus radiodurans
publication title A copper(I) protein possibly involved in the assembly of CuA center of bacterial cytochrome c oxidase
pubmed doi rcsb
total genus 19
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04314 PCuAC Copper chaperone PCu(A)C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1890 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2jqaA01
2K6WA 3ZJAA 2K6ZA 3ZK0A 2K6YA 1X9LA 2K70A 2JQAA
chains in the Genus database with same CATH superfamily
3BEWA 5JHLA 5DMGD 1BFOB 1VFAB 1F8TL 5D1ZC 4KJQD 2W0FB 4WI8A 4OZIB 1OGTB 5AENA 3BUBA 3PDOB 4MMXB 4F33A 4XT1C 3BO8B 4JFFE 4U1GC 2GB2A 3BP7A 2FQGA 4GG8A 4ZTOL 4MD0A 2A73A 1AGCA 4R7NA 4DGYL 3VRIA 3DJRA 4EUPG 1INQB 4J3TA 1KELH 4JPWH 5FYKL 3FRPG 1QSFB 3BSZH 2IG2L 4ZPTA 1B6UA 4BGDA 3O0RL 4PJ9B 3HTLX 5IIEA 5KJ7E 3B5TA 1D2OA 5ACZA 3QBTB 4YE4L 1H6UA 4M9PA 3WE1A 2P3YA 1ETJA 1Z7JA 2BFVL 5J9PB 4X5QA 1D5RA 1GSMA 2OZNA 3B7TA 4FXLA 3UYRL 4OM1H 1XH3B 3ZUCA 5AAWC 1CK0H 4XO8A 4JKPH 2R23A 4ALAH 2ALAA 3PIQB 4H1LB 2X2UA 4KTEL 2JH2A 3G5ZA 3FQWA 4DP7X 4KXBA 2N59A 1ZS8B 2C8NA 4EKXA 3V7MA 4NPKA 3EF4A 4NQTA 1JV5B 3OTTA 1DO6A 2H4EA 3G5XA 1MRFL 4GINA 3FTGB 4JFHD 4H25A 5KVMC 5FWQA 5FM8A 5LGJB 5EBWA 3O6KH 2P5EE 2HKHL 1QSEE 3VX1A 3AY2A 1AZNA 4DVRL 1Q9OA 1ETB1 2QADD 5DUBB 2ESVA 4HS6A 4BFRA 1WUNT 1CGSL 2CXGA 3QJHB 2HRGA 4HK0B 5ID1A 4RGNC 1GTFA 1AC0A 1WF5A 1IV8A 1A64A 5BOZG 1QI4A 4NRYB 3AXLB 1J05B 3C60A 4PJ7B 3V9FA 3WIHA 3ULUF 2R4RH 4ODUB 1XL6A 6FABL 3IEAA 4LBEB 2YFOA 5D2LB 4OZIA 2VC2H 1P9MC 5E1GA 5JW3L 3G5YA 5JNYB 4U3CA 1Q38A 4PLKD 1H6EA 2FO4A 2EDFA 2VJXA 3MV7E 1SF5A 4C4BA 1MHHB 1I7TB 2IH1B 2A77H 4OKVA 2BY1A 5AKSA 1HEZB 1A7RL 1KCRL 5LJYH 4JE0A 5L4JA 3N50A 1WCBB 3GSNA 4PJ9A 3V4VH 3VFMB 3WNLA 4WFFE 1T2QH 2VSMB 1N4XH 3IDMB 4B95C 1AMYA 4LGRB 1D9KC 3NCBB 3S34L 1TTGA 2ENPA 4NS0A 2Q6WA 4LCWD 2X88A 5TF1H 3VA2C 5IQMA 1KB3A 2WUCL 5ICZB 1NBCA 3B8YA 2CO6B 2DLTA 4LEOA 4NCC1 2E7DA 2WXFA 3KPMB 1YUKB 4EDWH 3BCFA 5EN2B 2ADGA 1AOHA 3LXUX 2ICEA 4AQAB 4F9PC 3RZCB 1DJIA 2IPTH 1ZA6B 2UVEA 2VDPH 4RQQB 1ZLUK 5JLZB 3KGRA 4XWGL 3U0TA 4DKEH 2G0KA 4OCWH 2WNKA 4Z3FA 4PAZA 4F8QA 4QRRE 1NLBH 4FMKA 3MCLH 3DIFB 3T77B 3TYGL 1CLOL 3TT1L 2J6EH 2X70A 3CG8A 2SEBA 3WKYA 4RA0C 3G5XB 5FCUH 4HDIB 1JI1A 2XZAH 3HR6A 5C9JB 4TTDD 4J3SA 1FL6A 1DCLA 2AXWA 3R06A 3WFZA 2D9CA 2O1AA 3QO0A 3GKWL 4R4FL 5FYLE 5LCVH 3BYYA 4I2XE 3TBCA 3WTSA 5C0FB 3UCRA 1V55B 1X4XA 2J72A 3C2AL 5DT1H 2OCFD 1SHXA 3MRPB 4GO6B 2BCKB 1JBJA 4GI9A 4HS8H 1P4IL 1Z0NA 1M57B 5CKAA 3V4VA 1NCAH 2ADFH 3WNMA 4DEPB 1CBVL 1DDHA 1M3JA 3UJJL 1YVLA 4WEUD 4XNZC 1FBIH 1A4JB 4PJFA 2AEOA 1LP9F 2B9BA 1RKRA 3LY6A 3FB5A 3Q2CA 4HOZA 4KNQA 3OWEA 2W65B 1MFMA 1FSKB 1XR9A 4X0NA 3RGBA 3IS0X 3ZHNA 3FTUA 1XMWA 2BIMA 5C09E 2LLNA 4GO9A 4J2QA 2G9HA 3PDOA 4P46D 1CMOA 1PDKB 3MRDA 3W11C 1QLRA 1S3KL 4YL4A 2CHZA 3A4FA 1X6LA 3ILQD 5KWYC 3W5MA 1KPRB 2H0JA 2QSVA 4YLCA 1A6AB 1Q9LB 4FADA 4F15B 4CVXA 2NY7H 2Y4SA 2R69H 4G71B 4RMUA 5CP7B 4OV5A 1P1ZB 3V95A 1EAJA 1RUQH 1ZA6A 2WHVA 4GQ9L 3LH2L 7CGTA 4X8GA 1CYXA 5D7LA 2ZTBA 4BRJA 4LKCA 3GMMB 4JKKA 3F6LA 3KWUA 3ESNA 2QPDB 3MOAH 2ODIA 1B2WH 5J11B 2FQFA 2FR4A 4UIKL 1OP3H 3WFCL 1PGRB 1S9WB 1INEH 2A1WL 1JYVA 5FM5M 3LDBC 1YN6A 1UWGH 2YHGA 5DRZB 5KBLA 4Z3JA 3EO9L 1BZ7B 4OGZA 2F19H 1IBZA 5E2TL 1T7WA 1ECZA 4MHHI 2DWEB 2XZQH 4YXHL 4M1DL 5L0QC 1CICC 1E4XH 1PY4A 2YPVA 3MRLB 1U0QA 4WTQA 2BCKA 1CZ8L 4G72B 4WFGD 3KM2A 2VO8A 5ACMA 3DVNA 4BFGA 4BKLA 2IO5A 4JPSA 1CI3M 4ZUTB 4QI3A 2EUXA 2XWRA 5GJTH 1CFVH 5JZ7C 4Z7WA 4F91B 1J8SA 1A9EA 5I1LB 4UILL 3WXWH 1CDJA 5ID1B 4J4PD 3I6SA 5FYKH 5C6PB 1WZLA 2PPFA 4GRWE 1IAMA 3ZE1E 5IB2A 4LP4A 1N64L 5KSUB 1T0OA 4ZSOE 5D2NB 1Y6MR 4HWZB 1KNOB 4DT2A 1AANA 2PWHA 4OCXH 4QRTA 5T1MA 3EYSL 2NXZB 4W9EC 3TN0B 4OCRL 5SWQA 2RB8A 1NMBH 4WWKD 5DQDH 3CZUB 2WXIA 3GM0A 5E8EB 3JZYA 2YMXH 4AYEC 5FOBA 3U2SA 3DRTB 5FGBC 3U4EA 1LO0H 3RVWD 3KGUA 4M6MH 2FB4L 1LEIB 2P80D 2YKLH 3O8XB 1FA4A 4FJZA 2V3DA 2VXVL 3H2QA 4WF7A 2CJSA 3CQQA 2OX5B 4UF7C 1NCWL 4HK3J 2J56A 4UDTA 5FS5A 4AH2A 4DKAA 1ZDQA 2P7TA 3FXIC 3WS3B 2WOYA 2ADYA 4P2OD 4IK7A 1X7QB 2RQ8A 2COVD 3IFPB 3L3DB 4P5TA 5F89B 4R7VA 2H9GB 5I1IH 4BFFA 1J18A 2VERN 1A3RH 5I1KL 2P5EB 2ZE0A 4I48A 1GZPA 4MMYB 2OZ4H 4K9JA 4JN2A 4NXKA 4BA0A 1XIWC 2LHAA 1W8EA 4U1JB 4DVBB 2FTAA 3EG9A 5C7XH 5FYKE 2PWGA 2ZQKA 4WO4D 3RGVA 2BJML 2I9LB 5B4MC 4IKNA 1OF0A 3Q6GL 4KJPD 2BWIA 1TVHB 2JB5L 4X8CA 5BMFL 4FLQA 4F58L 4X4XA 1LXMA 2E27H 2GTWA 2XCMC 2XG4B 3K91A 5ICXB 4BKLB 1MFDH 4PJ8C 4TMPA 4HLEA 4ELKA 1H15A 3ISWA 1PL3A 1CD9B 3P4NA 4WFFD 2WYZA 1N2RA 3KYMB 1NSNH 2Q8AH 2F74B 4O9HL 3N43B 4DN3L 5CSZB 4PWEA 4FP8L 5DEGB 3LPWA 2ADJB 4P49A 2XY2A 5BXFB 4FQ1L 3RGVD 4PGEA 4AKPA 2B4CC 3EJPA 1AS7A 2C4FU 2C9VA 3IF1A 3RY5A 2GT9A 4ZUSB 4NDMA 3RU8H 1HXMB 3HBGA 5I0YA 1AS6A 4CW1A 1PX4A 3A67H 4FYTA 1LGVA 1EHKB 1BFVH 3CC1A 4DZ8B 5KBNC 4ZFGH 2A9ML 3DBXA 4JQIH 5AZEL 3TH3T 3QFGA 3C5ZD 4HXAH 1R3IH 1RK1B 3LQAH 3WHE1 2D0FA 2XIBA 3DJZA 3UTSE 4PV9B 1ML0A 1ACCA 1Z9MA 4X9FA 2J8HA 1I9RL 3IDGB 3NAAL 2YXWA 3HB3C 4WU5A 4AVHA 3KYOB 1KENH 2PWFA 4PJIB 4YL9A 2EXWC 2OJZH 4KTDL 1J87A 