2JQAA

Solution structure of apo-dr1885 from deinococcus radiodurans
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
149
structure length
149
Chain Sequence
MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title A copper(I) protein possibly involved in the assembly of CuA center of bacterial cytochrome c oxidase
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Metal binding protein
total genus 19
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04314 PCuAC Copper chaperone PCu(A)C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1890 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2jqaA01
2K6WA 2K6YA 3ZJAA 1X9LA 2K6ZA 3ZK0A 2K70A 2JQAA
chains in the Genus database with same CATH superfamily
2XBDA 5GRJL 3UTTA 5D6DC 3EDDA 2VISB 4JPKL 5ICUA 1C5CL 4LGRB 3W0WD 1CC3A 3S0PA 2DQIL 4AYGA 2LVCA 1T1WB 2NY1C 4Q0XH 3KYKH 3QXVA 2B1HL 5JTWA 4JR9L 3ME0B 1FNAA 3LPFA 1G7HB 1HYRC 3BUYB 2O6DA 4YJZL 1T7YA 3MJ8A 1AR2A 1O9VA 3V5DB 1EANA 3E8UH 3ARFC 3I9IA 5F7EH 4IM8A 1KTLB 2CR3A 1NAKL 1EJOH 3QUXD 3EHBC 1EXUB 4NO2B 2HJKB 2KZKA 5AOMA 4LIQL 4Z7VA 3CX2A 1XGTB 1NIDA 3NFNB 4QXGH 4QHUB 4BA0A 1JVKA 1AANA 3D07A 3DV6A 3LNEA 4FQ2H 4OFYA 1DJSA 1I1AD 4E9VA 1QW9A 5BNXD 4L3CB 4HSAC 3X3GH 2QQKH 1EUUA 1QSED 3KGSA 3JWNC 3I6GB 3TV8A 4I18A 3D85B 4P59L 5D7SH 4AJVA 5HHXH 2X4NB 1PNDA 4M7LH 4ELMA 4BH8A 4AMKL 3SOBH 1LO0H 2G9HA 2CDEA 2W95A 2X89A 3QDAA 3GBML 5C2BH 2VW4A 4XC3L 4ZTOL 5KSBA 2NY0D 3MROB 3JSSA 4NO5B 1S7VB 3MA7B 1AKJA 5DDHB 5SWZA 1DQJB 3BFOA 4LSVH 1Q0XL 3LQAL 2JCWA 4NBZB 4E5XB 4KO6A 2PWHA 5MEOA 4FL4C 1OAYL 4NBXB 4XC1L 5CMAA 4A7QA 5F44A 3PIQB 4G9FD 4S1RL 3FO9B 2KERA 3HS0A 2VLLB 2R4SL 2OZ4H 3NCXA 3G5YB 4TSAH 3WCYA 1SN0A 1RAMA 2NTFB 3MV7B 3ZTJG 1QR1B 2C7UB 3LKOB 5I8KL 4GRWB 3BKYL 1FVEB 4OTXH 2X4QA 5KVGE 1UKTA 3SQRA 4P9HL 1P5VB 1BW8A 3D8MA 4M93C 2EKJA 4HKZB 4PS7A 4R0LB 5AAWC 5ICXA 2WMPB 4GP8B 1L0PA 4PRPB 3DVGB 5F1SA 4OGAD 5I1JH 5C9KA 3FRPB 2YLKA 4YQXH 4JFPB 3P3UA 4TKWA 3ZDXE 4Q9BA 3W2DL 2R7EA 2YRZA 5EUOB 4AZ8A 3FB5B 1DJXA 4LEOB 2DN7A 3E1ZA 3EGSA 3RFZC 1DFXA 2APBA 2P42B 2NUPB 1CPUA 4APQD 3MRFB 4Y5YA 1UUSA 1RULH 3C8KB 1S3RA 3QZOA 1DJHA 4NWTL 2BERA 4J8QA 3T3MF 3QJXA 3PDOB 3QNYA 2XN9B 4CKQA 2GJZA 4NZRH 3WL9B 3L3GA 4NWUL 4NS0A 2LFGA 3JWDH 3ZX1A 4BE5A 2CU9A 1KIPB 1OKEA 5DQ9B 1QWHA 4AQOA 4I0PC 5GQBA 5D1ZA 1F2QA 1O9ZA 3H7LA 3ROLA 4HK0A 1AIZA 1HHIB 5KS9B 1DCLA 3DVFA 4NO0B 3VU2A 5HGAB 5E6UB 4L5FE 3CDGB 4LNVA 1D9KB 5DHVA 2Z7WA 5CUSL 2KBGA 1NC4B 4JHVA 4J12A 1NLBL 2FJHA 5I9QC 3GMPB 4AEEA 3O0RH 3RWFA 4DEUA 3VXME 2H26B 2YAQA 5PAZA 1VADB 3WKPA 4FG2A 5EPMA 2NNAA 5SV3A 3BD5A 5BV7L 2CRYA 2QSCH 4DUWA 1DFBL 3MRMB 4YHYC 3FH5A 4L8CA 5D7IB 3Q6FA 3BLPX 5EEYA 5AG8A 3MRDB 1CFMA 1W0WB 1QFPA 2E74C 2LW3A 2L4OA 1TJXA 4AUJA 3L1OH 3W39A 3U48A 3QNXA 4FFYA 1OWWA 2UY7A 4MXQD 1FLTX 2XG4A 4I3RL 5AW8B 3W0WB 3WKML 5JIIA 4O58H 2CR0A 2IXQB 3TEUA 1XBRA 2K6ZA 4N2NA 3FT2B 4C83A 4J6RH 1CDGA 4O2EA 4OZGF 1LXMA 1OY3B 4N9OB 5SWSA 4OM0H 3GTNA 4X7TB 2CK0H 3ILEA 2ZKMX 4ODUB 3BHBB 3POCA 4LLYA 1BJ1J 4JE0A 3PGFH 5ECGA 5IHZB 3QUXB 4WSGA 3I6KB 5DWUL 3V5KA 3ZHLA 1BMZA 1MCKA 3H6JA 4DK3A 3T1WA 4W9HC 3BDYL 5IK3B 4PAZA 4GRWH 5FR3A 1Z9MA 3D2UD 4GXUN 5ACZA 2I9TA 1FL5B 1I1AB 1VFUA 5I16A 1AZUA 1R1CA 1U42A 1F56A 3L5XH 2DEXX 1QSEB 3WS6A 4MQ7A 2ZOKA 4FDWA 1RIHH 5DJ8B 3WFDL 5B8CA 2V9RA 4F91B 3V4VL 2E7LA 4A38A 3BAIA 4D9RE 1SXSA 3CFEA 1JK8A 3NZ8B 4XXCC 3QI9A 5DZVA 3FYEB 2NY0B 4HMEA 5B39B 4LVOC 4Y5VC 1TQWA 1KWGA 1ZSDA 3M7OA 1SMDA 4UNTA 5DO2D 3N91A 4BEIA 1A25A 2OJZL 3F7YA 1GZPA 3QIWD 4FERA 3H9HB 2XICA 5FK9B 2Q6WA 3GIVA 2PP9A 3RHWF 1LWHA 5C0CE 4G9FB 4YHMH 3OZKA 3O2DL 3MGTB 4ZQTA 3S9DB 1IAIL 1AP2B 2O6PA 4F3FB 1JRHH 1FJ1B 3TT3H 1I9RH 3HS8A 2RFXB 1TJGL 2H6OA 4WFHE 1MZYA 3DO7B 3O2DA 2XETA 4FQQB 4KK8C 4KC3B 1YUKB 5CZKA 5I19H 2XIBA 5L2JB 3GRGA 2F54D 4BK5A 3TBTB 5INCA 4E9LA 3TXAA 1HWWA 4D3CL 1AACA 5IFHL 4PRIA 4YHKH 1J5DA 1HL5A 3ABZA 4R96B 4KQ3H 1NBQA 4WJKB 3ZYIA 3Q8BA 4G6JL 4JZJB 3NIFE 1OM9A 5FUCC 2X4UB 5LBVA 3QFJA 5LJYH 5E94A 4OCNC 4BWTA 1FFNA 1ES0A 1V7NH 4AKPA 1N8ZA 4BWWA 4PTUA 4NAJA 1OF2B 1GY2A 2VLRD 1W8OA 2P43B 5LO7A 2Y06H 4M1CC 1J0JA 4D8PB 4FADA 5EBGA 4LVNB 1KENH 1ASOA 2YPKB 1M05A 3G5XB 3NZUA 4APQB 1HSBA 1A6AA 4JFFD 4YE4L 1CGWA 1CU4L 5JW4Q 2W94A 2X70A 1G1YA 3P11L 4AXWA 4YHNB 1V10A 1BJ8A 4D0BA 2WCGA 4JDVB 4ODXB 3IMRA 3X11B 1M7IA 3TF7C 2FR4B 1JDAA 2KZBA 2GVYA 1OIOA 3SDYL 1CG9B 4DGWC 3T0VA 1JGUH 5IHLB 3CG8A 5IOPB 3MSPA 1D5ZA 3MRQA 1JN6A 5IWLC 3CZLA 4LU5L 3FB7A 3O3BA 1NANI 2KDYA 1TTGA 1T3FA 3RL2A 1KGUA 2HB0A 1EV2E 4KKBC 5FGRA 4X7DC 4Y1AA 5E1GA 2EDOA 4YE0A 2XCMC 4CJ0A 1CO1A 3CXDH 3KBEA 4IIQC 3FOLB 2A6IA 2WN3A 4B41A 4CVXB 3NIGB 4HIQA 2M8XA 4L4VD 3WI9A 1EJ6A 2F53E 3SPGA 1R47A 3FQXA 4HFUH 1ZHBA 4JQVC 2VLKA 1E27B 5IROC 3F83A 1OXYA 2HUEA 4ZYKA 4Q2ZB 2R1YB 2H32A 5IBUG 2XVKA 1EZLA 2JB5H 4ODVL 4Y9BA 4JS7A 3BEWB 3I9AA 4NFDA 1SXNA 5E2UH 2ORBH 3WJJC 1BLNB 2E7DA 2R69H 3A22A 4FEMA 1I7UA 2JQZA 4U6HA 1K85A 2K3HA 3WIIH 4YAQA 3BZ4A 1NOFA 1LMKA 1NCHA 2K70A 3IAPA 4PY7A 5FYJD 1FGNH 3POHA 4KAQH 4DN4H 5EF3A 3HG1A 1YQVL 1ZHLB 1OSZA 3QPXH 2DQUL 2QKIA 3UYRL 1QSFA 