4N0FA 4JFDE 4IDJL 4U3SA 3ZUNC 4L8DA 4GAAA 2MCAA 4HIHA 4WIQA 4HJGA 2R1YB 4TRPL 4AJ0A 1A6AA 2MPAH 3LRMA 4NO5A 5TDOA 4BZ1A 4PMEA 3GSXB 5CEZH 4QWWD 4AZUA 3IFPA 4PJIF 1IKNA 2C1OB 3LEXA 2YWYA 3VWJC 1S6NA 1JV2A 4UQ9A 1S9VA 3WNKA 4B0MB 4D8OA 2X0WA 3C2AH 2ITFA 1MFVA 3R19A 4OF0A 4N8VB 1HL4A 2Z3FA 2VR9A 4KZ0A 3VTMA 5F0LB 4I2XA 2BM3A 4EI5D 3MNVB 2P44B 1DVFC 2OL3B 4JO4H 4XO3A 1AQ8A 2WQVA 3BQUB 4GUPA 3IFNL 3EOBB 4NP4H 4WI5A 3U0PA 4ZPVB 2HJFB 1TIUA 4K9EL 1JYWA 1H15B 4NJ9L 4P46C 4ZG1A 2A6DA 3LH8A 4LCWA 3D05A 1SDDA 2DWEA 1EFXA 4O02A 2CGRL 2EADA 3FT0A 1S7TB 2F74A 4M5ZH 4YUEH 3CN1A 1PCSA 1RHHA 5EZIL 2HLAB 4MA1B 4N2DA 4G7YL 4IGBA 4M1GL 2F8XC 3WN5B 1DL7L 4BDVB 1SM3L 1ZHNB 3HKFA 4G5ZH 5CXPA 4XMUA 5F3FA 4RX4A 2D3LA 3MV9E 3ZDZF 4Q9BA 4UQ3B 1GXEA 4F9LC 5CF3A 3MOQA 2HTLC 4ZXBA 4M61A 4ZYKB 2ZNXA 2JTDA 3ALXA 3T0BA 2BNQB 2H6OA 2IFGA 2DQIL 4Z7UA 1FFPA 3PFQA 3FUMA 5FGCB 4I13B 4ZTOH 2P8MA 1M7DB 4U1SB 1F6FB 3ZDXB 1UA7A 4J3OH 4TPRL 4DN4L 3QIWC 4OGXH 5I30H 3DJTA 4KV5E 2HT4C 4L3EA 3MLUH 4R4BB 4FG2A 4LEEA 2XXCB 4GKSB 4MCNA 3QEQE 1FO0A 1RU9L 5AG8A 1HINH 3JWOC 5L2KD 3QORD 1PFOA 2NY4D 1ZHBB 4O4YL 4MQXD 4P07A 4PMFA 5IKCA 3SDYL 1MY5A 1EXHA 1H8LA 2XRAL 3BPOC 3BT2H 3UIZA 1DQLH 1NPNA 4WV1B 1H3PH 2P7TB 3QE5A 5AKVA 1FVEA 2OBGA 2Q5BA 4UDUB 3TBYB 3WS3A 5E9AA 1KYUA 5GRJH 3WUWG 2OULB 3ARPA 1IZKA 1F1AA 3ZDXE 1UZ8B 3O3DB 5D6CB 4PG9B 3QPQC 1M2VB 1DLFH 3W81A 3MXWH 1JF1B 5IP4A 1FYTA 1HILA 5GGVH 4HUXA 1CICD 2Y06L 2PYEE 3VGAC 1F18A 1V54B 4MCMA 3PGFH 3QIBA 3IWVA 2R83A 2NPLX 3JSSA 2W92A 4JFHE 4M1CC 2NRDA 1TTRA 2PP7A 2VWEC 2MCPL 1G5GA 1U21A 2QL1A 1TNMA 3UIYA 3VDAA 3KS0H 1SHSA 4XMLL 5HGAB 3VXSA 3DX7B 3FT4A 5E0FA 4AK1A 3MYJA 4G7SB 3WAKA 4ZPTB 3V5DA 3X3FL 1QO3B 5JHDD 1CQYA 2R39A 4OFVA 5K9OA 2AQPA 4FFVD 1FNAA 2HPOA 1DQTA 3L5JA 3OSKA 3DURB 4ZXBB 2JJSA 2P47B 1SFDA 3E7JA 4K3EH 2DM2A 4YWGL 3EJRA 3RFRA 1NCJA 2XUWA 4NRZA 1O7DC 3F7KA 3D25A 4KHXH 1GCFA 5FO2A 4TUJA 1U3JA 2YGNA 1A7QH 5AOLA 3VXSE 1H8OA 2I85A 5J06A 4HJ0C 3HPJB 1HSAB 2YAQA 4N24A 4K23L 3MRHA 1JVLA 3CSYB 2NYKA 1AY1H 1FH5H 1HXYA 1D3CA 2PCFB 5L7XH 2YRPA 4WU5B 4F2EA 5B8CB 4U1LB 3OKNA 5E6IC 2R2EA 4QHNA 2H3NB 3REVA 4ENED 4D9LH 4RESB 3T6WA 4OZGE 2RCSL 2YRLA 3TU6A 5EUKA 4CC4C 4JKNA 3AS0A 3QUZC 3SE3C 3NPSB 4AMKL 4XAKD 5JHDE 4JRYA 4F9PA 3QJHA 1T5WB 5FV1L 2Y07L 4G8AC 1H8NA 1DUYB 4K07A 5DJ6A 5BUAA 2ZYSA 5DS8B 1F11B 3WNIA 1WIPA 3QORA 1FIGH 3ZZ1A 1OK8A 5EIVA 1MCCA 1UADC 3E3QC 2FL5B 3FQNB 1SN2A 2Z31A 2YQBA 1WAAE 1QYGL 1F6LL 1IC5H 5F7EL 3WUWA 5IMKA 3MNVA 3IXAB 4F3FB 5KVGL 1IAOB 4X8JA 2UZIH 3R7RA 5IB1B 4FLOA 5B21A 4HK3N 3UC0L 2PXYD 1S7WB 3L2MA 4OF3A 3X1FA 1I7TA 2IH1A 4HUMB 3BVTA 1JI2A 4JO5A 3JWOH 2H1LM 1TTCA 1PJWA 4GIOA 1P4IH 1LP9A 2P42B 3QEGH 4ZFOB 3BQUD 2LU4A 2ADFL 1T1WB 3MLWL 3QAZB 4LOUC 1JZEA 3HG5A 2DQEH 5FYJE 1KCWA 2AK1L 4HD9A 1WA1X 1YMMB 4L9LA 4UYQA 3ZKMD 3KM1A 4NNYB 2I60H 4LL1A 4N8VG 2JQZA 5A2IH 1YEGL 1M71A 1BQHA 4KHTH 2NNFA 3QIUD 4NIYE 4XPAH 4LQ1A 43CAA 1H5BB 1B0GA 4QXUH 3TWYA 4XZUB 1PQZB 3TF7C 5L8JB 3DOHA 2WCPA 3DTXB 3HE7B 2J1XA 3QQ9D 4XB3A 4JJ5B 1DDTA 1GRWA 1I1FA 2RFXB 4KDWA 5IB4A 4D3CH 3MR9B 1EO5A 1T6WA 3NK3A 5HHMD 4QXGH 5I6KA 2E8YA 4K7PL 5FUOH 1X5YA 3KCPA 4QHNB 4HSQA 2R69L 1T0PB 2GAZB 1P4LB 5MP6H 4HV8B 5JA8B 5DK3A 5FKPA 3RWDB 4JAMB 4APXA 1ZIAA 4TUKL 4OLEA 1BD2B 4X99A 4NNPH 3B2UC 2FAUA 3INUH 4BINA 3VD2A 1ZHBA 4ILDA 3MGOA 1GGCH 1JN6A 3HLKA 4NZTL 5FGBA 1F11A 3VGAB 1SFHA 2CBTA 1M4KA 3NJFA 3QORB 5MENE 1PSKL 2W60B 3V0FA 3UTTB 3MRCB 1PY9A 3CPLB 3L45A 4NZRL 4F33B 1IGJB 1ZTXH 3DV4A 1T5XA 4WLCA 1QSFE 3BKJH 1A9BA 4G8GE 5KW9H 2A74C 1W0YT 1MI5A 3QZNA 1NKGA 3DTUB 4GW4A 5AWNH 3V6OC 1H0DB 1IGCH 2WVVB 2ZSWB 2BNQE 4HBQA 4B27A 4FNLH 3K8MA 1CLZH 4I0PA 1DVTA 4A68A 3MBEA 4NKDA 4XNYH 1R19A 3ZHKA 2MRYA 4NNYA 3V5HA 3DLQR 2G3XA 3VQLA 4XXWA 3NA4A 2A2QT 1IQWH 1W6WA 2ATKA 2BOCA 2YZ1A 4DW2H 4FFYL 5KAQG 4OCNC 2BVYA 3FFCD 2A77L 2I32A 5ESVB 5LBSA 4QD2E 4FEMA 3MRMB 2H2PC 2Z1KA 3LZFL 1TSRA 2YUVA 4Z8FH 1V10A 5FB8A 2X0VA 2OP4H 2BNRA 1NCCL 3S37H 3WL9A 4MJIE 4ELME 2Y1YA 4R4NC 3R1GL 2H45A 2P8LA 4MAUH 2X7LB 4QJ4B 3TH2T 5HGGS 4BBWA 1RERA 1E4KC 4EDWL 1L6ZA 3UO1H 4AYFB 1LO0L 4LU5H 4ZMNA 1SJXA 3GHEH 3SDCB 1BD2E 1EHLL 5FKPB 4APXB 4Y4KA 4PYHA 4FS0A 2YKLL 3BAEL 3KH4A 1QRND 3NJXA 3WDJA 2W0KA 3V52L 3LKNA 3WN5C 4DQOH 2Q2LA 3IDYB 2X6MA 4H8VA 5EA0H 5F44A 1JPFB 3P11H 4XX1G 2XPGB 3D87B 3GSQA 5FGRA 1NFIA 2V4LA 4A6YB 5HGHA 4URKA 3CFNA 1ZGLA 1DVZA 5MEQA 5HYFA 3LNDA 1UCTA 3TCXA 3US1A 3QUML 5DJZB 5C0BA 4AL8L 2D03H 2GG1A 4IBLT 1DJZA 3WO4B 1UXMA 3D69A 2YPLB 3KPOA 5CZXD 4D9QE 1WS7A 3BEWB 1EJFA 3X1BA 3US9A 3VNYA 5JQIB 4HT1H 3MTRA 3FBQA 5J13B 1I9EA 3HRPA 3ULVL 1HHGA 2WINA 1AGDA 5I1EH 1YEDB 3FUNA 4FD0A 4UT9A 4K3EL 4Z0BL 4LLAA 1ETZB 5F9OH 4GOSA 3BP7B 4GQRA 5FYKD 1GY1A 1XF4B 4X9HA 1MH5A 4QHLB 3B5GA 5C0AE 3CU1A 3N0AA 3GM8A 4OLVH 2ZWYA 1R5WA 3MJGX 2ATKB 5D7IE 5AYQA 2QV2A 2AXGB 5DA4A 3PV6B 4HLZH 5TK2A 2NNAA 1A4KA 3D12B 2IH8A 3HB3B 5EOCJ 4M7LL 4Q0XH 1T0MA 5EU6A 2FWOA 2K8MA 1URZA 4AGOA 2Q3ZA 2VL5A 1MLCB 2RD0A 3DV6A 4PRIA 5EEUA 5D1XD 3K2UH 3HI6H 1C8PA 3MV7B 5KVEH 5KVEE 3PHQA 4WEEA 5KVFE 1UQSA 2XTJD 3BSGA 3BLBA 3K8LA 3NIDF 1RJZA 1EFXD 1UB5A 3EYVA 1HCYA 1U8OB 3VDCA 3QG7H 1KXQA 4UQEA 2H0FA 3EG9B 2ILLA 2ZCLH 2XOTA 3MR9A 4NWTH 3MO1B 4KTDH 4DFHA 3MRGB 4AOFA 2VAAA 5AVWB 1RP8A 3VI3E 2IDUA 1XFPA 4DKDC 2MOVA 1MCSA 4OF8A 1QACA 4JFYB 5F3HB 4F37K 2I07A 2Y6SC 4PGBB 2F18A 1MW2A 1LMIA 3U4AA 2D3JA 4XE0A 2WVTA 2K8QA 1D6VL 1PEZA 1UJ3B 3ESPA 4X5WB 2UZYA 3TM6A 4L2YA 1CS6A 2D9QB 3T6QC 4G80B 3KR3H 3TIEB 1F56A 1J05A 3ZKNC 1SN0A 2UXGA 2AEIT 3U6RA 5D4HA 4N1EA 4M1DH 2EH7L 3L4ZA 2CIKB 3N43F 4F8LA 2HVKB 4UYPA 2G4EA 3DWTA 3L4WA 3T3MB 2G9HB 5D93C 1I1CA 3L5XH 2A6KB 3DIDA 1XF4A 4P23D 2Y7QA 3O6LL 1UB6B 1ZWIA 3CD4A 4ZW5A 3QUMA 4Y0GA 4R9HA 1GKOA 5T5NG 2X10A 3CLEL 2X6BA 4M7ZC 2R2BA 1SLWA 1JMZA 5L8KB 3IM1A 3U9PL 4DAGL 4PYGA 4UUJA 1QZ1A 1VKXB 1U95A 3HI5L 2EKSA 2GI7A 2ZUSA 3MJ8B 3OM3B 4HXBH 4JQIA 2CIIB 5B7FA 2RALA 3N85H 3LZOA 3TVMC 4GSUA 2OK0H 4Y1SA 4PJEB 1BZOA 1FAIL 1NMBL 3AT0A 1N26A 2BOCB 2DWYA 3P0VL 3ZYIA 3GMMA 4WUUE 4NFBA 4K8RL 4X5PA 3CFEB 3CSTA 3FRUB 3MV7A 1E5YA 3VFRA 3GSWB 1S9VB 3W9EB 2F54A 2BP0A 4NQCA 1USQA 2UY6A 2K7QA 5JHDB 4YDVB 1BZ7A 4QR7A 4LPVA 3ZSTA 1SOKA 4N9GA 2V5SA 3QDGA 3EUUA 1XH1A 3HFMH 3CN0A 2LAAA 4W1TA 4PJDF 3ABMB 3U2IA 1IT9H 2YUZA 2N7BA 1L9QA 4IIQC 4L37B 3SOBH 3SPJA 5TQ2L 5DJ2A 4K3DL 2FWSA 2AERT 1A4CA 1SBSH 4W70A 2HKFH 4UV4H 3FT2B 4O4YH 1HZKA 1A9EB 5DO8A 1CXLA 4J3OF 2D7OA 1NDTA 3VXNA 5IK3B 2HLAA 2E5EA 4YHIB 3UAJD 4A6YA 3HVDA 4KXCA 1T22A 2Y0SA 4K8RD 3O4LD 5IVXF 5SX4I 3C08H 1IL1B 1F58L 5BMFH 1OSPL 3W0WE 1KWKA 4M8RA 1NAKL 1W9XA 1TEYA 1MFCL 4WI6A 5C0BB 1ZHLB 4KQ4L 2IGFH 1E4XI 1XF1A 2F1BA 3ARDD 5T3XL 5KZCB 1SXAA 1ZT4B 3N06B 4PUBH 1H9VA 1UWEL 2L8AA 3QUZA 1P2CB 3FUIA 1HH9A 3K72B 2VZOA 2OM5A 3EO0B 5JOFB 5H94B 1QFWI 1CDCA 2WJ7A 4U1GB 3ZE1B 1LEIA 5TTRA 5IBTL 1U95B 4XBMA 2QQKH 3ALPA 2B1HL 3TWCL 4E5XA 4UAOB 3TZVA 1J0HA 1EO7A 2NY3C 3HR5A 3LMJL 4PJFE 4QY8A 3IMVA 4NAJA 3Q3GA 2MTAA 1A4KB 3VI4F 1NPJA 4I48B 1WFIA 4MJJA 2WZ5A 4MMYA 2BP5M 3GBDA 5KN5B 3UYRH 2KZBA 4HS3B 4YDVA 2RMNA 5FO9A 2FD6H 5E9NA 5JHAA 2A4EA 4G6AC 3NIDE 5E8PB 1EZVY 3MLYH 5IQNA 5HY9A 1TVHA 1Z5HA 4ZAKD 3CXHK 2OMTB 4D7PA 2G9KA 1DQML 3GNMH 4L37A 5KVFL 2AVGA 4WFHE 3EYVB 5KAQF 1TO5A 4Y4FD 1O6SB 1ZVSB 3KWWB 4YVNA 2DMHA 4OZFG 3MV7D 3HMXH 3NJJA 2OL3H 4PJBB 3P3UA 2ZCHH 4F7MA 3LCYA 1QSFD 4NENB 5I1CH 4JHUA 3A5VA 3IN0A 1MFBL 4PGBA 2V2WA 5EF1A 5ABDE 3KPRB 4J8RB 4RAUA 2FIKA 4YHOL 1ILSA 5IG7A 2VDRB 3I50L 2B9AA 2DQGL 1NICA 4PJBF 3CVIH 4ZX6A 3ULAB 4WW1A 3BKMH 1A14H 3FB8A 2Z7ZA 3LNFA 1QQDB 4LDOB 2VQTA 3JV0A 2XVLA 3VXRB 4ETQA 4YOKA 1TLMA 1MCWW 2DI8A 4OBRA 5DJXB 4WJ5A 4DPRA 5SWSE 1U2CA 3RB7A 2OSXA 2X3BA 3NFSH 4LMQI 4GS7B 5J4MA 5ANME 2A99A 4G7YH 2WAQA 4QAWA 3W56A 1RFDL 4MAYA 1AD9A 2A0LD 2H1PH 5DJ8A 5T1MB 1GZHA 1OP4A 3HKZA 4AQ1B 5I74C 4HC1H 3G6JA 4JN1L 3GXPA 4R3SA 5K1NA 4KU1A 1EO8H 5BO1H 2JKIS 3KPRE 5EO1B 4L8DB 4BK8A 3TJEH 4UQDA 1W8OA 4NKMB 1AC6A 1HXYB 4LVNC 2Y7MA 3ROOB 2JJTC 5HJDA 3FSOA 4PRHB 5H8DA 2VABB 1TQUA 1HAWA 4XNXH 1JV2B 4BQBA 1J8RA 5DJDB 3M86A 4XPAL 2ICWI 3RIKA 4L3AA 1WD8A 4JFSA 1MVUB 2Q3AA 4CMMA 4LEXL 4KH2A 4HUKB 3SCMA 3ZQWA 5I2IB 3B3BA 3V0WH 4JLRA 4WO4C 3H7BA 3QNYA 1ZTXE 4MX7A 4GUOA 3U25A 3GQFA 4LPCA 1GZPB 2DLGA 4A2EA 4QIRA 1ET7A 2UY6B 2VZTA 1UATA 4ZO7A 5CJOL 5ICYA 4YSUA 2PCXA 3LQZA 3QXWA 4X7TB 1T0NB 4QRFA 2YRBA 5J89A 2H32A 1ROCA 3PG2A 1CE6A 5GZNC 3U36B 2WJ5A 1X6NA 5FHAL 2OXGA 3IAGC 2DW5A 5CJXC 5EUOA 5HHOA 3QHFH 1C5CH 4MDJA 1KV3A 4QRQB 4XRCA 4RLDA 5CGYD 3SDDB 2OMVB 3TJHC 1MJJA 15C8H 3BI9X 4IRZH 2VN5A 4NEHB 2F1AA 1MG2C 2BRQA 1LNUB 4Q6YA 5ISZA 2F53D 5C1MB 3NCJH 4K7FB 4MB5A 3HFFA 1ACYL 3BIBX 4JKLA 5CSZA 4EI6A 3S0PA 2F53E 2LABA 3L9YA 2X4SA 3NQKA 4IBZA 3K2IA 3QFDA 4LSPH 4PM1A 2EYRA 5TD4A 2VLJB 5PCYA 1AACA 4IKIA 1G9MC 4ZSOB 2CO7A 4FNTA 3PP3K 1W0VB 2ICWJ 2QQNL 4C54A 5H37G 1JGIA 4Z76B 3CVDA 3QUXA 5TFSL 1BBDL 1H5BA 3HS0A 5KG9A 4XVTH 4DH2A 4XGZA 1NCBH 1UEYA 2G3ZA 3TIDA 4Z7OB 3H7LA 4XB7A 4NERA 3NIGE 3DVIA 3NH7L 5D96C 2C34A 1LK3L 4KUCD 4QHUA 3ZTNH 1KGYE 3GTVA 2J2ZA 4DOHB 3EZJB 7TAAA 2JKWA 4Y16B 3TS8A 4GXVH 4WUUA 3RIAK 5A6MA 1U8PB 1AZVA 1MWAH 2LFGA 4AVKA 1PG7H 2PPAA 1GGIL 5HDOA 4N0FB 4I3RH 1E3XA 3EBGA 5BRQA 4PIBA 5DJ0A 5L2KE 5HJBA 4A67A 5A2FA 1FVEB 2EYTB 8FABB 3C60D 1F3DH 2ICCA 3FCGA 4NN6B 3GGWA 4X99B 3H7BB 4AKOA 5DUMH 2B0SH 1T89A 5E8NB 2WQUA 2X42A 4XN2A 1RUKL 2Z8RA 3BP6B 3HLAA 3N44B 1UCBL 1Z9PA 5JIQA 2X9ZA 3U4BH 4WK0B 4LQFL 4NM4L 1O7DE 4J6IA 3VWKD 2FX8L 3QS2A 2D2CC 1MCFA 5FW6A 3VXMA 3EH1A 1E4KA 2UYLA 3PCYA 3QWOB 5EUOB 1ESOA 1S5HA 2DI9A 5JHLH 4FXGB 3B9AA 4UM8A 1KJ3L 1TJHH 2BY0A 3IJSB 1BLIA 1J86A 5IVZB 5JXEA 1I9JH 2A9AA 3VXQB 5HP5A 4ZX4A 3G08A 3MAWA 3AWGA 4EXKA 3KLAB 2KQNA 5K39B 2YXVA 1OW0A 1LDPH 3BN9C 5A2JH 4FI7A 1CDIA 1A6ZB 3O11B 4H8HA 4GBXD 3ZZSA 3DYPA 4Q6IA 2X87A 1L7IL 3NYKA 1BZ8A 5DTFB 3V7AG 4KI5E 2AV7A 3UTZA 4B5ZA 2HN7A 4C83B 43C9B 1MFEH 4QRSA 3CZNA 2ED7A 5EO9A 4ZFQA 4K3JH 2OMUB 4P0DA 1UKQA 5TF0A 5JIKA 2HFEB 4MJ2A 3O4LE 1HT6A 2F68X 4OZFB 1MWOA 1ZHKB 1INDL 2WKOA 2K45A 3D8MA 3CSYA 3QWRA 4NQUA 4ZS6C 2WTOA 2VDRH 3L17A 3VXRD 1JZ7A 2B77A 4YQXH 1I8UA 3BSZA 5CNHA 4WUUB 5BCAA 3QGVA 2CE6A 4A6YH 1N8ZB 5SWZB 