5E2VL 3EYSH 3BWZA 3G6JE 5D1XA 5DFVC 3QORA 4YBLB 3D2UB 4APXB 5DZOA 1S8DB 2VIRB 3U4BL 4MJ6B 2CKBH 1HQ4A 3LEVH 4HX1B 4JHWH 4IU2B 4BINA 1CICD 3ARGA 3RKDD 2OBGA 5FM8A 4F7CA 1TZHA 1M7DB 12E8H 1IC4H 1E5BA 1PG7W 1CE1L 2O5XH 1G7IB 2VXQA 3H2WA 3SY6A 2CO7B 1GGTA 4FS0A 4PN6A 4KHTL 4RAVA 1SEQL 2XTJE 4LPVA 1BQUA 1H0DB 5E1HB 5ACMA 4DKDC 4WSJA 4FQIH 3KYAA 4JPVH 3QIWB 1H15A 5HD8C 2EIEA 2ID5A 1WP6A 4G8AC 1FPTL 2PR4H 4PGDB 5FFLA 2Z1PA 4KQ4L 1HNFA 5EFIB 1QTSA 4CN6A 4ZO6A 3FQYA 3UG5A 2EDYA 4C56D 1II4E 2VXSH 4ZUVB 1UD2A 3D52A 3EYVB 3M86A 5CCHE 3HN8A 3T0ED 3LIZH 4B96A 3PAYA 5TF1L 3ZGIA 2WBJC 2N01B 2O30A 5K1JA 2X1WL 4PG9B 1XL6A 1GGIH 1T1XB 5EOCL 3WTTA 2EDEA 4WEMB 2F54B 1W72B 2J1YA 2OMWB 1FGVH 1GAFH 1NEZG 2AJXH 2JMRA 5D5MF 3K6NA 4UT6A 1U95A 1B0GA 3VXQB 1HCZA 4XP6H 1UFUA 3U9WA 2J8UB 4LEXL 1XD1A 2VE6A 2YOAA 4GQZA 4WY7H 3T8XB 4D7BA 1K72A 3BQUA 1ZVSB 5KBNC 2NT0A 3DC0A 3LQZA 5D8JH 2QPSA 5EZJB 4XHJD 1L4IA 1HH9B 1JPGA 1FNEB 1T4WA 3FCTB 4DAGH 1RZJC 2EH8L 3F7QA 2H9GB 2VLRB 1KTKE 3ZDZF 1KTRL 1T20A 1J05A 1KC5L 5IESL 3HUJB 3DOIA 3GBNH 5F3FA 4AIEA 2AV1B 3TM6A 1XMWA 4JFFB 4WGVB 2IPUK 2NSQA 4PJAF 4UQIM 4EE2A 2ADJB 3PGCA 3UTQA 1DQQB 3QWOA 3QZWG 4PS4L 1MCNA 1RK0B 3HNTH 2O5YH 3RA7L 4DP6X 4U7KA 4CC4C 2V2XA 1I1RA 1WTGT 4AQ8A 5GGTH 3OV6A 4MKMA 4MDJA 4P2OB 1KIUB 1K5NA 1LYQA 5C0ND 2VUKA 4MMZA 4PRDB 3TFKD 3OPUA 4HIXH 2NXYD 3TVMD 2YAOA 4Z7NF 4N85A 1ZLEA 3L1EA 1YN7A 2YARA 5T3ZD 2TAAA 3HAEG 4BXSV 4W9FC 5AAMA 1YMME 4OKVB 3STZB 3ALPA 1IM3A 5J6GA 3EF4A 5SX5K 2R23A 2VERA 4PWGA 2PYFB 4UTBA 1DQDL 3KGUA 4ZDHA 2GTWB 1JWMB 4F9LA 2Z92B 1J8SA 1JZFA 1HILA 3CIQA 3UTTD 1PG7X 1XIWC 4FI8A 5GS0L 2MHAB 3MLYL 3TJPA 5JQHC 1W0VB 4L4VB 4Z77B 3P73B 3W57A 3CSFA 3HHMA 4OGQC 2OQJB 3Q7JA 4H8HA 1GYVA 5E56A 2DQCH 4KPHH 2BW5A 5ANMA 4U1KA 5I0VA 1TZ8A 1XCWA 2UX6A 5MERB 2CJUL 4OIFA 4K9EC 1HESA 4M6AA 2O72A 1KIQB 1HQRA 1MRCL 1TENA 3Q48A 4GQ9L 2DBLL 2CRZA 4M48H 4X5WA 1O7SA 2YPLE 5HVHC 2IC2A 4GMSH 4FLRA 4K3EL 4KOCA 1RUKH 4QRRA 3HB3C 1S7TB 1MHCB 4XP5H 4OFYD 1ORSA 3GSOB 5FDWA 4M1GL 3MX0B 1KELL 4UF7C 1AOZA 4HZAA 4HETA 4K7PX 1LM8V 5EF2A 2O26U 5GZOA 5E6ID 3UBXB 5AW4B 1KJ3L 1T0MA 5H4ZA 2WUBH 2DTMH 2I32A 1F3RB 1U8MB 1MCWW 3ECVA 1CICB 4HOZA 2YSTA 3T2OA 1KCRL 1IC0A 1ET8A 1MCFA 4Z95L 4UBDC 3MR9A 1E3FA 1MJ8L 2NY4B 3WKQA 4XVJL 1KNOB 3M46A 3L13A 4G1MB 4OM1L 4RMVA 2R29L 3LH2L 5ILTH 1MVUA 4N2FA 4PGBB 5SWZD 1DLFH 3RNQA 4IU3A 2LAGB 3Q0HA 1A9BA 3LPOA 1O75A 1A4CA 3S5LB 5AVZB 3T65A 3WIFA 4ICXA 2BC4B 4RSVA 3AM8A 3QJUB 2RA1A 3D87B 4GMTH 1NINA 4ZUWA 4ETQA 2ROYA 4PJXB 1GPOH 1GMIA 3SGEH 1QVOA 1N2RB 1CDYA 1IC7L 4WF7A 4I4WA 2Z35B 4TQHA 4LOUD 2JKSA 4PUBH 4C56B 3K0YA 4DGUA 5GRVL 3K6DA 1MFEH 3ZHDA 2QTEA 3T0EB 4YFLF 1DO5A 4HIIB 4KNSA 4N8CH 2GW5A 1L6XA 4GYBA 4GW4A 1UM5H 1GGUA 3B9DA 4HKJA 4OF8A 4L37B 4UNVA 5CBAB 1I9EA 3VI4E 5I2IA 3VH8A 2F0CA 4GG6A 2AJ3B 1YDPA 1U93A 5F70A 4A2LA 5HI4D 4W9JC 5DUPL 3TYFB 5AYTA 1JUFB 3FFCA 1PD1A 2EYSB 4DP8X 1P4BH 2APWA 3LNHA 4ABVA 3UC2A 5JPNA 4RNRA 3MZGB 4B27A 3P3RA 3KLAB 4K15A 4XCNA 1SUHA 3PAUA 1RZGA 4HZLA 1EAOA 4LCYA 2YPVH 2OZNA 2ZP8A 3OD3A 3VRIB 4U1LA 4K5NA 4XBPB 3WKYA 4Y4HD 1FBIH 3MYZA 4FQJL 1ECYA 3AS0A 2AGJL 2Z4TA 2QLVB 4TQ8A 4PJBF 1UKQA 3NVQA 3IPBA 1MHEA 4NHCH 2DLFH 1E28A 5FYJH 4YDNA 1PQZB 3JTTB 1MHPH 2NY2C 4NP4L 4XMXA 5D1ZD 1TCMA 4CSSA 5J1TC 1ZLWK 2HT3C 5IOKA 1TQBB 4R26H 5IFAH 1RURL 3EO1A 2CSPA 2I60H 2J20A 2NXYB 3KL0A 4N0FB 5GJSL 3TVMB 3OKOB 2AVFA 2EXYC 3ABGA 2QEJA 5EO1A 3VD0A 3LVEA 4NSKA 2HTLC 2NY5L 1HX0A 5D7JA 3L4TA 1F4XH 4HC1L 2CHZA 1IQDB 4Y7MA 3E3QE 4HUWA 4PRBB 2OS7A 1PZAA 1BAWA 4MJHA 4AQ1A 4F9PA 5CEZE 5E5UB 4B9IA 3VQLA 2BZ7A 2I07A 4KHXH 5CN2A 3ZHNA 2FBRA 3ILDA 1MWAA 1J8HE 5DQJA 2ZCLL 4X0NA 5IFJA 4ZS7L 1BAFL 3GRWL 4YXHL 3DRQB 1F00I 2ICEC 2J88H 2J2ZA 2ZCHL 3Q2LA 3JQOB 4Z7QB 2Y9RT 5AB2A 1JWUA 2XFGB 4IW4C 5EN3A 3IJ8A 2HRGA 5BS0E 1YYML 4G8GE 5DUJA 2YMTA 2L7UA 5HDWA 2QVIA 4XNMB 3RTQC 5T1LD 3KR3L 5EUKA 2HWZL 1VZIA 4QKXB 3VFPB 1LE5A 2XI9A 1ZT7A 1U8KB 4G72B 4GEIA 2P4AB 1PAMA 1WIUA 3FT4B 3LHPH 2X4TA 5DXWA 4DP5X 5C7XH 3JXAA 4OUUA 4L4JA 4KUCF 2VDMB 5DD0H 5JUEL 4EPSA 3BKJH 5CM1A 5E6IB 4HSQA 4I18B 5DEGA 4OLVH 3T8MA 4PG2A 1TIUA 2BY0A 4LIQE 3EXJA 4Z3TA 4BH8B 1M57B 2VW6A 5JR1L 2BVUA 2W91A 3B83A 3E7JA 3VXMA 5I30H 3X1GA 3BMWA 3QI9D 2UZIL 3Q06A 4WFFE 1OB1A 4LT7A 2DV6A 1YUHA 1FL6A 4IQHA 3DVNB 3EBGA 2B9BA 5SWZB 4HUKB 4F57H 4HS6A 4DNLA 4MBRA 4QCIA 3WIHL 5MHSD 3P30H 3ULVL 3LNDA 4XTRD 3U4KA 4XWGH 4R4NC 3A6BH 5CMAB 1WA1X 1R3KA 3HI5L 2YGPA 2B08A 3HS0B 1DSWA 3JVGA 4ZTEA 3L3JA 3FU9A 4GAJL 2OFQA 4RRPA 1YEDA 3HMXL 3WELA 4Y2LA 1LO2L 3O3AA 5JNYA 1R75A 4X4ME 4PWKA 2QKSA 3GO1L 1BPVA 2OXHA 1IT9L 3E80A 4W6YB 2Q9OA 4W6XB 4ZO8A 3U1PA 5F3BA 4RRPM 5BJTA 4PRID 2X4QB 4XZUA 5T3ZH 4I1NB 1A1NB 4LLDA 5IUCA 1IGFH 2B0SH 3E6FB 5ICXB 4TPRL 4LEEA 1GHFL 3GTVA 3QFJD 2C9QA 1OCWL 4MD0A 2JE8A 2R83A 5D55A 3QG6A 1K6QH 4PJHA 4H4NA 4ZNCD 3KXFA 1PDKB 3KWVA 3HCVA 4AEFA 4W9EC 5EC2A 1ZT4A 3NIDB 1WQVT 2YXMA 5ITFA 5D4HA 3ZKND 4FCHA 1PX3A 4Y4HB 3RVVD 2P3YA 2CLRB 3AU1B 4IRZA 1UGNA 5HY9A 1OPGH 4Q9CA 1U8HA 3QNYB 4PWJA 4JY5L 4UIMA 1W80A 3IFPB 3ZYOA 4HPHA 43C9B 1Q8MA 1I8AA 1UENA 1NCDL 4Y9FA 