4ZK8A 4J2XA 1QFWL 4B96A 3K6SA 5LWYH 2VDQB 4PRDB 3WBDA 4L3EB 3KH3A 4AE1A 5I1AB 5F8RC 3QPQD 4R4BA 1XIWA 4YNYB 1E7VA 4MNGE 3U30B 3B43A 4HOMA 4Q0XL 2NR6D 1EERB 3O4LA 4GAYB 3OAZH 4U1IA 3HMXL 1KULA 5C07B 1H3VA 2WLKA 2WYTA 1N18A 1CU4L 1UD2A 3DX1A 2AP2A 5IJKC 1TYEB 4AXWB 4M4RB 3ARED 3MCG1 4UQCA 3HE6A 5B3SB 2HWZL 2Y7OA 1YNTA 1YNLL 4PRHE 5I8KL 1XEDA 1NUGA 4FZEL 1FHNA 2PW2B 2O6FA 4I18B 4P5SA 2YRZA 2E7MA 3N40F 4FQ2H 5E6RB 3MLTA 4OGAD 1ONQB 5DZAA 1MJ7L 4EUPA 1Z5YD 3QEQA 2OMYA 2WBJD 2P5WD 1VPOL 2BLFA 3HC0B 4MS6A 1OSZA 2PXYB 4PJ5B 4RRPA 4CRPA 3V0GA 3ENEA 1WFTA 3U36A 2WXGA 4U3HA 1YQ2A 4H88L 4Z7WE 4FQCH 3PV7A 5EBMB 2BSRA 5DK0B 1SY6A 3GPSA 3EO1A 4XPGH 5FFGA 3KPSB 1D9KD 1RFDH 3EGXB 3MRFA 4Q6IC 3FFDB 3ZXAC 2ZX5A 3BN3B 1U4EA 2XIIA 4PBWD 2Q7AA 3BPCA 3S35X 1BQHB 2MIZA 3V6FA 1DEEB 3QZPA 2OA9A 2VE6B 5EOQH 2NY6D 2XZCH 3QDMD 3Q8FA 3T8MA 4LSUL 4P5MA 1KIQA 1GW6A 1IKNC 1AQMA 3RL2A 1TVBB 2FUTA 3MGTB 4P2OB 4KKZA 2RJMA 4KNSA 3OXRB 5MEPB 2VDQH 4ADJA 4YPGB 1T20B 3QA3B 3HAEG 5FYLL 4FFZA 4NRZB 3GI8H 2EZ0C 3TFKC 1QVOA 3ESOA 3O3AA 5E4OA 2OI9B 3FB6A 1ZS2A 3FCUB 1NC2D 5BV7B 1OZTG 3GIVA 2VLJD 2LU7A 4Q8BA 1I7ZB 1DE4A 4KOBA 3F58L 4RMVA 1AR1C 2IG2H 3CXFA 3VXPB 3OZ9L 4C4KT 1D7BA 4P2RE 1P84J 3FT3A 1U33A 4EI5C 4NKIL 1FZMA 4MJ6B 3TT3L 1IM3D 3T0WA 2JELH 4Y5YC 1FRGH 5TH2B 4WTWA 2X6UA 4U1LA 1Z0MA 3NIDB 4GAGH 4ICWA 1YYCA 3S8FB 2OK0L 1NEPA 4OW6A 1KYFA 3AS3A 4Y5VA 4OD3L 2CLRB 3HI1A 1Z3RA 2E7CA 4TVSa 1T7XA 5DJ0B 2BVQB 1RVFL 2VW7A 3KXFB 5F7WC 5C0NC 1LWHA 3ULVD 4QTFA 2YBGA 1MF2H 5GHWL 4PJGE 4IKLA 3CH1B 3F83A 4PRPD 3RIFK 4JY4B 5B1KA 2DM4A 4MA8H 1I8AA 2UY7A 4XMPL 3HE6D 1A9BB 4EUPB 5DD1H 2G75B 3A6CL 3QRBA 2NY2C 2YK1H 4U2ZA 2EDMA 2ERJC 3RHWK 5TE4L 3BWAB 2WVUA 4GAJH 4MKTA 3MU3A 2EH8H 3RWEB 2E3VA 1N0LB 3LKQB 1WRFA 4BYHA 3KPSE 4GRMB 4LT7A 1T1XA 1X5ZA 5K9JL 4GUCA 3BPNC 4UV4L 3KZ8A 5CUSH 3SKMA 4PLJD 3CX2A 3EO1B 4L8CA 4GP4B 1ZWIB 3MRKB 3PWPB 4PJGA 4NUJB 2MMXA 1I1AC 2O26U 2B14A 2ZT9C 2ARJB 3IXTA 3T0EB 5ID0B 1TT6A 4IBYA 5HI5D 4L4TA 3G5VA 5LUMA 3MRMA 4YHLL 2XPYA 1BF8A 3HPLB 5DSCB 1EA9C 2VC2L 2KC0A 2UXTA 4NGHH 4X7DC 2PWDA 5MEPA 4M3HA 2VXQA 3K6NA 3MFFB 3K2KA 5D2LE 1GR7A 2AEPL 2C3GA 2NX5A 3ARGC 4LLUB 3KVQA 5EO0A 1CFSB 2CRMA 5FAAA 3ARFA 3SE9L 1E9OB 1ZVYA 2QGDA 4DO5A 4KDVA 4TNWK 5SV4A 1SMDA 4Z5RB 2OMUA 2BP0B 4G9DA 3TBBA 5HDBE 2QELA 1D7CA 2H2SD 5DUML 4AWJC 5KSAD 3M7OA 1FZMB 4Z7UF 5B4MD 4P9ML 2C5DC 3MI6A 4M7LH 5I30L 5DHDA 4JM2A 3O6FB 2BXZA 3E9TA 4QYOA 3ZT6A 2XPGA 1XB6A 3LPOA 3GSQB 3K6SB 4Z7VB 1U8IB 1WWWX 1P4LA 3BAJA 9CGTA 5JDJA 2M2DA 4Y4HB 3RNQA 3LZLA 4PWKA 3F12A 3KXFA 4WGVB 3ASNB 1RIVL 3L48A 5EZOL 3D2UD 1Q9OB 1VGKA 3SGKA 1T4KA 1X4YA 4QJ5B 4HWBA 1C16B 4H40A 2M26A 3ZKXB 1JN6B 2VIRA 3GZOA 1NCTA 2C3XA 2AABL 2AFNA 5FCUL 4KROD 3RUGA 1GGBL 3WHE0 4IHBA 3T2PA 2YPKA 3QZWA 4G6KL 4IRSC 4MGXA 4P9HH 3SPHA 3T4AA 3U6XS 2XG5B 4FHJA 5C0CE 5GGVL 5DR5L 1NKOA 5KYYB 1XGYL 5FX3A 2H2SC 1L9MA 2EO7A 5D7EA 5CCGE 1PLCA 1MH5B 3D3VA 4QHLA 1PZAA 4KGLA 4UI2A 5AUMB 1DBBL 1RIUL 4WWKC 4EZKA 2AJUL 5CILL 1AO7D 4HKXA 1JZ4A 3B9VA 3PL6D 1MNUH 4HJTA 2R0ZH 5EPMA 1JXKA 3A47A 1NA8A 3B2MA 4O2EA 4WW2C 2EH7H 4FG0A 1BQ5A 1RLWA 2CQVA 5E1AB 4MHHG 4X83A 5FK9A 4NC0B 4Z7OE 3D0LB 1CO1A 1H3UA 4AQEA 5B7MA 2ZUTA 3TZVB 3Q06A 1BAWA 2VL5B 5KS9F 1CFSA 1EAOA 3STZB 5LGHH 1EJOL 3IMTA 3MJ9A 4MA3B 3UYPA 3PJLA 3ZQ9A 4A7VA 4XCNA 5GGRB 4JPVL 2JB6A 2VDMB 3QJVB 4XXDB 1SQMA 3BUPA 1Q1JH 3Q1SL 5F9JA 4NAQA 1EZLA 3PAYA 4XPBH 4JRXB 5JIHA 2WW8A 1B3JA 1MEXL 1OPGH 3HB3D 5IGXL 4XMKL 3ECUA 1CU4H 5GRUH 4IOIB 1S9XA 5DFWH 2NX5D 2VDPB 3D7PA 2NT0A 4KUCF 3SODB 5GGSB 3T9WA 1U30A 1BVKB 3P73B 2HRPL 4LE8A 3IAQA 4H0HB 3QH3A 1VZGA 2G2RA 2PO6C 2VR7A 3CLFL 5CINL 4X80L 1U8MA 3FU3A 4ZFZA 4BUHA 5EU5A 2V2XB 3FOLA 4HUWA 1C16A 3LPPA 1VPOH 2A7BA 2FO8A 1LO2L 4MCYB 1GGTA 4HHAA 1FF5A 3KDMA 4TOYL 3LKRB 1F5WA 3IU3B 4PJHA 3S5ZA 1X9QA 3AJ7A 1IGFH 1WITA 5HDBF 1INEL 2A1WH 3UGUA 1KB9J 5KANI 1KACB 1UYWH 2IOMA 4XOAA 3EO9H 5E2TH 2Z1PA 3P69A 1GL4B 2VDMH 1S9YA 3IYLW 3ZHLA 1AR1D 2NDFA 3EH3B 3MDJA 4PWJA 1LHZA 3EW3B 3C75A 4BZ1L 5KSBB 3BUIA 5E4EB 5BRPA 1XSIA 1WT5C 4X4ME 3W39A 2GY5A 4IU3B 3JWOL 2WANA 1A1MB 3GI8L 5BS0A 4G6MH 2NZ9D 2AV1A 3EGSA 3T4YB 3AM8A 4CU6A 3QB7C 4FKEA 3JT2A 3AT9A 4ODUA 1A21A 2OZ4A 1SY6L 2EXSA 1V3JA 2P5ED 4QHMA 3I6LD 1MRCL 4P2OC 2VABA 1RZ7H 1NOFA 1N64H 1WBZA 5EWIH 1P1ZA 2K9FB 1UKSA 3CSBA 3T0DA 4WNQA 2WLYA 4PS3A 3L1OH 1DQJB 5KANG 4B9YA 3F7YA 1I9IH 5F7KC 4B7IA 5DVLA 1QKZH 3S98A 4MAZA 3DDGA 4PJAA 3QDGB 1VEPA 1MLBA 4GI6A 5IHZB 5L4MA 1JZ8A 2A83A 2PW1B 4U6XA 1J12A 3SKJL 4YX2H 3CE1A 2G3NA 4XN8A 3ARXA 2CO6A 2DM3A 4JGJA 3KPMA 1QBAA 1TJMA 1MVYA 4W93A 1FCGA 1PLGL 1Q9KA 3EGDA 3NZ8A 3Q48A 3HMXA 2VAAB 2BVOA 3S96B 4XI5D 3CGTA 2QFPA 4MB1A 3TF4A 1GIGL 1JZGA 1EUUA 2XFXB 4GAJL 5KSAB 2H41A 2BSTB 1KBPA 3BKCH 4HIJA 5EU6E 1G7HB 3PHOB 3MSPA 5I18H 1SJMA 2X89A 1TLKA 4NN7B 5HI5C 4G43B 4XCYB 3S6CA 1ZV9A 2HP4A 2X70B 1LM8V 3MYZA 1LLAA 1ZHLA 4L3ED 1OCWL 5D8JL 3HNTL 3K1KC 1FZKB 1RJYB 4HEME 5EU4B 1LE5B 3BIAX 5DI8B 2CHXA 2UZXB 5AEAA 5KZCD 2Y3AA 1FIEA 1USZA 3UZEA 3KCWA 1PD0A 3WO3B 4ANVA 2VLMD 3MLVH 1F3JB 4X5LA 4P4KA 1KCVL 3KWXA 3WI9A 1TO4A 3AS1A 4JFUA 3P4OB 4NWUL 4OLWL 5KYYA 3LZPA 5A43C 4KI5C 4LLWB 4M43L 1MDAA 1KJMA 1UURA 4MJ5B 1JIBA 5EC1B 2DKUA 3JTSB 4G5AA 1FC1A 3LN4B 3IS1X 3KWTA 2FRGP 4MXWH 2FVNA 3UPRA 1MELA 2BS9A 2PYED 2Y24A 2HRHA 2XX1A 3U79A 2WNGA 1DQVA 2ZOTA 3RKDD 1A6WL 3VGEA 1O6TA 2CKBL 4EBQH 2FJUB 3BXNA 4U05A 2P26A 1OZUA 1PVHA 4IRSD 1JZ2A 3FFOA 4IRJA 5GGRA 2WUBL 1CGTA 2R8SH 1INDH 2GIMA 3FCTB 1DSWA 3PDGA 1ZY9A 5ETUA 2IPKA 3MJ7A 1YJDL 4HAGA 4JN2B 5F7DB 1E9QB 2DZEA 2X05A 5TGBA 3FF8A 4JRLA 2K6ZA 1UEMA 1IC0A 4BFJA 4R6UA 3Q13A 1G7PB 3OR7B 3QUYB 5AOKA 1JNLH 2IJ0C 4ES8A 3Q2NA 1NAMH 4F7MB 2DN7A 1Q72H 5CIPH 2Z7WA 3CH8A 4J3OG 5D7LD 5SV3A 3DETD 5C09B 3V52H 1IGIL 3P73A 3KLDA 3ELQA 4L4TD 1WV7T 2KPWA 3GO1L 4UM8B 4Y89A 5D1QC 4ELKB 2XTSA 5HHOD 5B39A 3BMVA 2NY6C 4LKCB 1VA9A 4OTXH 4KFMA 2HJLA 4JHAL 3CCHA 4AIZA 2BIOA 5CEZD 5HVWA 5JXED 5MERB 4OF5A 3CDYA 5DJXA 3GLZA 4JQVC 5E95B 4A7GA 4FERA 3LRSA 5JO5A 1LE5A 2GT9B 6CGTA 4NYLA 4EOWH 1UXSA 1NDMA 4PP1C 4QRRA 5EBGA 4L48A 4ZS7L 5DJ8B 3NSJA 3DX6B 2B08A 4LIQE 2EDDA 3B7UX 4MLSA 4NNXA 3UBXG 1ZT4A 3WLWD 1KFAH 2W07A 3N9GL 1KJMB 1NGQH 2HFEA 2J1YA 4L29B 4OUOA 4Z18A 2O30A 4AGPA 4AJVA 4LVOC 3NTCL 4MYWB 2VQUA 3IDGA 4J27A 3NT0A 4HX1B 5JPMB 3L3HB 3RNKA 4OZIF 5IVOA 2X4TB 5EV7A 3CHQA 3FQ1A 1IFRA 1FNEB 2AHIA 4L4VB 5EH1A 1EZVX 2F0CA 5C8JA 4HJGB 3TCLA 4U1KA 3EHBD 5F0PB 3OKMB 3NJVA 3PS6A 3QZOA 4OAWA 2FUQA 2YMTA 1LK3H 1F4WH 2KI6A 1G7MA 3WHXA 1J5OL 5FO8A 4MX7B 1KBVA 4HWEL 1D7DA 1NGYB 1MCOH 4JHZA 3C6SA 3BT0A 1CIUA 2X4NB 1U8LA 3V4PA 3VDBA 2PCPA 1OL0A 1YDPB 4F7EB 3ZL2A 5IQ7L 1INQA 4PBXA 3FHEA 3VFVA 2OFQA 4Q89A 1A7PH 3I02A 4CBZA 2XWBB 3U48A 4DJMA 5ITBH 1QSFA 1JZ6A 1V8HA 1M05A 3BIKA 4QNPE 3TURA 1W16A 2YAOA 5HD8C 1F86A 2F19L 3JV6A 3T0EC 5DK2A 2IAND 1OB1B 1DVSA 1ONQA 1MJJB 4UTBL 2APFA 2ZONA 5CLYA 3SYCA 4EI5A 1YY8A 1FI8C 2H7WA 4N3UA 1MJUL 3TA3C 3O3EB 4H8WH 4POZD 4PJ5A 4JFOA 2IAMA 4UNIA 2M8XA 1EANA 1XX9C 4LSSH 4HKZB 1AZRA 1JS4A 4UINH 4NT6A 4MFHA 4R4FH 5GRVL 2X4SB 4QTIH 5T1JA 3O3UN 2GTZA 4W9IC 3CZSA 3GINA 2VSCA 4XNQA 1TTAA 4MA8L 2R0WL 1CGWA 2V0AA 4L1DA 3ZYJA 1EXUA 4ODSH 5AAWA 3IU4H 1ZXQA 3K4AA 2GSIB 3IMBA 3QFJB 2YD1A 1EH9A 3QEUA 4ETQB 3CVHA 4ORZC 3D2UB 4OR1A 3MVSA 1JHLH 4PP2A 2IDCA 2P43B 3JV5A 4P3CL 1W8NA 4U1MB 4BQ8A 3KE0A 1I3GL 4QHUB 3ES6A 1YEEL 4IJTA 3VD4A 1PCXA 3L5XL 4IGBC 4N8PA 4HGKC 1U3YA 4Y4HC 1BQSA 4U7KA 3FJTA 4A2FA 2ESVB 4HS6B 2X0UA 3D9AH 4GSQA 4YBLB 5A2AA 2DQDL 1N0XL 3FPXA 3FTZA 4KROB 4TUOA 4AEHL 3S3PA 2MWCA 3O6MH 3V10A 4Y8AA 2B7DT 4LBEA 2XV2A 4NBXB 5BZXA 5A3ID 3AU0A 2XT1B 4R2GB 3QYCA 4ZBJA 4OFPA 3TOPA 5GJSH 1TKWB 3NMEA 1DBMH 1AO7B 4HJSA 4HULB 5LNDA 4LLDA 2XN9A 4WKZB 1BVOA 1HZHH 4X6EB 4HMCA 3BRGC 4EZJA 4JVUA 1PYWA 1Z3GL 2XQYA 1MHCA 5DRWB 1A3RL 3TN0D 5ALCL 3IK2A 4EDXA 1HNGA 3BIKB 4P05A 5EEYA 4AV5A 2NQDA 1MG3C 4KJYA 1KBWA 2VLLA 3VJ6A 3VQ2C 4MQ7B 1WBXA 4AV4A 3CJJA 1BJMA 2X4QB 4G9FE 5T5NF 3QIBD 4LO9A 3RB5A 5F7UA 2QPEB 1MFNA 3MOAL 3LQZB 4DEPC 1GTNA 4HHWA 2E9WA 4IBQA 5IW6B 3VH8B 1N0LA 3D51A 4G6AD 1FYTD 3EJYC 4GRWH 4JM0A 3QYMA 3LXCA 1WG3A 4KK6D 3O41A 3EDKA 1KCSH 3E8UH 3E9UA 1RULH 4PD4J 2NY0B 3DYMA 3AQDA 3GSUA 4W9JC 2AW2A 4JFXB 4K3HA 3D6GA 3PJSB 5FUZL 1JXDA 1W72A 4JFWA 3SQBA 2R1WA 3ZIYA 3DMMD 4AZ8A 4YK4C 4L4TB 4LSRH 4ABWA 4CAGA 2TRHA 3IPBA 3EYQD 4HDIA 5AVTB 4JDVB 5AALA 3BQUA 4GUPB 2J71A 2VLJA 3SJVE 3MRBA 5EFIB 2Q0ZX 2CO7B 1XGYH 2WWNA 4AUYA 1NIDA 5EO0B 3RVXD 4FEIA 3PWJB 4EIUA 2XQ0A 1O9WA 4Z7WF 4HUUA 2WQAA 1FO0H 3EJJX 2EIDA 4TUJB 1NFDF 4B9FA 3BP4A 1VZHA 1A3ZA 2COQA 2CDFB 4LSVH 3WELA 1KCRH 4UCFA 1XSJA 4DCQA 1KV7A 5FA4A 1IIKA 4LSUH 2P4AB 5L2JA 4MZ2A 2DJMA 2J1ZA 1YJDH 2BSEA 3AMLA 4PWIA 4AITA 4AE0A 5E2UH 3R4RA 1RZKH 3L3HA 4P5KA 2LE9A 5D5ME 3RNKB 1TMCB 1U93B 1E6OL 2W65A 2X4TA 4AEEA 4BA8A 1KTDA 4TLKA 5DDHB 1XR9B 2XA8H 2F7IA 2O72A 2EE9A 3S4SA 5IQ9B 1ZLDA 3IRPX 2OYPA 4Z77A 4WUUD 3FULA 3L5HA 2BX5A 3FUJA 1JVKA 3APCA 4RRPM 2FECL 3WFBH 5MENB 1F41A 5DJYA 3F58H 4XPBL 1G7MB 3QJXA 4LLQA 5I5RA 1A25A 3P4LA 4IJ3B 1WBXB 1AHWB 3GSOA 1RURL 1OAZH 3RG1C 1ZJBA 4LFHG 4XP5L 3JUZA 4M48L 3CBKB 1HJCA 2QGBA 4G1EA 1FO0B 1O75A 5LB1A 3RJDA 1PJ9A 3BUDA 3LSOA 1CI5A 1JFQL 4W81A 1RZIB 3NFNB 4ZMPA 4N0YH 5D7SL 1J9SA 4PJ5D 4LNRB 1V3LA 2OL3L 1B0WA 1E5AA 1JVOA 4LKXA 3K5SA 2EIJB 5DWPA 3LKPA 1HVXA 3MNWA 5DT1L 1HH6B 4XMXA 3RWHA 1HDMA 5EZIH 3IGAA 4XP6H 4YR6A 2ADIB 3GZKA 2R1XA 5DUJA 4GT7A 1KIPB 1KIQB 1SM3H 3X3GL 2FR4B 4YSQA 4N2HA 4UV7L 5F93C 4X6CF 3UTPD 4Z7NF 5E08L 3K6IA 1C5BL 4LHUB 2E46A 4DN3H 1YN6B 1C1EL 4L05A 5E8OA 3I6KB 1QVOB 4RDBA 2I5YH 1KPUB 1M9SA 3DX8B 4N2GA 2AJSH 4BZ1H 2FO1A 5IW3A 2WQ8A 3IFOB 2ZX9A 4JJ5A 2NNRA 5E9DB 3DVNB 1NC2A 3NPZB 3QFJD 2VO5A 5C07E 2CCLA 2WLJA 3T3PB 1CYWA 1W0WA 2RTTA 2V3FA 4WDIA 4L1SA 1S9XB 2XV6B 5E6UB 2EDJA 3TBWA 1F8TH 4MNQD 5IQ9A 3OAYK 3QQNA 3S4SB 1MCNA 4Z77B 1G7JB 3X14B 1BAFL 1H3XA 1NTDA 1XO8A 4S1QH 4XMWA 2PCYA 5F0JB 5HHQB 1A7BA 1LTXA 4K7PY 4GQ9H 4ZS6D 3TEYA 2VZVA 2WZPD 2NY3D 3F7LA 3P0GB 4HFWA 5AVSB 4U1IB 1DQLL 4G9FD 1H3PL 4CL7A 4MCYA 4QRRD 1QKZL 1WH0A 2O61B 1RPKA 5GRJL 4HHAB 4MAUL 1DFBL 1XCTB 1E4JA 3K74B 2E9BA 5GS0H 4JFED 2MOQA 1BWWA 3PUUA 