1JNLL 4PY8I 3FQTA 3CFJA 1TT6A 4UI2A 4LCWE 4LVHC 2OK0L 5E24E 1NSNL 3BGFB 3CZEA 3DMMB 1P6FA 4IBWA 3VX0A 1IEHA 4C47A 4X5PA 2VDMH 2WN2A 1NIEA 1O6SA 2FJSA 4FLOA 5HI5D 2FJHB 1J88A 3NK4A 5EO9B 2IQ9L 1J1XH 1W9XA 5DHXB 3RWFB 4F8PA 2HLAA 4HKBA 2W9DH 1K8IA 4O2FA 4Y1AD 4IHBA 3OR7B 4MGXA 5EPMB 5F7AA 2KZWA 3W5MA 2P5EE 1RUMH 4PJCF 4H13C 5CZXD 3L95A 1QFWL 2CJTA 3UH8A 1WFUA 4FG6C 2NTSP 2OI9B 3QRGL 3EO9L 3QUYA 4KKAC 4PJXF 2FX9H 4QLWA 2RQ8A 1N8OE 1CN4A 3HEIB 3L4WA 3NJNA 2VLKD 3A4FA 2BVYA 4ENEC 1TJIH 4TNEA 5FIEA 3W39B 1WFJA 5E1IA 4PJDF 1EZVX 4XI5C 3ARUA 2X4SB 1SY6A 5L0QC 2J4WL 4X99A 4AVJA 4EDWH 1GC1C 3S88H 3MACL 3CNKA 3G9VA 3O6FA 4XNZB 4LSQL 4XRCA 4O2EB 4HGKC 3MFGB 3V4LA 5L88L 2E8YA 4EI6A 4W9IC 1HKLL 1U8IB 4UOJA 1YEGH 4O5LL 4PGJA 3HBPA 3HG1D 4QPEA 3ZTNH 4FHKA 5IBTH 5T1LB 2BK8A 1QTYT 1OEZW 3IU4L 1PMYA 1HINH 4IKJA 4YZFE 2FQFA 3QORD 3JV0A 1GSMA 5ACZB 4GSQA 2I9TB 5GS1B 1WFIA 3RHWK 4Y2DD 1JZ5A 1T03H 5I66A 1UB6A 5I16B 3MRPA 1U33A 5IVZA 3TH4T 2DOCA 4XE0A 3ARGD 2YXWA 2JTYA 4J3XA 5AW5B 1C12A 5KW9L 3Q6GH 3RNKB 2AMGA 3WHE0 4F58L 3V0HA 5I0WA 3V79C 5EU3B 1JK8B 3P4MA 3QI9B 1CE6A 4ETYA 1G6RA 4QRSA 3VXNA 4BKTC 1ZSDB 2Y72A 3B8YA 1NBVH 4GUPB 4QRTA 4U05A 5AVVB 3O8XC 4JZNB 5KSVA 1GZPB 4TQEH 1ZJBA 2KL6A 2AEWA 2F53A 3NSFA 4KROD 2GUOA 3IJHA 1X5GA 3WLWD 4JJHA 3WEBA 4ONGH 1KCUH 4ZSOB 4XNDA 4P4KA 4HK3J 2UZXA 1QLEL 2HCZX 4X6BA 1S7XB 3BJ91 3SD5A 3QISA 2AS5M 3MN8A 3RWGA 1FFOA 3AREA 3N06B 5B3JE 1YY8A 4Q58C 3EGXA 4OGXH 3IGUA 3B9KC 3U83A 2Y07H 5INCB 3EH3B 2I27N 2I7SA 5ESVA 4PRIB 4OI7A 4I8DA 5E70A 5TD4A 3NCFB 4U2YA 5J1SC 1EQWA 4ZX6A 2QGDA 4YPJA 3QFDB 4GG8B 2OMYA 5FHBH 3QFJB 5AW1B 1ZDSA 2NUTA 1ES0B 1MIML 2ALAA 1N8ZB 1T5WB 2ICWI 2OL3A 5DS1A 2NY7L 2OMXB 3Q5YA 1A9EB 4DTGL 4K7FB 4FFYH 2D03H 2EC8A 2R56L 2J55A 2OW6A 5EBMA 4AMXA 4WEBL 4Y9GA 5FHAL 2HA1A 2PCFA 4G42A 3AXHA 3RY6C 3BWUC 3MMEB 4O4YL 1HEZA 1U9KA 4LSRH 2X70B 3D18A 4Y2OB 1BQSA 1Z9NA 1QA9A 5TQ2H 2BFVL 3CLFL 3X2QB 1EVUA 4KY1H 4D0BB 1M7IB 3BZDA 4RAUB 4EOWL 1ZIBA 1RJLA 2HTKD 1OANA 4LBAA 1G4RA 1SHMA 2FH8A 2O6FA 2Z65C 3T0BA 1JPTL 3VMOA 4X8GA 5IG7A 3VTAA 5DR5L 3MRQB 4U3CA 1JN6B 2AZUA 3DXAA 1N0LA 3FB7B 3O3BB 3TONA 4U1GB 4RMTA 4Z1PA 1F41A 1FV1B 4Y16A 5E08H 2EYTB 4RFEA 4ZD3L 4KDTC 1IM3D 1T3FB 4OCYL 4ONHA 2PETA 2CNYA 3QUMA 5FO9B 4Y1AB 3BJLA 5K5YA 1F4WH 5IW1B 1JV2B 2X41A 4G7VL 3MNWA 4R83A 5LAXA 3TGXA 1G87A 2WQ8A 3CDYA 4NGHH 5JIHA 4BBWA 2A6IB 2EICA 5DQDL 1KJVA 2FUQA 1GCFA 2QQNH 3BGAA 3VXUA 1Z9OA 4AGLA 3JWNG 4FFVC 3ZZ1A 3FQXB 1WT5A 2ZJSL 5DZNA 4Z3EA 2GHZA 2VLKB 4KMTH 1I8LC 5J06A 3C6SB 4B9ZA 4MAUL 1EGJA 2H32B 3DBXA 4JB9H 4IOIA 1CFVH 4LPWA 4M5ZL 1TEFA 2APSA 3KPPA 2IAMB 2DMCA 3V52H 2XG5B 2WC7A 2YZ8A 3K6FA 3VAEA 2F8IA 4JFWA 2W92A 4S0HA 1J18A 3EW3B 1OP5K 4YAQB 5KSAC 1GZHC 4MNHA 3RUGB 5IB2B 2JJTA 5CSZA 4PY7B 3LS4L 1N10A 4ONFL 3MC0A 4HOWA 1SDDA 1A3RL 1JNNH 2QKIB 2MTPA 2DQHL 5C0RH 5AKVA 2QVTA 1Q9OA 1XGPA 3EJZD 4JZJC 1HHHA 1OTUD 3PQYA 3QORB 4Z76A 5GZOD 4Y2DB 1BVNP 2MQ3A 3CSPA 3BYYA 5HSFA 2NSXA 1PD6A 3ARGB 5FFGA 3NZHH 4F7CB 1TZHB 1YMMA 3ABLB 4NZJA 2CO3A 2NYYC 3OAUH 1CL7I 3LZPA 3EDKA 3NEEA 4NAQA 4CJ1A 4JAMB 4APQC 5DJXA 3D0LA 1KCVL 1LTXA 3PAVA 3QEQA 5CLZA 4B9JA 4RAVB 1MQKH 1PY4A 4CBPA 4Q9QL 2Q7YA 2XXGA 4UT9L 1NMAL 4L2YA 4K5LA 4A7VA 1H15B 3VFRA 4G59C 1ZVHA 3QCVL 4OD3H 4KROB 2JH2A 2ZNWA 5GSRA 2FX7L 3QHZH 3NTCH 4PRAB 1TPXB 4ZPTA 2IWGA 3VACA 5FO7B 3EOTH 3BESR 1ED3A 1LLAA 3H3KA 3TIDA 1G7MA 4X5LA 3L2NA 4J3SA 3GZKA 2IIJA 3QHFH 4PHXA 4WJ5A 4K94L 1N7MH 4F24A 7CGTA 5C0FA 3VRLF 1WWAX 4HWZB 3KBHE 2NZ9C 4KTDL 1YPZE 1U95B 1B0GB 1FAIH 3NRQA 3DKHA 1N5AA 2A4EA 1X5ZA 3NCYS 3FFCD 4WI3A 2A9NL 2PLTA 1MJJA 1MRDH 5E4OA 3VWJA 3WE1A 3V9EA 3P0YL 1JPGB 3FHEA 5KTEL 1BVKA 2FJGB 2MPAH 2HFEB 2EXSA 4NUQA 3MCYA 2W60A 2AQ1A 1P7QA 3B5HA 3DV4B 4P2QE 4HAFA 1U3HD 1XB3A 3B8SA 4OT1H 4P57B 2H32H 2WLNA 1H3PH 1LE9A 3JWOC 1K3IA 3QPKA 3WUWG 1ZTXH 2R4RH 4KXZI 1MG3C 2H6UA 5ICYA 3CFMA 1KBGH 3ETBF 3PHQA 3UTQB 3QWOB 4YX2H 2AJYL 3AG4B 4G8EA 5DUBB 2OMVB 4XXWC 4YBLC 1X4XA 1B4RA 3IFNH 1ZS8B 1WFOA 3SPHA 3KLDA 5EO0A 4FXKC 3GMQB 3VI3A 1KGJA 3L5WB 32C2B 3OKYA 3Q3GB 4BH7A 3MZTA 3WEXA 1K4DA 5TFSL 1WVZA 2WQSA 3S3CB 5B3NA 4L9LA 4P5TA 1T22A 2LFEA 4WV1B 4NRXA 5D7JD 2G5BA 1IM3B 3L3DB 3EYOB 4OU3A 5I15L 3BOVA 1KIRA 3TBWA 1UWXH 1B4JL 3N55A 1KZYA 4FFZA 3ZL1A 3VD5A 2DQDL 1RUAL 4W9KC 1HILB 5GGUA 4HUXB 4PQXA 1NFDE 1B9KA 2VXQH 4FJYA 1FH5H 4UDTA 5KUMA 2CMRH 3V6BR 1YO4A 2JKJA 2E27H 2AZAA 3P4LA 3X13B 3AXLA 5HDQL 1VA9A 1U8JB 1NEZA 4AENA 4XVTL 1SEBA 2BSBA 4LRNH 4TRPL 2YHGA 1CGYA 5ANMB 4U1KB 2W0LA 3DK2A 4PJ5E 3JYCA 3QRFM 2BS71 5IEKA 1E4XL 1RHHB 3LKQA 3JWNE 1AS8A 2CBQA 3MUGB 3SDXE 1BDYA 4BK8A 5ADOL 4UTCA 4EF3A 4H1LB 1XSKA 4FYQA 4JFTA 1MFNA 4LLUA 4ZMQA 2C9SA 2HJFB 4PGCA 4CILA 3WLBA 4UT6H 1INDL 1RFDL 1T0MB 5JORB 2XXMB 4QMEA 1R3HB 3B43A 5L4JA 3UZEC 1E9PB 3EYFB 3L4YA 3QZWA 4FKHA 3VXMD 4D94A 3GMOA 2EC9T 1WGVA 1OAXL 2EUZA 3MR9B 5EC1B 3ZSSA 4EZMA 4KNQA 3K4ZA 1T0PB 1UM6L 3DI3B 2VDQL 4PREA 5KYXA 3QJRB 3FUMA 3RNQB 4J39A 1NGYA 4IDJH 1CFTB 1A9BB 1H6UA 4BQ8A 2G3MA 3HZKA 3T65B 2WQAA 3WIFB 1CGXA 4O51B 2YEQA 4YDIH 3MLSH 4CW1A 1A7BA 3Q8CA 4P2OC 1J8HA 4QOKA 3QYNA 