3RVUC 1T03L 5IV2A 2QHRL 3HE6B 4HH8A 3NIGF 3L5WB 4GRMA 1CUOA 4C56A 3SKMB 2O5YL 3D52A 5C6TH 3H53A 4BM7A 1TCRA 3LKPB 1KEML 3UDWA 3PHAA 1IZJA 4LOVA 1TQWA 1WD9A 3QQDB 4C59B 3TNNB 3EUDA 2FE0A 4PBDA 1YPZF 3R8BB 2R4SL 3BE1L 1H3TA 2ZWSA 2E9GA 4UT7L 2UX6A 2Z65C 3CXDL 3D4GA 1PLAA 1AYOA 1DJSA 1SYVA 4A39A 3SGDH 4FNRA 3MGAA 3X3FH 3EADA 4BE5A 1M7IB 3D9AL 1FGNH 3CIAA 3WXWL 5HYQA 2DQDH 1XCQA 4UZUA 3T3MF 5CM1A 1DEEA 4WTZA 4DWHA 2ZXEB 2X41A 2BWDA 2PNDA 2NY0D 3ZVVA 5B38G 4Y1AA 1NUDA 4GXFA 4WO4B 4XNDA 2OAAA 3WIFA 4U6YB 4G9DB 4ONOA 5E9DA 2K0RA 5F9OL 3B7RL 4RAVB 4H7VA 2QR0B 1THCA 4YXLL 4LP8A 4ZFOA 3MBXH 1T1WA 2VZUA 2D7TH 5I8CA 3ZR6A 3QS3A 1W91A 2PW1A 1KTRL 3MACL 5IZ7A 4JFFA 3FN0L 4QTHB 2CJ3A 5FA4B 3G6JF 4UOW1 2E4FA 2J1KA 1TQCC 1HWGB 2CBPA 4X6BA 3Q1SH 1D5XA 1KF9B 2VXVH 5TH2A 1OO2A 3TVMD 2AQ1A 3BEVB 5DHVH 2ZKXA 5IGXH 1DYZA 3ZKSD 3NEXA 3X12B 3L81A 2R8SL 4AQOA 1ZS8A 5CLWA 5IV2B 5I0XA 2OZ4L 3H3PH 4FXKB 4TSBH 2A5UA 4LZKA 4Z78A 3BP5B 3T0XA 4NHCL 3APNA 1BOYA 4OFYA 3CLFH 3JWDC 3QWNA 4HP5A 1T66C 1LQSR 1JSYA 4X98B 5C0JA 3A23A 4P2RA 3UGXA 4JMNA 5F7YC 1HHGB 1VFOA 2B1AH 2WB1A 1X5HA 1I85C 4JMXA 3S88L 3BH8A 3NG5A 3K46A 3WN6A 3SGEI 5FK9B 3L4YA 2ZOLB 4UT6H 5T1LB 3D0LA 3VM5A 4U31A 2H2PD 5F6IB 1FH2A 1E2VA 1G1OA 3WNNA 5CCHE 4TQHA 1G4MA 3PJNA 3JTSA 4LDLB 4JO1H 2LVCA 5L88L 3G5YB 4YFLF 1GYWA 4Y7MA 4WJKB 5AAMA 1A4AA 2AI0L 1T5XB 1YEGH 5EZJA 3JTTA 1O9ZA 3B2PA 4E9LA 3D09A 5J12C 4QXUL 5IM7A 2GC7C 2Z92B 3GRWA 4JRXA 1OGPA 2WWMD 1MFEL 4LCWB 2W0FA 4URTB 4PRIB 2B15A 1KTCA 1N5AA 4M62H 1N59A 3WY2A 1UD5A 3IDMA 2Y5QA 3V0JA 2WXRA 2WXMA 4K55A 1NWOA 5F71A 5KS9A 2VDKL 3FZUD 2EXYD 2F7OA 5IB3A 3UTTE 1CB4A 5J13C 3U9PH 4U1HA 1JYXA 3MLSL 5FKAA 3FMGH 4WDIB 5LWYL 3FH8A 3HN3A 3QCVL 4FE9A 1BFTA 5F7FA 2ZXAA 1I4FB 4PJFF 4AJYV 1XZ0A 4P5TD 3IKCA 3M07A 4Y4HA 1F4WL 2HT2C 3H56A 4UBDD 5CEYA 5B39B 1BREA 2W0LA 5J9PA 1GGCL 4QOKA 1UGNA 2G30A 1P7KB 5I73C 3X2QB 2VR6A 4NQEE 1T21B 1A0QL 2VQ4A 3KYKH 3QXDB 3GMRA 1ZTXL 3MV9B 4QLRA 2Y07H 4G9FB 3CDGA 3PAVA 3GS0A 5BOPA 5C0FA 3S5LA 1SBSL 3DSNA 4WTZG 4C4UA 3QR1A 3PDDA 3BH8B 5ECGA 4B41A 4M00A 2C9AA 3MUHL 4N4YB 4QNPF 3MODH 3WJJA 4TQPA 5E1QA 2DLFH 5FDYA 5AUMA 4MS8C 3WNJA 3SHSA 1ZOXA 5D1QB 1F2XK 1XSKA 1U8CA 3SQOL 5D71L 1DO5A 1CE1L 3QNXB 3CFIC 4DGIL 2KPNA 3KDPB 2QLYA 2QMJA 4UOQA 3EXLA 5KOMC 1J1PH 3UO8B 3KWVA 4M5YL 4BKSC 1Z5LB 3MRQB 4KXZH 3CSPA 3MJ8A 1FWXA 2XDHA 1KYDA 2ZX6A 5C0RL 4OT1H 4CNIB 4OLXL 1KCVH 1IAIL 5C0IA 4ZAKB 4FRWA 2IWFA 4NZJA 3OVUB 4M43H 3ULSB 1F1DA 1G9HA 1DVFB 4GRWB 3FRUA 3GWJA 3OQRA 1BAFH 3PLYA 4S1QL 3MRDB 4S1RL 2FO4B 1T1YA 4HEPA 4KNTA 2BFVH 4POYA 2WPGA 3OKOB 2E9IA 3OJDB 3UMTA 2ICWA 4MA7H 3VXME 1B88A 3FO1A 4AG4L 3NZ8B 3JVGC 3B9KC 1QFHA 2Z35A 5KYXA 1WCBA 1YG9A 1J5IA 3O6ML 1R3KB 3WEBA 4TL4A 3VQ1C 1DQIA 1LEGA 2G2NA 3ZRCC 1BOGB 2B5IC 3VXSD 3IDXL 3JV6B 4KY1L 2O6EA 4M7ZB 5IR1B 3P3SA 2BDNL 1T0MB 3OKLB 3QH3B 3P9LA 1MLCA 4TXVB 4Y2OA 4QF1B 3RVVC 3ZE0B 1U3NA 1KEMH 1ANUA 2FK9A 4HKZA 3BEVA 4X6DA 4XBGB 4ZMYA 1MF2L 5JLZA 3OL2A 3WAJA 1JNLL 4NC1C 1U8OA 2V2TA 3H4HA 1KCKA 3ECBB 4G42B 1JGLL 1FV1B 3DPDA 4JZJA 2OCCB 1KJVA 3I2CH 5I0WA 4I8DA 5I71C 4IEFA 2GHWB 1KJ2L 3D2UA 3Q1EA 4IDLA 3RDJA 2EH8L 3PU7A 5JW3H 2OMBA 3REVB 3CVCA 1QEWB 4H8PA 35C8H 3MA9H 4MD5B 4OFQA 1AMXA 4OQTL 4QPEA 3NCYP 3IBOA 4YHYB 4NUQA 2VMCA 2OYMA 4XPFH 3ZDYB 3B34A 2NW2A 2Y2WA 2UZPA 4ZW3A 4IM8A 3SE3A 2ED8A 3MUGA 2VR8A 3NCWA 4WV1C 3V4VL 4ZS7H 3FC8A 4BWWA 4DGVL 1A66A 3F05A 1FYHB 4EO5A 1QBMH 5KSUA 1KYAA 5AFAA 3B2UD 4N2AA 1DN2A 4O2FB 2HMIC 4WQOA 1IVTA 4OD2B 2Y36L 3IJ8A 1IEBA 1MFDL 3DX9A 7PCYA 3V79C 4JM2C 2DQCH 1MI5D 1FVCA 1KPVB 4N2CA 1T80A 1RUMH 2OW7A 3ZIMA 4HS3A 3ZL4H 3CDCA 3Q9PA 2DH3A 2DJ4A 1N6QH 5AKRA 1OAQL 1K85A 3QQ4A 4O02L 2VLLB 1ZSDA 3VJ6B 5T33H 4MQ7A 2ZCLL 2GUOA 5JDSB 1KB5L 1QLRB 1PF3A 4P9MH 5LGKA 2YUXA 3H2WA 1KPRA 1LO5B 3FFCA 2PYEA 4GKZB 4UAHA 4AJWA 3TP4A 4DO6A 2HMID 4IIQA 1BQLH 2GJ6A 4A7UA 3LD8B 3D85D 2DLEA 3G6AB 5IMLB 1YEIH 1IKFL 1OF2B 4TQ8A 5DGQA 3ZY7A 1M2OA 2ICES 4GAFB 2YKKA 3SE4C 3A24A 2GFBB 3A4DA 4RZCA 1YYLH 4MCZA 3NCFB 4UAOC 2GI0A 4HMDA 5GS1B 4MNQB 4ODXA 2GPZA 2Q2EB 2ZOOA 1GPOL 3CTTA 3T1FB 1JPTH 4QCIB 3IPFA 1KYOJ 3ZW3A 3TTYA 4H5SA 4IRZA 2GAZA 1TQCB 1PZUB 1U8HA 2AI0H 5AW9B 4RMRA 2IF7A 2BPBA 2ITDB 1F4XH 2BC4A 3P4NB 3PXJA 2ZCKL 5JPMA 1HQRA 1U58B 1WFNA 3SYOA 2ICEC 3VI3A 4HPYL 1U42A 3X1NA 2X89D 1J1OH 1IM3A 1MWAB 3HRZA 4WY7L 2MEJB 1J0JA 4RFOH 3AG1B 4NSKA 3N42B 4ZW8A 4Z7WB 1HXMA 1CC3A 5IW1B 2CLZB 1HAUA 2IVFC 4OQTA 4Y4HD 1JHLL 4KI1A 3QUKA 1NANH 3P54A 4KRPC 1I3GH 3KL0A 2I60L 4XPHH 1HXKA 3C9NB 5D1QD 4QOKD 3I9AA 4WK4B 1YA5A 2VDNL 2X4NA 4PW3A 3FMGL 5C0DB 3OQ3B 1QWUA 4Z0XA 2KZWA 3CLWA 4CJ0A 3GBNH 4PCKA 4ZMQA 4OKVB 4OIIL 1CF8L 4OLUH 2XA3A 3T5WA 3R4DA 2R56H 3BZFB 1XT5A 3AITA 3OPUA 4KKBD 1DBJH 1H0DA 4LSTL 2J57A 4GH7B 2JQAA 3HZKB 4ZFFA 2F2HA 4DUXA 2BXYA 4JFDD 3BZ4A 2X09A 1VESA 4LSQH 2ED9A 1RPUA 3V6OA 4KQ0A 3RIAF 4G6FD 4RWYH 2DQFB 2JIXB 1AZZC 3EYFB 2A3TA 1DVFD 3HG1E 1MWAL 2R1YA 4GXVL 4ONFH 4X7TA 3VG9B 1CFNB 2GK2A 1GGIH 2VN3A 5C08E 3MRJA 1S7SA 4L8BB 4N2LA 3WDHA 3VYOA 2XJKA 1J8HA 5B1JA 1JZ3A 3GUTB 1J0KA 2HKFL 1UA3A 