2IH1A 4ETQB 1ZTMA 4JCMA 4I88A 3B4NA 2CCVA 1IQWL 5A2JH 1G9NH 5JIMA 2BZCA 3WDJA 3T2QA 3SDDC 1I7TA 4DGVH 1A6ZA 4KH2A 4G8GA 3CZFA 1DUZA 1XV8A 1IAOA 3AC0A 3D48R 4KWUA 2XZAL 4BRJA 5GISL 3B3BA 4P0DA 2NX5A 4JY6B 5A2KH 2WXOA 4GW4B 4JFHE 3EADA 1OOAA 1X5YA 5I1IL 2BNRA 2XY2A 1HWHB 1KB5A 4W68A 1Y07A 3FT3A 1YDPB 2Y6TE 3WNIA 4K3JH 4AYBA 1R4XA 1DEEB 3U82B 3SPIA 4KV5F 1TG8A 3K4DA 4UTBH 5AL8A 5ISZE 4HFWB 2O4EA 2EH7L 1DBJL 3BP7A 4JDZA 3II3A 3KXFD 4XCNB 4H2CA 2W88A 5FLUA 3WN5B 4NLAA 3H2QA 2N59A 3RUGF 4D9RD 1JWSA 2X7LA 3UJJH 2BNQA 5CWSA 2X6VA 4KMLB 7PCYA 2EECA 4TSCH 4S0TD 3RL1A 3NT0A 1U3HB 2P5PA 1HU8A 4FZ8L 4PVBA 3GJFK 3N43B 4DKEL 5I1HH 3WGVB 1ITBB 5T33H 2CXGA 1HXMB 4P3DB 2W8CA 1ML0A 5FA3B 2IPUG 2LR4A 2EE2A 3NJKA 1AC0A 2DYPA 1OAQL 1J9CT 5C0CD 1LO4H 4KX9A 5HGHB 1S7WA 2BHFA 1G0YR 4W9CC 3CU7A 4YEEA 2G3XA 4L05A 2KH2B 2EINB 4K7PL 3CMOL 1D2PA 1NIBA 2EDQA 3BUBA 4PJEA 4PYGA 2WD0A 4Z7IA 1JMXA 3EO1B 2WZPD 4X4MA 3RKDC 1SXBA 2N1KA 4HCGA 2GITA 3K3QA 2NY4C 1BFTA 2K7PA 4NSKB 3GSNL 3WHXB 1E3ZA 2UXVA 5D7JB 1DBMH 2VL5B 3ZE2F 2Z0BA 4HVBA 4JFDE 5CN1A 4Y5XB 3QRLA 3RZCA 4XNXH 4H8WC 1EEZB 1ZEAH 3GK8L 5JHLL 1YEHL 3GSNA 4MA8H 3IE4A 2I07B 2WKOA 3OAZK 5G55A 4DQOH 1HEHC 3W37A 4QAWA 3UDWC 3Q9QA 4G9DB 3DOSB 5CZVH 1PJ9A 1JZGA 1MWAB 3S35X 4U1IA 3ZDXB 4E2OA 3GEFA 5IFJB 3VTMA 5HDOA 3MXWL 4AK1A 2J2ZB 3WS3A 1IARB 1WSST 3O6FD 1JWUB 4ZK8A 3GSVB 4DN3H 3T0EC 4J6IA 2P48B 4PWIA 3T09A 2E4FA 3BP6B 3NDYE 1IU1A 5F72S 1FZJB 2IPKA 2JCCE 3F05A 5EUKB 3ZE1F 1ETA1 3SQBA 1I3GH 2AEPH 4BCYA 1ZT7B 1F3DJ 2K1MA 1V55B 4RMUA 1OQXA 4FQPA 3C75A 4X9GA 3CWGA 3FN0H 4MCZA 1X9QA 3M8OH 1A7RL 3MUUA 4OUUB 3SPJA 1MFBH 2DRUA 2P80D 5KYUB 1NCAL 1KN2H 3QZLA 1NBCA 1VB9A 2OP4L 4FP8H 3H0TA 1FNLA 2XJKA 5H37G 4KH9A 1SM3L 4JDTH 3VXMB 1C9SA 1EO5A 5J12B 1T7WA 5I17A 1F11A 2WXFA 1NKOA 1OB1B 2P46B 3QUZB 2R0LH 3PFUA 4IBVA 3QXUA 1YUHB 1FL6B 2YD0A 5CCJA 4X6EA 3NCJL 4HWUA 2BLFA 2APFA 5CJ8A 2V2TA 5D96B 4A2DA 1FUNA 4QCIB 3LRSA 2F53D 5EIIG 2R9HC 1UVQA 3QXDA 3FQ4A 5DC9B 4N20A 4KMQA 2P24A 4P4KD 5E99H 3EOBB 3S6CA 2HT2C 1XH2A 2HFGL 2PXYD 4EN3C 1YY9D 2R2BA 2K4WA 1TQBC 2YC1B 3IGAA 1QUNB 4NKOA 4QNPE 5I0ZA 4GAYB 1GJWA 1PZ5B 1YEDB 2B7DT 3R18A 1GW0A 1EAPA 1TVDA 2DWEA 5TPWL 5JNYB 2BWDA 3QBTB 1M2OA 2EO7A 2P44B 4P3CH 4U1NB 3RKPA 5BRZE 5MP6L 4OZIE 5C6TH 4KZDH 1BFVH 2FT8A 4OI9A 4UQ2A 1I8KA 4B7LA 3R06A 5T3XL 1DQLH 2PWDA 4LKCA 4JFOA 4X8CA 1A5FH 5D1QE 4BHUI 2OMNA 3RX8A 1FFPA 1MCPL 1TLKA 3FU5A 5KVGH 5ECJE 3U30C 3U36A 4AV5A 4MD0B 4UTAL 4S1QL 4BSWA 4QF1B 5ID1B 4DCQA 2ICCA 4G83A 2V9UA 3BC9A 4G6KL 3QG6B 4U3HA 3SDCD 4WI0A 3CHPA 5LCVL 1CUOA 3HCVB 3RP1A 5IV2B 1LHZA 1AVAA 3CN3A 1MWAH 1CF8L 2FQDA 5GRUL 1JBJA 3FPYA 1GOFA 3L9RA 2WVVA 3EYUL 2EKSA 2JK5A 4NENA 4PIBA 4R2GC 2XTJD 1CXHA 3AT8A 3QIBC 3CFBB 5HY9B 1QX1A 2B59A 2F7QA 5KYWA 3CC5A 4UIMB 3TF4A 2MCPH 4PJ8B 3UYPA 4G82A 2WLIB 4PBVC 5F1IB 3KPNB 1GSKA 3HZ3A 4XN7A 1ZLUH 3CFJB 2DM4A 3ESVF 1SUJA 1WHPA 5C0CB 3NOIA 2YQ2A 1URIA 3CFDB 4HUMB 3T6XA 1WA0X 1SBSH 5E6IC 3P77A 2ZX7A 1AJ7L 4FFTA 3EFFB 1KLGA 5E1AB 4AJWA 2ITDA 4Y16D 4L5FH 1TF4A 4OVUA 1NAMB 2GTZA 4TUJB 2LABA 2WXKA 3MXVL 4C4KT 4HKBB 3VFSA 1JGDA 4O2FB 1ASQA 3U9PH 5LG6A 5I1KL 5FV1L 3DRTA 1HKFA 3MBXH 1EEQA 1YYLH 5D2NE 4QO1A 5HDRA 2DI7A 3L95B 4PP2B 5TE7L 4E41A 1L6PA 3LKPB 5GGQL 4XO3A 4FTVE 5EHFA 3EGDB 3NIFB 3VXUD 2D0GA 1CGSL 5HI3C 1CDBA 5EG6C 4H20L 4PJIF 5E5RB 1PZ3A 3JUYA 4GRLA 3ECBA 4Z7UA 3FB8B 3SGKA 3BSGA 4ELKA 4X99B 4JPIB 4ODWA 4ZUUA 3ZUCA 5F0JB 5AZEH 4DQAA 1HS6A 4AV4A 3QZPA 1KSRA 1DE4A 4XAWH 1T7XA 3T4AA 3IDJA 3DLQR 3ZTDC 5I73B 1I8MA 2XWJB 3KPQB 4BD4A 2ZUVA 4TMPA 3ZR6A 2F5AH 5ADPH 2X1QA 4HUUA 1A3ZA 4HUCA 3O2VL 4AX3A 4F8LA 4HEMA 3MRPB 3BKCL 2VDRB 1RUPL 4CDHA 2CDFA 4N0YH 1ZAGA 4F33A 3U7YH 1N18A 3ERXA 3BZEB 1C12B 5HHQB 3H8NA 1YMMD 5J7CC 4M8QB 3SKNB 4WI2A 3ZDYE 1RK7A 2JJSA 1U8LA 3P4MB 1AD0A 1J0IA 1DL7H 4QRSB 4YBQD 3VXNB 3H53A 1XO8A 1TZGH 5LNGA 4E9SA 4X42A 3RIFF 4N8VB 4IRZH 1U36A 3MAWA 2VH5L 1NJ9A 1NWOA 2F53B 3VVVA 3IJHB 5BVJA 1AY1H 4HH8A 5IQ9B 4P4KB 3DMMC 3GSQB 4RGNC 2YRPA 3QNZA 2XXCB 2PXYB 1UASA 4NN7C 4R8WH 3DX7A 4X6BB 1NBZA 4NM4H 4NB7A 1KBWA 3UTZB 1OM3H 2OMUA 4YDKL 1IEAA 2KC0A 1YY8B 2NYZA 3EH5B 3L1GA 4TNVF 5LGKA 2PO6D 1N6QL 4UILH 1NGWB 1F6LL 2FWLB 4WW2A 4EIZC 1OB0A 3CVHB 4NJAL 2VSMB 1KFGA 5ESVB 3H3PH 2WK2A 2XQYK 4HUVA 1P1ZA 4HIEA 1G7QB 4HT1H 3ZDXF 2RIKA 4KO7A 3FTYA 3G6JB 5TQ0H 1R3JB 2O61A 4NNXA 2V8MA 3OKEA 5HYFA 1U41A 1UT9A 2NUTB 3VWJD 3SBPA 1PF3A 1FP5A 3RYMA 2EDXA 3J07A 3V0WL 2EC9U 3ZTJH 1L9RA 3QULB 3SDCB 1JYVA 1CXEA 4MD4A 1P7QD 4MD5A 4C4KO 5F0PB 1JTOA 2R27A 2P52A 5DRNB 4BQ9A 4F7EA 2JFCA 3Q13A 1SY6H 1UA3A 1HL8A 5EBMB 5TE6H 5E8PA 1XTLA 2CA3A 2Q1EA 2PCFB 4LDCA 4M61B 4NCC2 2XTJB 4NYLA 4YC2C 1D7FA 3L48A 1BG1A 1HEZB 4G80A 5I23A 4Y4KA 1F6AA 3D18B 3VQ1C 3ISRA 1N12A 1RJCA 1T0NB 3H9ZA 4FLQA 4K71B 1V54B 2JWYA 4ODTH 4G8IB 2VRAA 3F6LA 2AJUH 4QGYA 3BPCA 4QYOB 2I9LA 4JFUA 1UJ3C 5GS1C 1GIGH 3ILPA 4IGBA 3TFBA 3WFHB 4ZMPA 4ZO7A 2WUCH 4A55A 2E7CA 4HBCL 1N3NB 2ZONA 3ULUF 2ARWA 2YQGA 4U0RB 1U3YA 3U1SH 4JFQA 1XAUA 2FBOJ 2VDRH 4P5TD 4Y16B 3F7VA 5I6LA 4ONHB 4MAZA 1IBZA 5CSBA 1DVFD 3QUMB 5AOIA 4YGAB 1KFAH 1VFBA 2XN0A 3HRZA 5D93C 5EZOH 3BD3A 2GFBA 2HH0L 1ETJA 4OLZH 5DVMA 1DZBA 2J57A 1QPKA 1X3DA 4KTEH 4XTRC 3TT1H 1DBKL 4JFZH 1Z9PA 1CVRA 2AXHA 2ZX6A 5DJCB 1YNLL 2Z7UA 5EMYA 4HJ0D 1K9TA 5K9KA 2WTRA 5I71B 3DBXB 1A7QL 3EO0B 1R9FA 1I8IB 3FCGA 3KPPB 3I50H 1NM9A 3B2UC 4OVVA 3UYOD 1QLRB 3JV6A 5FB8A 2H8PA 4JO3L 2ZP9A 4MNHB 5CSZB 3P9LB 3ARSA 3OHMB 4Z7WA 1BA9A 2Y1VA 4J8RA 4CVUA 2BP8A 1IX2A 4ZMVA 3T2NH 1HHHB 3CVHH 1RZKH 1SFDA 3KVPA 2GJRA 2ZXQA 4Z76B 2VYRE 1E50A 1PEZA 2ATKB 4GI8A 1ZANH 5IW3A 2CXKA 5ENWA 3UJIL 3PNWA 4EO5A 5BRPA 4Z7OF 5CR8A 2W81C 5F9JA 5D6DA 3VD2A 1YMMB 1QACA 4JY4B 3WTXA 4OZFG 2ZX8A 3IDIB 3MRLB 1YCSA 4XP4H 1MN4A 2F5BH 1FNSL 1G9MH 3D39E 1G0DA 1BSIA 2J25A 1DDHA 3OJ2C 4LPTA 5CEZD 2ZXWB 1DSYA 1NFDA 3G04B 2Q7YB 3ARFA 2BIOA 3JV5A 2ZKHL 1PKOA 5JQ6H 1P69B 1J8HD 5JHDE 5A3ID 4QRPE 2WHVA 3RWCA 1T83C 4JKWA 5GSRB 2L04A 2XPGA 2MCAA 4ZPTB 3EJPA 2FBJH 5CJQL 1NPJA 3VXSE 4KK9D 4OGYL 4F1SA 1JHKL 4G8GD 4MS6A 4YL9A 4XPAH 2LQRA 3GQFA 3SYQA 4KUZH 2NX5D 3VYPA 2XN1A 4L0ZA 1EO8L 4WJ5B 1BPLB 4Z78A 1B88A 2FT7A 3BH9A 3LY6A 2WP3O 2PO6B 3NIFF 3BEVA 1F0LA 3SDAD 3VRJA 4P23C 5IBUB 4LBEB 5HDLA 2BS9A 2VOTA 2CALA 3SCMD 1GR7A 2Q10A 3MRGA 3QUMH 3CBRA 3SGEI 2P26A 3Q9PA 5F7MC 5AW7B 3CDFA 4HCRA 3WXVH 3FTVA 1MJJB 2EQDA 3KCPA 4PGZA 3UCQA 3VWJB 1MJ7L 4UB0H 1MDTA 1TVBA 2NXZC 3T3ME 3WGUB 5ID0B 2IAMC 2BNQD 3IBEA 2J6EA 1RLWA 4OUOA 2W60B 4WFFD 1P7QB 2IANE 1LE9B 3EDEA 4G43A 3ESNA 3HLAB 3PWPA 3L7FA 4E5XG 3C5ZA 4ACPA 4CMMA 4JCWA 2E9WA 3KYMB 3PHQB 5JYLA 3KJ4B 2C4FT 3WXWH 2Z31C 3IWUA 3DX3A 5G5DA 1E6OH 1XZ0A 3WAKA 4LLVB 5I6XB 1Q94A 3QEUB 4Y2DC 3ARBD 1FDLL 3IDNB 3BUTA 2WINB 3OLDA 5EO0B 2IGFL 4G3YH 4FFWD 5AAWA 1K4DB 5EZLA 2C1OA 5JA8B 4Z8FH 5IM7A 4P5TB 1T22B 1MAJA 2CPUA 3EAKA 5DHYA 5IVXF 5GIRA 2BVPA 2YO3A 4XVSL 1SFHA 4AGMA 1T80A 1SGKA 5DJ6B 4NQEA 5AD0B 1DVFB 1WAAA 3RZCD 2PPAA 3O3EA 1AKPA 2VDPL 3PWVA 1XT5A 4PFEA 1XX9C 1SJXA 2AV7A 4H8PA 4UDTB 5EU4B 1FVCA 4IDLA 3FRPG 3QJZA 4BGDA 4HXBL 2WQRA 1GOHA 3RVWC 3IFOA 1Q72H 5K59F 5EU5A 4ZXBC 4OZGE 3AXLB 3HBGA 2IJ0C 2F61A 4JHZA 3C2AH 3WTUA 3CGTA 1UWEL 4J27A 5SWQA 2QFRA 4I0PA 2FD6H 2GI7A 1J11A 4L29B 5D7KE 1KZQA 5HHNA 2XWBB 4QHMB 5IEKB 3VW3H 3VFMB 1XF2A 4RSYA 3H6AA 3I75A 1RIUL 2YK1L 1R5VA 1YA5A 1IGML 3K91A 5TJWK 1A4KA 3CUPA 2JELH 3INOA 3BMVA 3KAAA 3MFFA 3S36L 2GIXA 4YUEH 4LCWD 4NZUL 4A2MA 1XH0A 2QQLL 4LLUB 3OXRA 3NABL 2H3KA 2IFGA 3LNIA 5F7YC 2WZ0A 2XN2A 3OMZA 1IBGH 3WLBB 3WUWA 5C70A 3KH3A 2CNZA 1AC6A 4M1DH 1TITA 1P4IL 4AZUA 1VGEL 3C5JB 1V7MH 2OMBA 4HJEA 4M6ML 4HCFA 2F8XC 3BZFA 2XWTA 3UGUA 2P5ED 5DJAB 1JPSL 1FL3B 5C0EA 2CIIA 5GS3A 5KYXB 3TP4A 1SJMA 2QADC 3OAYK 5E5LA 3CBJB 4XH2A 2QQQA 3LV3A 2A6JA 1T2QL 3LXBA 5AL0A 1UG9A 4AG4H 1VGKA 1KBVA 4Y88A 4HV8B 4ZNEE 4PBWD 3R19A 1S9VA 3HAEB 2CK2A 5AOLA 3LDBB 3NCMA 1QO3B 4CVZA 3KZ8A 1J8HB 3WY3A 1Y0LB 2IH1B 4DUXA 3EJSA 1FE8L 2EDHA 4LLQB 5E8DL 3DSFH 2IPTL 4GSDL 5BS0B 4XP9H 4G8GB 1DUZB 5KVDE 1PIFA 1XEUA 2BSRA 4WV1C 1JP5A 2DLGA 3D05A 1RP9A 2JCCA 3BVNA 1MFMA 1Q1JL 2A9CA 2H2PC 2MNUA 7FABH 1PLBA 3OQRA 3SE8H 3SDAB 3R4RA 1BZ7A 4G6FD 4N9GB 1ZD6A 4NUJA 5D7LA 3FT3B 3V7MA 3SCMB 2YRLA 4XXCA 3GI9L 2HKFH 3VFGL 1D5IH 4FFZH 4Y5VA 4GKSA 5LBSA 5GJTL 4HYTB 1SLUA 3MBEC 5AKRA 3GXPA 2AQQA 4NC0B 4JDZB 5DYFA 2QPFA 2R1XA 2ADFH 3U6RB 4KU1A 1JWSB 3PE9A 2BNQB 1E4KA 2UYLA 5B39G 3UP1A 4NI3A 1BBJA 2VR4A 4Z3JA 4I9WE 3RVTC 4JGJA 3GMLB 1VSCA 4HQQL 2G30A 2BZDA 3HJEA 5HHVL 3X1FA 2APTA 5AUMB 2WNGA 1CFQB 5IEHB 2O5ZH 3KM2A 5AOZA 3QA3A 1HHJA 2CUMA 4DVRL 1BAGA 1BM3L 1XXFC 3Q8FA 2MCMA 1S7WB 4QRQB 2YOCA 3CK0H 2FUTA 1N9PA 2CLZA 1EHLL 1NGXB 5DMIH 2WLZA 3ARBB 3E6HA 3DA0A 1S3KL 2V9QA 1WYJA 2EYRA 1NPNA 2WIMA 2AFNA 1DVXA 1O9WA 2GITB 4OZIA 4G1EB 3O3UN 3FRUA 3V4UH 1PBYA 3LN5A 5BQ7A 5E2TL 2FEEL 3UJTL 4E68A 3MDJA 4CU6A 3KVDD 3RZCB 2ODHA 4A6YL 1VKXB 3OHXC 1GS8A 4PCKA 25C8H 1BLIA 2JKIS 3B2DC 4PJGA 4FYTA 2RACA 4JL2A 5ICZA 2EE6A 3ULSA 2X6CA 5AWNH 5CEZH 5I1DB 3N1GC 1HC1A 1BGXH 4GRLD 4N8UA 4N2AA 4EJ1C 1JZ4A 3VSVA 3RTLA 3BP5A 3GSXA 3HAEH 3CSTA 1UXWB 1PGRB 3OJMB 1F90L 5DRXA 1AS7A 3L4CA 2AKRB 3SYOA 4UIKL 4LHUG 1Y18A 1CVSC 3P3YA 2WBKA 1UURA 1M3JA 2A99A 3NACH 4OLYH 5IKCB 1R3LB 5IWLA 1I3UA 1E5UI 1V5JA 4KJQD 5DGRA 1CDUA 2NNCA 4N6QA 4KZCA 5ABZA 4ZI8A 3VQ2C 1JXFA 1C5CH 4NUGH 5FKAB 3U1QA 1MREL 3QIUD 3HC3L 2W80C 1J86A 2NR6C 3RB7A 5I1CL 4LCWB 4K3DL 5DYOA 3TBYB 2AK4A 2UVEA 3K8KA 2QHRH 4BZ1A 1KB5H 3UBFA 1A65A 3EJJX 1WBYA 1AHWC 3HE7C 1KT2B 4IIQA 3L17A 3H0TB 4JPWH 3CFQA 5DD5L 4OKDA 4R7DA 4JGUA 5IT2H 5E2WH 3BVVA 3TH2T 1QLFA 3AQYA 1Y1DA 4ERSH 5BUPA 1SDYA 3N85L 4TXVB 4AWJC 4X6CA 2Z3FA 5IROA 4WO0A 3LH8A 4D0CA 2VM3A 2GYSA 1EWHA 1U3HC 2H2SD 4YZWA 5EB9A 3NSJA 3RE0A 2P5EB 5C86A 1RVFL 4DO5A 1P5UC 2EIZA 5JMRA 3ZL4H 1MCIA 2YJLA 3WJJA 4X6EB 4AOFA 2V2TB 5EN2B 2G2PA 1UD8A 4OLXH 3LRSB 1DQML 2AI0H 3QXDB 5DJDB 3OG6B 5F9OH 1JGVL 5IIEB 5DLLA 4NKMA 4WCYL 2DEWX 3GXDA 2XKNB 5ESAA 2JKWA 5BV7B 3V0IA 3MV9E 5FO8A 4EXKA 4QY8A 3GJEB 3IGAB 3BAEH 1NCNA 5DTFB 2UWEF 2DY2A 1CBJA 5D5ME 3VI4F 4PJFE 2EDKA 3PF2A 4ZOBA 3RX9A 4BCXA 3OJVC 1RMFH 5CBEB 3RGVD 5J1AA 1QFOA 4YSOA 2Z8RA 5B22A 1J87A 2VMJA 4GSUA 1J5OH 2YUWA 4GQQA 3PP4L 4I87A 4G6FB 1ZMYA 1MCQA 