1WT5A 4NHUA 3BMWA 1YC7A 3RZCA 4PY7A 3MLZH 4OM0L 3WJMA 2ZG2A 2HA1A 1EEYA 3MRIA 3MPCA 1B9KA 1QLEB 2OTUA 3BDXA 4YDMA 3GMLB 1VRSA 1E4WH 3IGAB 3K4DA 3OZLA 1ZLSL 1BIIB 4NZTH 4N2EA 3WGVB 3QXUA 4K94L 1THAA 1M1XB 4NQDB 2A6JB 1ZEAL 3KW8A 2OMTA 1J7VR 5I0DA 3QJSB 5GZNA 1JWSA 1KTLA 5DD5H 2FGWH 3F8UB 4LCCC 5DD3L 4E36A 2QKSA 1TITA 5CGMA 1J5DA 4NQQA 4P9HC 5GGRY 1LEKA 2VDNB 4G42A 5GZOD 5KSBE 2I9LA 4L4VE 4Z7IA 2W9DH 4I7ZC 3ZKXC 3N55A 1R5IB 1F2QA 1C7TA 3QXTA 3VYNA 2BNRD 3L7EB 5IHWA 4NNXB 5F1IB 5ITFA 5ICUA 3QQ3B 5FF6A 3BZ5A 1VZIA 2V2WB 5LGJA 4I1PA 1FL3B 2FWLB 3UTPE 2A9NH 1B9ZA 3MBWB 5FDWA 1CTNA 3TEZA 4DGYH 1DSYA 4OFDA 4PD4K 2X2YA 5FA3B 2HT2D 1QQDA 4UBDC 2MFNA 3VXRA 4UTCA 4WKZA 3ZRFC 1FAKT 3ABGA 3HS0C 2DBJA 3OGCA 1SEBA 5DYOA 1FG9C 1Z32X 1KIUB 4L4VA 3RIFF 2ENSA 3OF6D 4X6CB 1PBYA 1H3GA 4KY1H 4CW1B 2P8MB 4O2FA 4ZUWB 2OYLA 4BZ2A 3BDYH 4N8UA 5E8NA 4RDQF 4R7LA 3DGGB 2VR5A 1NGYA 3C6SB 3HHSA 4L5FH 2J5LC 4YXLH 1J11A 4LRIC 4K8RH 4IRJD 4NO3A 5K9KB 4YDKH 1CFNA 3CQPA 4BFIB 4PV9A 2CK0H 3HUJA 2MNUA 2DYPB 2J5LB 5KYUA 3D3VE 3VXUB 1S8DB 1XR8A 2FSEA 3T3PF 4R7XA 1B90A 2Q6WB 1NAMA 1MCHA 1P0SE 3TL5A 2ZCHL 4R0LB 3HUJF 5T1KB 1PEWA 1YY8B 1MRFH 1DBAL 4DK6A 3N41F 3ULUD 1GOGA 3HG1D 1SXSA 1MCLA 1Y6KR 1X5XA 1CXHA 35C8L 3KLAA 2I24N 3MA9L 4HFUL 5D72L 2C9QA 3SIKA 4FI6A 5LVEA 1AGEB 5C0AD 1IILE 3FU6A 3ZTDC 2AMGA 2ZJSH 3CU7A 5EFIA 5ICYB 1AZBA 3QDJD 1N9PA 4UTAA 5JMRA 5DLML 2JKXA 4D9LL 1L9RA 1OPOA 2HN7B 2UUDK 3QDJA 4S2SB 2ZIDA 4JFYA 4IRJC 1B4JL 1KXVC 1P4BH 5F3HA 3SPVA 5DFVD 4A2DA 3U0PB 2OMVA 3X1GA 3QDGD 2XU9A 2JLPA 3SGEH 2FX7L 3ARBB 1FZOA 5CEXB 2QVMA 5KTEH 3ES6B 4GW1A 3S88H 5E8DL 4DP8X 5BS0E 2C9PA 2CUHA 4L0ZA 4F1SA 3AACA 2NY1B 4H20H 1BEYL 2AJXL 4IBWA 4X0KB 3WKML 1RUAH 1WQVT 4XP1H 2JXMB 1BSIA 5FA3A 3KXFD 5HHMB 3TIEA 1P7QA 2EDKA 2VMJA 3RWJB 4M6OH 3U1PA 5MI0B 2FYYA 5HDLA 3Q0HA 5DD0L 1LL1A 3FQXB 3P3TA 4XOCA 1KNOA 2D4DA 4HPHA 4QRTB 4Q9QL 2J8UF 3V0HA 1OARH 4PJEE 4YK4B 5MEND 4M61B 3BHBB 3DX2A 2Y7QB 2VISA 3WIHL 2FEEI 2XKUA 2K9UA 3LQAC 4HCFA 2NZIA 3U4EB 3L5IA 5FOBB 3BZFA 4NX0A 3RWIB 3EHBC 4XC3L 1L6PA 2WV3A 4KZDL 1GC1L 2FSEB 3L3JB 3KJ6H 3OF6A 1ES0B 2XTLA 4P59H 3RLSA 1FL5B 4M8QA 4QT5A 4ZTPH 3FQUA 2YEQA 4JRYD 4AUJA 1HH6A 2IANE 2HFGL 4HH9B 5KVFH 8FABA 4TV3A 1X7QA 1VCAA 5AW7B 2HT4D 2P1YA 4YDJB 4NHUB 3RFZA 1HHIB 1DUYA 4TF4A 1E9PB 2F54B 5DS8A 3EGXA 2EACA 2EDWA 3B9KA 3JVGA 5E1HB 3CN4A 4JFXA 3MCKB 2WMPA 3LS4L 1ZLEA 3V6ZA 4TNFA 3T04D 5C6TL 1IM9D 1KPUA 1TTBA 2ARWA 1CL7I 4PG9A 1ZKAA 1OHQA 3AREA 4BQ6A 1NBYB 4E0RB 1M2VA 4F80A 1S9KC 4XO9A 3SYQA 2N1TE 3E6FB 3BESR 4L8SC 4NNPL 3KD4A 2X4RA 3CNKA 5DZ9A 2IAAC 4NOFA 1BQKA 4PREA 3CVHL 4UT7H 4ATTA 3E1F1 2ORBH 1QOKA 3O4OB 1UVQA 2MOGA 2AXFA 4HIPA 3LPFA 1FDLL 3KYMA 2LR4A 4FFWC 4NCC2 4D7BA 4U6VL 5DO2C 3LZRA 2WXNA 1XIWD 5ITFB 1QUNB 3E2HB 3BX7C 4LF3A 1TTFA 5I16A 3ZTCC 1FGVH 3TBVB 4WI0B 5TE7H 1YNKL 1BXVA 3FDWA 3K81A 4OCYH 5ABZA 5IUCA 1RJLA 3V7AE 5I1LA 3R8QA 4LIQH 4YLBA 3TEXA 3KYAA 3O9WD 4JFZH 5M95B 4H8QA 1LP9E 3B2XA 4WUKH 1TZIB 3TO4B 1VIWA 2VISB 3ASWA 3V6OE 1YY9D 4KVCH 5J6SA 1I1FB 1QX1A 4LEBA 2JTYA 3CZKA 5CU9A 3SDCC 5J7CC 1BJ1J 3HHRB 1WHOA 3FN0H 4XX5A 3KYOA 5EULV 4D9RE 5CS7A 3UEZA 5EZLA 5DMKB 2MCG1 4HZ1A 1AH1A 4Y16D 1DCEA 3MOBH 3DHUA 3LTVA 4FFVC 4BFNA 3FQ4A 1LYQA 4YO0B 2YLHA 2DJUA 3NEOA 2H6PB 4XWGH 1M42A 1WZKA 4DKEL 3VD7A 1UWGL 4DP9X 3DSNB 4LXFA 2J4WH 4YSPA 1JF6A 5A2KH 4W9HC 5MHSD 1HHIA 4N6RB 4K15A 1HKLH 4MJHA 3VACA 4R0LA 4D0CB 5L2KA 2FCBA 2P80A 3NDZE 4MNGB 2E7BA 3IXTB 2ZXCA 5KJRL 4ERSH 2DL2A 4JY6A 5I71B 5JZ7D 3C5ZC 5CD5D 5JHBA 5E94B 3MRQA 4TQEL 4U6YA 3SO5A 4DQOL 1WZAA 3MFFA 5DZVA 1GMIA 3U82B 3PYCA 3CMGA 3DJSA 3NGBB 4TNGA 2XN0A 3UCQA 2FLMA 4PRBA 1A1NA 1GOFA 3LKSB 4S2SA 2V33A 3JVFC 1IFHH 2PTVA 3FH5A 3M17A 3U30C 1LMKA 4GW1B 1ILUA 1OCRB 3FO1B 4WI0A 1N0XH 2XX0A 4XXCA 3I3BA 2PR4H 3KLSA 1JXFA 5EORL 3ULVC 1UGKA 5EOTA 3VI4B 2R4RL 4YHPA 2YMXL 5C0ND 4KKPA 2C4XA 1QUPA 2EEXA 1X9RA 3R0MA 5ACZB 4KQ3L 5F9DC 3PP4L 2BNQA 4Z0BH 4BFEA 5F7NC 1S7RA 3OKLA 3RWJA 5ACLA 4PIRF 3U7WL 4MVBC 5GJSL 5IMOB 1R3LA 2IQAB 5AD0A 5CWSA 1FFTB 1M71B 1F4HA 5LBSH 2XN9D 2WSPA 3ZE2B 1S7XB 3KGSA 1UENA 1KCUL 4G3YH 4BQCA 5I6OA 2ZOKA 3M1BA 4FQLH 5F9WC 3GMPA 4XN1A 3MLSH 3GI9L 1PAZA 4OZHB 5GRUL 2I9TB 1HL5A 4XMZA 5J8OA 2V2TB 4FX5A 1RZ8A 4PRNB 1DQMH 3GNML 3V0EA 1SLXA 3GRGA 4PY8J 1QRNB 4JDZB 1F3DJ 4C56B 4LFHD 3FTGA 1FL5A 4M8QB 3T65A 3Q6GH 2E9JA 1EZSA 1QEWA 3IMSA 2VSDA 2IV8A 2FLBT 2X53A 3BPLB 4MNGA 1YQVL 3C60C 3QXAB 1BD2A 4HJUA 5DQ9A 1E3ZA 4ZD3H 3BOVA 2JIXD 1AYRA 2QFRA 3U0WH 1JG9A 1NLBL 5G5DB 4E9TA 1H6TA 2EDLA 1HIMH 5T3ZL 4O9HH 3UPAA 5I66A 5IY5B 5B3JE 2L7QA 2ZPKH 4M6NL 3V6ZB 5DHYB 4YBHA 2WINB 3X11B 3P4MB 1CE6B 1MZZA 4Y5XA 1I8LA 2QSTA 3WLBA 3VWKA 1B0RB 5AOJA 3RWGA 4NN6C 4OZ4A 4GRLD 2MQCA 1FLTX 1QFUL 4KKRA 3ZPDA 1TQBC 1ADQL 5ISZB 1EMTH 4LSVL 3EJZD 3NRPA 2GBVA 4MA1C 4OJDH 5I6MA 4W9CC 5I8CB 4N90D 4EI6B 4KUZL 1UM6L 4TN9A 5E2VL 1KG0A 2C7FA 5HGDA 1AI1H 4J6RH 1L3NA 1I9RH 3IKCB 4IK6A 4CA4A 2FEDD 2WO4A 4FNQA 4BZ2L 1SMAA 1Z9SB 1N67A 2WQWA 3CC5B 1OP9A 2O5ZL 2XTJB 1JGEA 2OJZL 3K2MC 3QHZH 2YPVL 2YXMA 4DK3A 5F97E 4HUWB 3RYMA 