1Y6NR 1S9WA 3ZDZE 4HIJA 1AE6H 4KZEH 2ARJA 2D31B 1S9XB 2R8SH 1WJ3A 4K3HA 3BDXA 2DKMA 3EUUA 1A6TA 4WDIA 3A23A 4WI0B 3U2JA 3WNMA 3KLKA 5T3XE 1UCTA 3DETD 1FA4A 4KVCL 1YJDL 4PJAE 4TL4A 2AP2A 5BVPL 2QV2A 3ZUNC 1FZMA 3F58H 1L9NA 3L9RB 2Z7ZA 5G4NA 2EKSB 3FFOA 4NKDA 3B34A 2B4CH 5KYWB 9PCYA 1B0RA 1A6WL 1MFCH 4CNIA 1XCQA 3LYRA 5BMFL 1M9WA 5FV2A 2WBJA 5H37A 5T1KA 1WUZA 4WFEE 1M6OB 2DJ4A 4U1MB 3FMGL 4FNTA 3V0EA 4KTYA 4Z7NE 2VWEC 1N0XL 3HI6L 3Q1SH 1T89C 2IALA 3CZSA 3P77B 1E8ZA 4CC0A 3AWEA 1D6VL 1UYWH 1KLGB 2H0FA 1D5MB 2VM9A 4JN2B 4B9CA 2ITDB 4WI6A 5EIIA 5J12C 1THAA 2CD0A 1IEBB 3KWWB 5JIPA 3PDGA 1LMIA 5HGGS 5CCKH 3QUZC 3ULUC 3RU8L 4F15C 3T6QC 3DRTB 1YN6B 5DD1H 4QO1B 3BT2H 2W9LA 3RI5F 5D96C 3LEXB 5DWPA 1F42A 2EDFA 2WXMA 1I7RB 3HKZA 1VFAB 2G75A 5FEBA 1F8TH 4UAHA 1IBYA 4M7JL 3QCTL 1VERA 2OSLA 1P7KA 1KV7A 1T5KA 4GO6B 5DVLA 1KGCE 3ECBB 1GOGA 4JFXA 1RLBA 3GXFA 5K93A 3T9WA 4ELKB 2OTUA 4IJ3B 4ODWB 1OP4A 2B5IB 4YDJA 3P0VH 5IHZA 2ADYA 1Q9WA 2P28B 2XT1B 1DE4B 2PP8A 1KCKA 3T4AB 4Z7VF 3B6SA 3K2UH 6TAAA 1AHKA 1I8MB 1P53A 3RX7A 5J3HD 5J11C 2EXWC 4TVPE 3QIUB 4I3RH 4KJWD 5D72H 2AQRA 2UVFA 1NQBA 4M7KL 4F27A 1HT6A 4TUKH 3FCSA 3NAAH 4KX7A 5AW9B 5JO5A 1K8DA 4RMBA 5C8JB 3KYOA 4G2AA 1E5AA 3N1FC 1DO6A 1QPPA 5LGHL 1UXLA 3EJQA 4WI9A 5KSBF 2RAMA 1R17A 2FGWL 2NY1D 1PU0A 2P1YA 3IN2A 4TNVK 3PCYA 2H1XA 2YBRA 4G5ZL 1L7TH 3DURA 1UA6H 4XCCL 1XGUA 3IDMB 4PJ8C 2FDBP 1Z5HA 2D4DA 3ARFD 5JW4N 1AQ8A 2HJLA 1MI5E 1R34A 4MCNA 4UOQA 2IDUA 1NJ9B 3EHBD 3O41A 1L7IH 3RJDA 4AL8L 4BKSC 1Q9LA 1HIMH 1KG0A 1M1SA 3TBSB 5BVJB 4E0RA 1XF5A 4MA7H 4BUQA 4UINH 1FYTE 4DW2H 1Q0EA 2FO4A 4XBGA 4I1PA 4UCFA 3QNZB 4XPGH 3QZBA 5AB1A 1QG3A 2ZUXA 1SMOA 4MMXB 4RX4A 2AQTA 2EDTA 4PJ5D 2C9AA 4JKNA 3WE6A 2HRHA 2EDRA 4FNSA 1SLWA 2OMUB 1K5WA 2IFFH 1Z3GH 3IMTA 1IEAB 3W1ZA 2VC2B 2XV3A 2BY2A 4OQTA 1MY5A 1OQOA 3RIAK 3WOVA 3MLRL 3RGVB 3B2VL 3QPQC 4KXBA 3PYCA 4YMPA 4GO8A 2XJLA 3LTVA 4A2FA 3PY9A 3GB7B 4HUVB 1BD2E 2D7NA 2DQEH 2OCJA 1P1ZB 4HIEB 2UUDK 3CHQA 1E9OB 2J3SA 4H7VA 1FQ9C 2UZYA 1F4HA 4XPHH 5I74B 3AQXA 1YNTA 1NANH 3U9UA 1KJ2L 2EO1A 2HN7B 3BUIA 1B90A 3OKEB 3L3OA 3HFML 4LSUL 4PJ7F 4EKXA 5IMKB 4E9YA 1KJ2A 2C9XA 4MD4B 3UZVA 4EVNA 1MLBA 3G08B 4PJBE 4GKNA 2XZQH 3APNA 1Y7VA 2HRPL 1CFNA 5CJOH 4F7EB 3PWPD 4PI2A 5DJYB 5E8PB 4NYLB 5KVEL 4R4FH 4YDVA 1I9JH 2VZTA 4TUUA 3S5LG 4D9LH 1LWRA 4FQXB 1F6AB 5HPMB 1P4LA 1X7QB 2PCPA 1ADQA 4P4RA 4TF4A 1K4CA 5EV7A 5FX3A 2SEBA 1TZOA 2I9LB 3TN0B 5I28A 1IUZA 5TH2A 3ILPB 4F7MB 1UWGH 4LP8A 4BFJA 3CFCL 3NGBB 3UTOA 1OP3K 1HZHH 4PJ9B 3CN0A 1DBBH 2OW7A 5EH1A 3V0VB 2VABA 4JFQB 1KEGL 2GBAA 2VLJA 4JFHD 5JOEA 2GBVA 4YHPB 1YAIA 2QSVA 4NQED 3BZ5A 2GSIA 1TNMA 1RJYA 1YPZB 3RIKA 5F93C 2VJ8A 2Y3AA 1G7PA 1YNKL 4LLWA 3WUZA 4IKIA 4Y8DC 3QG7L 4V1DE 5ISZD 1N5YH 2APXA 4ALAH 1YYCA 4N68A 1IBHA 1OSPH 5T5NG 3VXTA 3NK3A 4I9XA 1L3WA 1I1FA 2PXYC 3ARTA 4M4RB 4F5CE 1TQCB 4I0PD 1A1OA 4Q6KA 3ARQA 5KBKA 2FSDA 1NL0H 1ZIAA 5HVWA 2CO6B 5LN4A 3JV6B 5FB8B 2H8PB 4J3BA 3INUH 2FB4H 1NCUA 1XCTA 1ZRUA 5BXFB 3V0FA 4R3SA 3SKMA 1J0HA 1WCBB 2PYEE 5FPIA 3G5ZB 4Z7WB 2VC2H 4J8RB 2A9AA 1UZGA 3D09A 5E8EB 4DFIA 2ZYRA 4N8PA 4Q0XL 2CBTA 1FYHB 3KYKL 4PH8A 4K8RC 5HJGA 3HHSA 5EEWA 2IOMA 4JO4H 5AB9A 4RFNB 1MH5A 3K80A 3E8UL 5IGXH 5F7EL 2OJEB 3PWUA 2EDLA 1NOAA 1EJOL 4XAKE 3TO4A 4KKCC 1VEPA 5JOFA 3BISA 4JFDD 2NY1B 1RV6X 4MB1A 1I85C 1MRFH 1ZK9A 2ICEA 3G7TA 4QXGL 4TS6A 3C60C 2BSEA 4FQ2L 3WBDA 3BVTA 4E9QA 4S1DC 3HC4H 4K71C 1NFDB 3U4BH 4EQ2A 3X3GL 1RK1A 3VGEA 1D5XA 3ARFB 4FKKA 4WQOA 3ILQC 5CGBA 4JM2D 3MGAA 5HHXL 3EHBB 3GXIA 4M7LL 5T1MB 3ZIYA 5CXPA 3SOBL 5T1DH 1EEYB 4HIHA 1LO0L 1WS7A 4UM9A 5C2BL 1GZQB 1I1YA 3L16A 4Z7AA 2IDFA 4PJ5B 2VGLM 3I3DA 4LSVL 4V11A 1FRGH 4KKQA 4Z78B 3BH9B 1ONQA 3BO8B 3BEVB 5D2LE 3VRJB 3L3KA 5BPPA 5D7LD 2IADA 1T5XA 2G0KA 4ZMXA 4V2CB 2H6PA 1LEKB 4KQ4H 2XQYG 1UM4H 2Z6FA 3MRGB 1RUQH 5I1LA 3G5VB 2OZ4L 3B7RL 4HIPA 4TSAL 1BVOA 1PKQE 3FZUC 4S1SH 4PB0L 3NJLA 1MW1A 4NM8H 4JRXE 4QHKI 4P9ML 2OZ4A 2BVQB 5DJ2B 3UTSE 4NERA 1E8YA 1TVBB 2BVEA 4OTXL 4CSTA 1SVBA 1QD0A 2LOEA 4PYHA 4CMHC 5E5MA 3TJHC 2JSFA 2AXWA 1BQHB 3HZVA 5C92A 3SQOL 4P48A 4G43B 1F1GA 2IWFA 1J9RA 1WK0A 1KXQE 3VUAA 2H0EA 5AYUH 3HZMA 3OMNB 4KK8D 4HS3A 5EZPA 1IFHH 5I1JL 3F5WB 3WNKA 4YQXL 5AKSA 5B3SB 3UPRB 4YGVB 3D3VA 5DRWA 3KPLA 5G5DB 2AEIT 2JB6B 1JHTA 3PHOA 3FONB 4WLCA 1I3RB 4KJPC 3OZ9H 2NQCA 3L4XA 2PPCA 1UH3A 1S7RA 5KBDA 4XMWA 3QAQA 1RULL 4R90L 2VISA 4LRIC 5EZLB 4PJCE 5BRZD 5K9QG 1HHKB 4J1UB 4Y1SA 4NQQA 4ZW6A 2CJ3A 5IM7B 2JIXD 4ZW7A 3AG1B 2YD5A 3C87A 4NZRL 2BVPB 3HW7A 1INQB 1JL8A 1E9QB 2NOYA 3JWDL 3ME0A 1E6JH 1CYGA 1FVDB 3K1KC 3BUYA 4M1CD 1A3QA 4DESA 2WO2B 3V5DA 3PWVB 2N4IA 2FLMA 4AEHH 3RFZB 2AV7B 2ETWA 4PJDE 3ROOB 1EMTH 1ZKAA 4EQ3A 3ZRFC 5ISZB 1EXUA 3AU0A 4NO2A 2HJKA 1A22B 3IRZA 5EU5B 4C8XA 3O0RL 1XGTA 3FFDB 3NFNA 3NP3A 5SWQB 4WO4C 3BXNB 3W38A 1VAHA 3P4OA 3X12B 4LEBA 2I7OA 3S37H 2QSCL 4N5EC 3APDA 3R1GH 4PW9A 1D5BB 3D85A 4PP1C 3I75B 5TDOA 4U49A 1TYJA 4JN1H 5C0BE 4P2RE 4NRYA 5I9QB 3K0WA 3MFFB 2X42A 3JWNH 5KANI 3L1OL 3PWNB 4KKBD 5EDXA 3U25A 3MROA 2KPNA 3V6OE 1TO4A 4O58L 2AK4D 3ZRCC 5DDHA 3WUWB 1RSFA 5C0DB 4J6RL 3CQFA 3MNVB 4E5XA 4U6YB 2EDBA 2ZWKA 4OM0L 3NA9H 5FECA 5SV4A 2CK0L 3FAWA 4R7VA 3VFVB 4HCRH 3WY1A 4YLCA 4FI7A 3ETSA 1ID5I 3PGFL 5IROD 4JVWA 4HJGB 2YGQA 4YXKH 5C0AE 4JFDB 2VMDA 3G5YA 2CIIB 2AXJA 4FXGC 2J6EH 2FL5B 2NTFA 3UO1H 2Y6SC 1CURA 4FTVD 3MV7A 2B77A 3QS2A 3ASWA 2AW2A 1M2VA 3UXFA 3KJ4C 1QR1A 2XKSA 3L5XL 1BVLB 2ADIB 3PXHA 1S9VB 1RIHL 3C08H 3QO0A 4JM2B 5I6XC 4BKLA 4WUUE 4FHBD 5PCYA 4CVZB 5CINH 1S78C 2IWEA 5KSUA 5JXEC 1ESOA 1KCRH 1P5VA 4F7PA 4HKZA 3KW7A 4R0LA 4Z95H 1HZLA 4A2EA 3CN1A 5DFVD 2WMPA 5CU5A 5HHME 3CHOA 3LQMA 5LAPA 4PRPA 3DVGA 5C71A 4MA3B 3FRPA 3DX6A 4M7ZB 4M03A 2V2WA 3FF7A 4PTTB 1T6VN 2C5DC 2JCCB 2Q2EB 1B6UA 3BVNB 4XCYB 4YHIA 4GUQA 4MQSB 1NBYB 1DVFC 1INEH 2X9WA 5EUOA 3SJVE 3IMUA 1A4AA 3SKJL 2W38A 5BZXA 2VDNB 5D70H 4QTFA 4M43H 4NBYB 1EZUA 4HKXB 4IBTA 4JKKA 4YHML 1ACXA 3MRFA 3A24A 3ARDC 3CXHJ 3SSGA 2XWEA 1LILA 5L7XH 1JRHL 3TT3L 3DX8A 2JTDA 3V0DA 4LVOB 3WDHA 2DMBA 1JXGA 2N3JA 2XN9A 4OJCA 1KCSH 3ZE0B 4BHUA 2Y2WA 4GSXA 3O8XA 5A16B 5A7EA 1BZ8A 5L9DH 4UT7H 5I19L 2F8VA 2NDFA 3Q8AA 4NKQB 5DQ9A 2R1XB 5KBLA 1LQBC 4AC2A 2Q8BH 1HHIA 4NO0A 1NUFA 3QCUH 3LNGA 4YHKL 3RDJA 1D9KA 2Q86A 1BBJB 1CT8A 4KQ3L 4H25B 4D2NA 2FQEA 2WBJD 5T1KD 5A6MA 4JHAH 2H26A 1G1CA 4X50A 1VADA 5INDB 1V7NL 3QA3B 1OE1A 1GVIA 1MF2H 4N86A 2CE6A 5JXAH 1THCA 3KNBA 4M3HA 4NLHA 4NOFA 3MRMA 2Y06L 1J9QA 4OJYA 5B1KA 3E6HB 4CADB 1KENL 4CGUB 3E38A 5D7IA 1WV7T 1G84A 2BSTB 1W0WA 3MRDA 4YSQA 1NICA 2YRBA 4LMQI 1VFMA 2C9VA 1G0XA 5BRZB 4YBHA 4OZIB 3W0WA 4F1ZA 1IKFH 2JIXB 5BZDB 1KLFB 2IXQA 3BLBA 4XMZA 2WOBA 5BQ7B 2P5WE 3FT2A 3U0PB 1X9UA 3QQ3A 4R5XA 4ZW3A 3BVDB 4XMLH 5F1NB 2MQCA 4XVUC 2DMHA 4KO5A 2MPVA 3VG9C 1JGUL 3T1FB 3W9DB 2BY1A 3LDBC 3ULSB 4FZEH 3RY6A 3QUXA 3I6KA 1RQ5A 4NOBA 1ZGLP 3FBKA 3ECWA 1H8NA 1QR4A 4GJTB 1B9ZA 2TSBA 4HS8H 2D7PA 4PJAA 3SDXF 1E8XA 1I1AA 4TULH 4A7UA 2WPGA 3P69A 3OMIB 4HJSA 4ZX4A 5C2UB 2L7JA 3LZOA 1QSEA 3CXDL 3US1A 1A9VA 5DJ8A 4FQHB 3NEXA 2QZQA 3SEPA 5FW7A 3EJUA 2QMJA 3SDAC 1U4EA 4JKPH 5K33A 5IJVA 3OKMA 1U6AH 2CBPA 2EIKB 3QQXA 4HFUL 4KDTA 4PSPA 1YMHB 5F7KC 1AXTH 1N59B 2ERJC 4TOYH 5FYKE 5I1AB 3DX9A 5B39A 3U2IA 2AK4B 2X2IA 2JB5L 2BW4A 4LVEA 2VDNH 3ZT7A 1TO5A 2ORBL 2OYMA 1AD9B 5FAAA 2R69L 1JXJA 1XIWD 5B1CA 5FW6A 4EKJA 3WIIL 4E9XA 4X7CC 1FGNL 4KAQL 2PPEA 5LBSH 4DN4L 6CGTA 2HWZH 4G9FA 4D0CB 1I8LA 3NEOA 1AP2A 4F3FA 4NKIH 1FJ1A 3QPXL 1CK0H 5D2NB 3OPZH 4IRSC 2QLYA 3T3PF 3RWDB 2EIZB 3CZNA 3EYSL 5ITBH 1IZKA 3MKGA 2WYZA 3DO7A 1UEYA 2F7PA 4FTVB 5AVQB 2GC4C 4CDGC 2CKBL 4OI8A 3LEVL 3HC0A 2HX8A 5KSAA 1GZHA 2WTPA 4GRMA 3TBTA 3TO2A 4G71B 2H3NA 3CFTA 2HRLA 4TTDC 3B37A 3ARBC 2X2UA 12E8L 4R96A 1IC4L 2OMZB 4XNUH 1N6UA 3G3LA 3LQAC 4OFKA 4AGNA 2O5XL 4FFWC 4JZJA 1KBKA 3TYGH 2NMSA 4ZFOA 3VRLE 5K9OB 1LK2A 3FT9A 4YK4C 3BPOC 4KKPA 4Z3FA 4J3OF 2AABL 4HISA 1OF2A 2EUXA 5J1AB 3CFUA 4MNGE 3WIHH 3MODH 4FQIL 3WEMA 4ZMYA 1I82A 2MTAA 4JPVL 4LARH 4GG6F 4D8PA 4UBDD 3SY0B 1L9QA 1D3CA 2A5UA 4JDEA 2GT9B 2PR4L 5A2IH 2YPKA 3WDIA 4BSVA 2GY7B 3G5XA 5AW2B 4APQA 2XV0A 4FJ6A 4P06A 4PB9H 2VXSL 4HHWA 2Y22A 2X6BA 4YHNA 2ARJB 4ENZA 1S2EA 3GO1H 4P9HC 3DHMA 4JDVA 4WDIB 3X11A 5I0YA 2XVBA 2FR4A 1GGIL 5CEYB 3ZRSA 1AGBB 3VU1A 3ZDYB 2DYRB 3CQQA 4NRZA 5BZZA 2XA8L 2ICWB 1I7ZB 1FGVL 1KPUB 1GAFL 1SRDA 2AJXL 3FSZA 3LIZA 3QR0A 1JPST 3U4EB 4XP6L 4J3VA 1G7LA 1BG9A 1QEWB 1QSZA 1MNUH 5JW3H 5KAQF 1GHFH 1B0RB 2FX8H 1MI5A 1V3MA 4WY7L 3RI5K 4CNIB 2WBJB 5T1KB 1MLCA 5D8JL 4B60A 4FQCH 4W4OC 1IIIA 4DAGL 2J73A 1HI6A 8FABB 2YUXA 2VN5A 4KK6C 1GS7A 2IALB 1EPFA 3HLKA 3UG4A 3W11D 3HE6C 2V5RA 3X14B 5KVFH 3GBNL 1J5IA 4F2ME 3TBCA 4ADGA 4BZ1H 5EIIB 2AAAA 3OZLA 4DPAX 1E27A 4L3FA 2O6EA 3PREA 3TEYA 4M3JA 5FCUL 6PAZA 4Q9RH 4LP4A 3R4DA 4YLBA 3HNTL 2O5YL 3DO3A 4Q89A 1BD2A 1N4XH 5GGTL 4KRPC 1ASPA 3DGDA 2J7LA 2FWOB 4HIXL 4PLJC 4QT5A 5GGTA 4GAAA 3RGBA 3K8LA 5K9JH 1CXLA 5IUSA 2Q87A 3UROR 5BV7C 5EIVA 2IQ9H 1XWVA 4JFXB 1HXKA 1SYVB 4NQCE 4UAOC 3CIAA 2BY3A 4PJBA 2NY2D 4B53A 4XXWA 2FAUA 3THMH 2IAND 5HJDA 4APXA 4KVNH 4DGYH 1IE4A 1S8DA 2VIRA 1H3VA 2HT3D 2MOGA 4MJ6A 4YDJB 5SX5H 3PXLA 2XC8A 1JZIA 4FXKA 2VITB 1M4KA 4RFOH 1HXYA 1M7DA 3ZGHA 3CLWA 1EO7A 3IJYB 3SGDI 1ITCA 2HTLD 4N2HA 1OVZA 3RX5A 3US9A 1IGIH 2CO7A 2DQCL 2F7RA 2Y7NA 4KPHL 5JO5B 3QJVB 3MACH 1H0DA 4J23A 5DVNA 1PX4A 3MA9L 3GJFA 1XIWB 1LQSR 1WA2X 1MXDA 4M48L 5CJ5A 1MJUL 1AYRA 3FN3A 4PGDA 2DIBA 3FU6A 4QLRA 5B8CC 4JCLA 2F58L 4W9GC 4GMSL 2FSEA 3IB4A 1RUKL 3NPZB 3O9WC 5B1JC 3W5NA 1H6FA 2D7OA 2BSED 4RQQB 4XP5L 4ZUVA 3DURB 1DSFH 3K1DA 4L1HA 1RZ7H 4DEWA 1TOXA 1KXHA 3WYRA 4Q52A 2JKNA 4V1DA 2HJLB 2G3ZA 4A68A 2WUBL 2DTML 3RTQD 4HJ1A 3O41B 2XFXA 1OD7A 1ODUA 1W72A 2OMWA 2ZYSA 4BJLA 4BFBD 3ULVF 1XF5B 4QRAA 4UM9D 5H37H 5L2KE 2FO4B 2GKIA 4XBGB 2J8UA 5D7KD 1X5JA 1AO7E 2YD4A 5CIPA 1DJYA 3WE6B 5JHMA 3T8XA 5ILTL 1BF8A 1DLFL 1ZVSA 3C5SB 2Z8VC 1RPKA 5EZJA 4UUJB 3I3BA 1HH9A 3UZEA 3FCTA 4H2AA 3TNMB 2IDCA 1UB5B 2P7TB 1TZIA 3MV8A 5C09E 3O45A 4KV5E 2H9GA 2PYEA 2VLRA 5J9PB 4BK5C 4GMTL 3OAWA 3M1BB 4H1LG 4LDEB 5EU6E 1GPOL 3HUJA 4EDXB 4NX0A 2YUVA 4MJ5A 4WK4B 2AV1A 1RZJH 3U9UB 1QYGH 1U8OA 4ODBD 4JFFA 1PL3A 4KKZA 5CFAA 1U91A 1NUGA 4PUBL 2ADJA 4PJHF 1TQVA 