4FTVE 5D7IA 1JCVA 1HL9A 4RH4A 3U1QA 2Z0UA 3X12A 1U2YA 1EEQA 1UZGA 3HPJA 1TJGH 4YAQA 4R26H 2PKDA 2AQ2A 3WNOA 4G9FA 3WL9B 5FYJU 1J0YA 2AAVA 1CF1A 1UH2A 2X7LA 2YSSB 2YA2A 1NGWB 2EO9A 3PF2A 4JHVA 1MIMH 1XGPB 2NY7L 3B6SB 4Z7VA 2VXSH 3UG3A 3F12B 12E8L 4MMZC 4FZEH 1ACZA 2R29L 2KYIA 1JZ5A 4XPTL 3KS0J 2ISDA 4IS6B 3GGWB 2UZYB 3SDDC 1KUMA 3AWFA 4PJ8D 2FQDA 3G6DL 3Q01A 2WQXA 4CKQA 5I23A 1IMHC 1G6RL 3S5LG 3SD2A 3ZTJH 2L7EA 3OAUL 4KJWC 4AQ8A 1SJHB 5EEWA 4ZAKA 2HKAA 5E6SB 4LDCA 2KLTA 2R51A 1AHWC 5GGSY 4POZC 1FGVL 5CBAB 3LHAA 4LCYA 1TETL 1C1EH 1D5MA 5I73B 3PE9A 4IOSD 4L1BA 5EIIG 1QABA 2PYFB 2XBTA 1BBDH 3OBAA 4JW3A 1RIHL 2VC2B 5E99L 4XPFL 3NJLA 4YSAA 1CT8A 3W0WD 2FT6A 2NXYD 1EGJH 4J3OC 5BRZD 1EDHA 4ZFFB 1JDAA 1Y18B 2Z7UA 3MNZA 4X50A 3W37A 1AIFA 3EF7A 5F88B 5K39A 1OM3L 1A4BA 5HGDB 1PY0A 5T5FL 3T2OA 1E27B 5IB3B 1BHGA 1OD9A 4UT9H 2VMFA 3A67L 3BVDB 4I5BB 5HGAA 3VXSB 1Q9LA 2DQCL 3QDHA 4RGMC 3Q8BA 4M7KL 4N8CL 4X4ZA 3MJ6A 3PV6A 4XAWH 2IADA 1PQZA 3HS8A 4K5OA 1P7HL 3N44F 2DWDB 2QV4A 4I3GA 3PHOA 4H1LA 1I3UA 1N3NA 5CEYB 2F7QA 2I69A 1QATA 4UTAH 2JWYA 4YC2B 2CBQA 5DQDL 1EHXA 1WCQA 3VQMA 1CJYA 2A6JA 4WI9A 4D8PB 1BJ1H 3PHQB 5FOJA 4B50A 1FZKA 4LOEA 3SJVB 3C2SA 3OR6B 4ERSL 1D5BA 4XCEB 5DJ2B 4PRPA 1BF5A 3D18B 3VCLA 1PX3A 1YMHA 1KC5H 3DX4A 3GSRB 5C70A 4ZFZB 4A7TA 3VFWA 1DBBH 1I1AD 1RIUH 1U41A 2DJSA 2FATH 1NCDL 3OV6A 4HT1L 4ES9A 4YHIA 2OTWB 5EEZA 4PLJC 3TYGH 4PLNC 5BVJB 3ZO0A 1T22B 2YQ2A 5L8LB 4PJ7A 5I1IL 1GPOH 1JHKL 1E40A 3ZYZA 2E47A 3N04A 2EDBA 5A16A 1ZJAA 5HGBA 4FTDA 3DX9B 1CFQB 3WTXA 2GVYA 1RP9A 1AJ7L 1XB8A 3EYUH 3HE6C 1YCSA 4OLZH 2ZCKH 4FYSA 5JW5A 3F00A 2Y5EA 2BNUA 4HPYH 4YHLH 3ETSA 3HJEA 5IFJB 4NI6A 4HWZA 1RJCA 4NGHL 4R5TA 3BJLA 1O6VA 4GBXC 3MNZB 5F88A 2WYHA 4OZ4B 3HW7A 4XNUL 5CO1A 4MQSB 4YQXL 2H26A 2V9TA 1A6UH 4FP8H 5LXVA 4R83A 1LE9A 2VRKA 4FDWA 4MSWB 2O4EA 2Z35B 4QHMB 4I77L 2YR3A 3WTVA 1R3KA 1S8DA 1XR8B 3RY6C 3O2VL 5C09A 1YUHB 2YFNA 3BVVA 1MREL 3DK0A 3RTQC 2TRYA 3P0YL 4CILA 3MROB 4A38A 5J57B 1T83C 3M8OL 1UWFA 4OI8A 4KGJA 3T09A 4YSTA 2QGEA 2A9MH 4ZO6A 3UERA 5AZEH 1S78C 2VXTH 2Z64C 1ZIBA 3T2NH 4TLSA 1R3IL 2CDGB 4JCLA 3KBPA 1ZANL 1YQVH 5IESL 4N5ED 2YWZA 4F57L 2X2JA 4H2AA 2QKIA 1KXTA 1X5MA 1NDMB 3FT3B 1Q9KB 2LTQC 3EGDB 3IB4A 1F6AA 4Y4FB 1JV5A 4OM0H 2CKBA 4FQHB 2AABH 2EIZB 1NGWA 1JPFA 2WK2A 3KCPB 2HFGH 3SPVB 3MNDA 1IM3B 1MWAA 4FLSA 1QWHA 3B6SA 4X4XB 5CLTA 4DP4X 4E9QA 3ZTEA 1CQKA 4LSSL 1S5IH 5CD5C 1YEKL 2DQHH 4JQVA 3DIVA 3VU2A 1OE3A 2JK5A 1N2RB 2GW5A 3QUKB 3LRLA 3NQIA 1FE8H 4OH2A 2ZSVA 3CWGA 3L4XA 4KKCD 3CFMA 4YZFF 2H47C 2IGTA 3IF1B 1SGKA 2Q86B 2N01B 3TCLB 2XXFA 1U91B 1UM6H 2CGZA 2EXTA 3NJKA 4FFZH 4ECNA 3LB6C 5TDNB 5DC0A 4YHNB 1IBHA 1V27A 4NP4L 5ELIA 3RTLA 3VFNA 1UZ6E 3GBEA 1IGJA 2F5BH 3CVHH 4NJ9H 1KIRB 4QGYA 4EF3A 2XWXA 1U4FA 1JUFB 4YDZA 1A5FL 1JGDB 1P2CA 3WY1A 2PCPB 4EN3C 3CN2A 4JO3H 3IJHA 2B3IA 3RVTD 4PRHA 1M05B 1IGMH 2BWQA 4I88A 4LAQL 1UH4A 2HTKC 5D93B 3MTXA 1UZ6F 5GGUA 4OV5B 4MS8D 1MEXH 1OPGL 4EXPX 4FTVA 1EBPA 3CV5A 3W0WB 3CFCH 5H37H 3TBSB 1FYTE 1JOIA 2JLLA 3CZGA 3HR5B 3O3EA 5CP3A 1IT9L 3SOBL 1UACL 1P53A 1SMOA 2IAMB 3L3OA 2HX8A 1N19A 5TQ2H 2AZUA 4Y7OC 4G82A 4QO1B 3KLKA 1MPAH 4KK8D 3N3EA 2MTPA 1U3HA 3OJ2C 5FECB 4Q52A 2IPKB 1KTLB 4RGMB 3ARFC 5L7XL 2VTFA 2X4OA 3ESUF 1KXTB 4LK4A 1CIDA 1X5GA 4NPYB 5INDB 1HE7A 2QBWA 2WWOA 4F5CA 3A6CH 4TOYH 4QHPA 3BYTA 3QG6B 4YDLB 3CUPB 3QZWG 1CTMA 4GBXB 1Z2KA 3GLEA 1OGAE 4YIQB 3OLGA 2CLVB 1DR9A 3NABH 4NZRH 3VD9A 1OT1A 3VTAA 3CQFA 4NQDD 1T6VN 4LNVA 3SDDD 4AC4A 2NY0C 1YMHB 5D1QE 1DZ0A 1UCBH 3T8VA 4D9QD 1HQRB 1U58A 2VL4A 3DXAB 3THML 5E24E 3MRPA 2V9QA 1A65A 4LPXA 3A3YB 2G5UA 1IGCL 1WS8A 4LF3B 4WI4A 3LRSB 5I16B 1SEBB 1MRDL 5DYOB 3KMDA 3FO0L 1ZGLB 2FIKB 2Q86A 4M7JL 4A55A 3EXJA 4Y19E 2ZP0T 4F58H 4YHNA 1MFUA 4HUNB 3QUXB 1NDGB 4WHTB 1A4JA 3Q5YA 2EVFA 5AZ2L 2EUVA 1I8IB 3TN0A 4AYID 4NO2A 5C3TA 2AJXH 3ATDA 3DO7B 4WI7A 4XP1L 1FFPB 1NGPH 4HEMA 3C6EA 1KYOK 2ENQA 3SDXB 3LZFH 2J88L 1RQ5A 2L7JA 5IFJA 1BV8A 4WI3A 3GMNA 2DLIA 1CDYA 4OZGB 3TEUA 1AD9B 1VADB 4GKLA 3ETTA 3D34A 2FT8A 2B39A 3BZ4B 3SY0B 5JR1L 5BJTB 3FUKA 5KVDH 3L1GA 4Q2ZB 5D1ZA 4WSKA 1WPCA 4TNEA 5EBLB 1H6FA 4XXCC 4ANXA 3U46B 3GTTA 1JK9A 3P77A 1MDTA 4ZFGL 3H55A 3ETBF 3GUFA 4HU8A 1JYNA 2P24B 3TZVD 4YBLC 4MBRA 1WAAA 4XCNB 5CCKH 4HXAL 4QOKE 5JORB 4R2GC 4G8FB 1EEYB 3L9BA 4PS8A 4K7PH 3RDTC 3BAWA 5AOIA 3ATFA 4NQEA 4WV1A 5FUOL 2YD7A 3T6ZA 2VZ1A 3OZKA 3S3SA 4OD1L 5C0AB 4JLRB 2R1WB 4OV6F 3QNYB 4GT0A 3LIZL 1OP5K 1ZSHA 5E9DD 3CUPA 2MPAL 3RUGE 3DOSA 4HCRA 4ZUUA 1NZRA 1QBLL 1RJZB 2BVPA 4JEGB 1FZOB 3FF7A 4LRNL 4HPOL 1LEKB 2HT3D 1OCWH 3BW9B 4U0RC 2CUMA 4H13C 3W9DA 1AJ7H 1OWWA 4HGWB 3C6LC 3NFSL 4HLJA 1M1SA 1OAYL 2WTRB 1G9EA 3JT0A 5HHOB 3BP4B 5BXFA 2CDFA 4B0MM 2GTZB 1CGYA 1SXNA 4OLWH 2DEXX 5GZND 4AGMA 1X44A 3LEYL 2ZOWA 1XCWA 3PXHA 3B9EA 1B4LA 2VSKB 3T0VA 4NO2B 5BUPA 2D73A 1QSED 2Y6SD 1AGFA 3P1VA 4ZX3A 1M6OB 1FDLH 4YDNA 4HWEH 2NXZD 2CIKA 1QHQA 1C9SA 5LKNA 3O2VH 4GFTB 1WC7B 1O0VA 2VUYA 4FQQA 3FQ2A 4KO5A 3BKYL 1JZDC 2YD9A 3M1BB 3PGCB 4XP4L 5JQ6H 5CJ5A 5DVNA 1Y0LB 4JPWL 5GSRA 3GSOB 1HYSD 5ANHA