1DQQA 1MFEL 4ABQA 2B2XH 1RK0A 2ESVE 3CX5J 4IJ3C 4N8CL 3UZVB 2B1AH 4EVNB 1UM5L 4P2OA 1ND0A 1KIUA 2PUQT 1CFNB 4UV7H 5KANG 4WK0B 4B3VA 2VMFA 2FE0A 1WZLA 3SDDA 1X5LA 2LLNA 2WSPA 4OCLC 1CZ8H 2AHIA 1P4BL 2BIQA 2WJ7A 4OKVA 3SKOB 2PCPB 3WJMB 3D3VD 4P4RB 2WXPA 3QIUC 5JHDB 2V7NB 3RFRA 4QRPB 2SEBB 5K1VA 5IQLA 5TH2B 2PYFA 4YSTA 2Y7LA 1OGAE 2GTWA 2YPVL 3AG2B 3VXSB 4JK0D 43CAB 1FBIL 4EUPG 2MHAA 3ZE2E 3WFEH 5FHAH 3PP3H 4JMNA 5KG9A 4YS4A 1W0VA 2DKUA 2OTPA 5AVRB 4O4YH 3NG5A 5J6HB 3P73A 3SBWC 3T4YB 3KGRA 4CRPA 3NP4A 4OFIA 5ANHA 5EEXA 3QRBA 4NHCL 4NIYE 4U33A 1BZDA 3CLFH 5HTSA 2GSIB 1HOCB 2DLFL 2QELA 5F0MB 5FYJL 1MHPL 3VDBA 4LL9A 4MNQA 4LLWB 4RGOH 4G8FB 1KIQA 3IKCB 2HKAA 3SGJC 3I02B 1CL7H 4R26L 4DKAA 5IFAL 1ZLWH 1WGOA 1BQRA 3MCG1 4K9EH 5DGQA 3FB6A 3UTSA 1FHNA 2UX7A 4MMYA 1AR1C 1Z9SA 1S7TA 1MHCA 2BNUA 5E1QA 3T3MB 4IBSA 4MMXC 2NY2B 3ZE1E 1F4XL 1OCZB 2IANB 3MO1B 1KULA 1OZUA 1J1OH 3M45A 3FBQA 3FQ2A 4I9WD 4PHZA 3FTSA 1JXKA 3GLDA 4XPTL 2DTSA 4KHXL 3QYCA 3QEGL 3SKMB 2PTVA 2MKLC 1Z66A 4OQTH 1KNOA 2J88L 3EJCA 4PGBA 3LN9A 1AQDB 4FG6D 2XRAH 1AMYA 4KKAD 5D1XC 3VD1A 4RZCB 2WZ6A 3S5LA 2B15A 5TDPB 2HX9A 4UNUA 4HG4K 4PJCA 2BC4A 2X12A 3PWUB 4MAYD 3QDME 1Z5LB 3UDWA 4B6ZA 1T1ZB 4PJXA 5JOFB 1KGYE 4XI5D 5IHHA 3FO0H 1N2RA 4DOHB 2A2QT 5TE4H 1YEEH 2ICEB 2Z35A 3LHPL 4NFBA 2CBOA 1E4WH 3EXLA 2X44D 3VXPA 4C56A 3NCEB 5C7XL 3MV7D 4FQXC 1IC5H 4X7FC 5DD0L 3M1OA 2PCXA 3T0EA 1MPAH 3BKJL 1RK1B 4HIIA 2EEBA 3MLWH 2WBXA 4Q6IC 2ZOOA 3OKLA 3DTUB 1SLXA 4OLVL 1QNIA 3RTQB 3TN0C 1ZA3B 4OZGB 4L37A 1EH9A 3B9EA 4AC4A 4MVBC 4QD2E 3HRPA 4UM9B 1ADQH 3NGBC 4H88H 4KXZH 5I30L 1XDTT 4PJ9C 1FFTB 1JJUA 5E2JA 3TYFA 3ZMNA 2DQJH 1FLRH 1X7SA 3KPOB 2C7FA 3E8VA 3IGLA 4XP1H 4WFGE 4N1CA 2L8AA 4LPYA 3IFLH 5C0BA 3LZFH 3P30L 2WBWB 4OFDA 4XWGL 3A6BL 4OIIH 3L3KB 3VRIA 1BF2A 4M4PA 4MS8C 4XBPA 2BVTA 3QARA 4IBZA 1T5XB 4ZTPH 2FVNA 3DJRA 3PJNA 3FL7A 2VZOA 1AGFB 2I26N 3EBHA 4OJFH 4ES8A 5KYYA 5I0XA 5E0FA 3O8XD 4XXDA 5ADPL 3BQUC 3DPDA 3IDUA 4M5YH 4GQPH 3JTTA 1FO0A 4H0HB 5IMOA 2WLYA 3CLEH 4LSTH 5DHEA 2A83A 4NO0D 1ZT1B 2MNJB 5C0AA 2L7EA 4KTDH 5E5MB 4EN3A 4FA8A 5T3ZL 4EZJA 4ZS6C 2G5RA 1IGFL 2B0SL 4XCFH 1SJHA 3N04A 4MRBA 2F1BA 3HZMB 5E4EC 3TC9A 4XWOC 3WSQH 3D3VB 3B9KD 3KPLB 5DRWB 1K6QL 4KJWC 4OZFB 1JHTB 2CIKA 2A7BA 3PHOB 2VDQB 4PRBA 1Z0NA 4AQ8C 1S7RB 1J1PH 4IRJC 2X53A 3QDJE 5F21B 4B9KC 2RBLA 5DRZB 4H0GA 1SHWA 1OPGL 4TQIA 3S96A 4QDGA 1WBXA 3DRQA 3N50A 5I5IA 3GSUA 2W5PA 1E40A 3EG9A 4PJIE 4YEFA 2ZT9C 4MCMA 3SD2A 1MIEH 3CH8A 2J1KA 4XNMA 2HZHA 3QIBA 1UEMA 2FHBA 5C7ZA 3RWJA 4KITB 1AGCA 4URKA 3CVDA 3V6ZB 3VFPA 1NCWH 3K72B 2VDML 4TVSa 1U8KA 2CO1A 3FT4A 4G7RB 4M6OH 1QAWA 2VXTH 2VMCA 2W9DL 4X4XB 3NFSH 5GS0C 3P4OB 4I7ZC 2XQYA 4LVHB 1RUML 2VQUA 1SXCA 4JLRB 4RESB 4N22A 5E6IA 2XA3A 1KWKA 5JDJA 3HNVH 3K5SA 2FX9L 3BW9A 2A77H 4UWQB 5TDOB 5E23A 4NRYB 4L1TA 1U58B 4L0YA 2Z9TA 4WFED 1TJIL 1VFOA 2OCCB 3UTPD 1MZZA 1OE3A 3KPTA 2ZQKA 1D6EB 1XR9B 3T5WA 3DVNA 4XR8C 1CD1B 4EDWL 4EIBA 5JHAA 3S88L 2JLLA 2DWSA 1MCDA 3RY5A 3T08A 1QEXA 2DD8H 4YHZH 5FECB 1J8RA 2GIMA 4X80H 1YEGL 4FFVD 5TDNA 5E9DE 3ZTNL 4MAYB 2WZAA 5IBTL 5I0DA 5IZ7A 1PS3A 3D33A 4QXUH 3VD4A 4JO2H 1IGJB 2BSSA 3ZO0A 3S34H 2LLGA 5FF6A 3LD8C 1HINL 5L0QB 5GZNC 1OARH 1G1OA 4HG4J 3ZZSA 3PABA 1E2ZA 1T03L 1M2VB 2A1WH 3D0VA 3HA0A 4MXVF 5KSAD 35C8H 2QPEB 3LVTA 3QO0B 2WWMC 4BKLB 1KGCD 2GCYA 4WHYG 1AFVH 3Q6GL 3ZVVA 5KSUB 2OLDA 2YD7A 1A1NA 3ESMA 3GKWH 4F7PB 4GRWE 3FDWA 1E90A 3LZNA 3E6FA 3BAXA 4OZFH 3WY2A 3OJDB 2BHZA 3SBQA 4G6MH 2DM7A 3O6KH 4FNLH 1A2YB 1S7SB 4RDBA 3DX6B 1G94A 1NBVL 2V2WB 1Z9LA 3H7BB 4YHIB 1PDKA 4MBOA 4ES9A 5KVDH 4TQEL 4LMQE 2R0WH 2NYYD 2YFNA 4TVPD 3ABKB 4ZMNA 4J3OC 1X4YA 4ONGL 1KCUL 4ZUTB 3T6ZA 4Y4HA 3N9GH 2VQ1B 4ZMLA 2CLRA 3ELAT 3AU1A 4LHUD 2QVMA 3HOGA 3TBVB 3DX8B 2GJ6E 5IHBA 3IFPA 43C9A 3O8XB 2I85A 4ZJ9A 5JPNC 2W65A 3QEHA 5CD5C 1OV8A 4OGXL 3MHZA 1KYOK 2CWRA 3BAKA 3HPJA 4GH7B 5EWIH 4J5VA 4YSEA 2Y07L 4TLSA 4LASH 3LHAA 4WNQA 4X4ZA 3D12B 1L9SA 5BUGA 2VWEE 3DMMA 3I6LE 4JO1H 4BFNA 2X2HA 4RLDA 4JG1H 1L9PA 1UD3A 2Q86B 1CT8B 1QTPA 2E47A 1KEMH 3FO1A 3OWEA 4O9HH 3U46B 5B7FA 3MOAH 1MI5D 2WZ5A 4N8VG 1PG7H 4OCRH 5EO9A 2VDKB 2RD0A 3NJXA 2Y1AA 3RAJH 4R97C 3OR7A 2VDLL 3B9KB 3FTUA 3ULUE 2QDWA 4WTQA 2NZ9D 3MLVH 5EF0A 1L5GA 4M7LT 3KNBB 1ZXKA 2X10A 4ZX5A 1PLCA 3TEZA 2X3CA 4FFYL 2EE9A 2ED6A 1L9OA 5FYKU 5J6SA 2BDNH 3QGVA 5D5MB 5DMKB 4XO4A 5HHPB 2VRQA 5FFOA 3GXTA 4K73A 3MRRB 4LSRL 3SODB 5LXGH 2FWSA 1NCCH 3UEZA 3V0JA 2X4SA 5TQ2L 3V8OA 1BD2D 4KY1L 3BUDA 2Y69B 4XBMA 3WEAA 3ZXAC 2Q3ZA 5F3HB 3QQ3B 3ZQ9A 4EZLA 4HD9A 3KCWA 3GXNA 1U8IA 5T5FH 3T04D 3V55A 2NY5C 4JM2C 1GC1H 3ZDZB 5T1LA 1WO2A 1CD0A 1R5WB 3MLZH 2ZXCA 2Q3XA 1E2VA 2ZUWA 4O00A 5DMGC 5E08L 1GH7A 1GRWA 3NCYP 2OYPA 1HAWA 4MDRA 4PJAB 1UJ3A 5GS1A 3TL5A 4ZMWA 1F4WL 1JSYA 4M7ZC 2CGRH 2DL9A 2DF3A 5A6LA 5JHLH 4NGHL 4MYWB 3GMNB 3RNKA 3MJWA 1ZXQA 5I75C 4KKLC 4PCSA 3RDTC 3Q2CA 5EU3A 3QAZB 4EEEA 3OKMB 2HLFC 3VGFA 5IJVB 3SYCA 3CMGA 3VXOB 4KMTL 2JVUA 4Z7OE 4Z7NB 2WLKA 3DX9B 3LCYA 1IJNA 2ED7A 3NQIA 1CFVL 2MJWA 2X28A 3UAJC 2BRRH 4GUPA 4L3AA 3V52L 4J4PC 2MEJB 1EAQA 4JZNA 4ORZC 1FC2D 3DPBB 4MZ2A