2JQAA

Solution structure of apo-dr1885 from deinococcus radiodurans
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
149
structure length
149
Chain Sequence
b'MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title A copper(I) protein possibly involved in the assembly of CuA center of bacterial cytochrome c oxidase
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Metal binding protein
total genus 19
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04314 PCuAC Copper chaperone PCu(A)C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1890 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2jqaA01
2JQAA 2K6WA 1X9LA 2K6ZA 3ZK0A 2K6YA 3ZJAA 2K70A
chains in the Genus database with same CATH superfamily
1Q8MA 2A74A 4NM8L 1LDPL 4NRZB 4QOKB 5AYUH 5H94A 3SDCC 3VXUE 6PCYA 1A4AA 1T20B 3TO4C 3ZT5A 1KCLA 2RBLA 2UY6A 4KKLD 4D9LH 3MBEA 3IK2A 2Y36L 1T89A 3BN3B 4JY6A 4HISA 1Y6MR 4WFHE 5TFSL 4ZJ9A 1WPCA 35C8H 1XGPA 3VFNA 3C6SA 4PJCB 1KTJA 4XPTH 4F3FB 4J3WA 1XF4B 3ARDB 8PAZA 1G1OA 5DK2A 2R29A 5AVUB 1FHNA 1ADQH 4OV5A 15C8H 2DM3A 1BCIA 4WIQA 2FT7A 2NXZB 3FQTA 1CQKA 1IM3B 3RZWA 1BZ9B 1XB3A 4N3UA 4PLNC 3LRKA 5HHOD 5L8KB 4KROD 4JFXB 4GIPD 2DQCL 4UNTA 1ZT1B 5EO0B 4GSQA 2VRKA 2BY2A 4L5FL 1JL8A 2VDQL 3QJHB 2WANA 4JFFD 1K4CB 4WI9A 2NW2A 4KVNL 5JPMA 2UXGA 1CF8L 1H15B 1FORH 3ARVA 3KPLB 3L3KA 3MYZA 2CM6A 2VUYA 2EDOA 5D1XC 5EU3A 1AFVL 1J9QA 3GI8L 3BW9A 1T2QH 1OWRM 5MERB 1DVUA 6TAAA 4BXVA 3OKLA 3QDGA 2E6JA 2FIRT 4D9QD 5AZUA 3UZQB 4U0RB 2VH5L 4DQAA 5T5FL 4O9HH 4TQHA 4FQPA 4HEME 1KIUB 4U1NA 4XPBL 4YDJB 1HQRA 3CSGA 3K0WA 3BUBA 5EBGA 1BG9A 2ZXAA 5L88L 3UG5A 4DO4A 1DZ0A 2AEIT 1K5NA 4GUCA 3JV0A 4Q56A 5I1CH 3IRCA 4K94H 3RILA 5BMFL 4OZHE 3NESA 4F1ZA 3DX2A 4A2FA 2YS4A 2JJSA 1NANH 1FNGB 1R3JA 3MFFA 1CD1A 3N9GH 2WIIB 3LIZA 4XT1C 1A4KB 1P7HL 4PS8A 5KYWB 3ECUA 4XN1A 4WTWA 3MNMA 5G5DA 2EXYD 5C0RL 2CXGA 3LQZB 3ILDA 1DDHB 1R34A 2YXFA 4APQD 4ZXBC 2DM7A 3IGFA 1OB0A 3N3EA 4YQXL 2QR0A 1P6FA 2RALA 3G6AA 5C0CA 5D96B 4KOBA 4DGIL 1QASA 1LE5B 1AKPA 1MJ8H 2PO6C 4PJ7E 1KCSL 4H26B 4OD1H 4KKQA 4GT0A 3VNZA 3OWRA 2WNKA 3RIFK 5HXMA 2P8PB 3ABGA 4WI5A 4LAJH 2Z8RA 3STLB 1QBAA 5I1AB 2MRYA 4OZIE 2AEPL 4PYHA 1G6VK 3HB3C 5DMKB 1F0LA 4D94A 2MKLC 4TLUA 1HI6A 4JQXC 4K9EH 4TUOB 4MDIA 2GY7B 4AYFB 1U8NA 2R0ZL 1U8MB 1EIBA 2XXCB 1B4JH 2VC2B 2FB4H 4XC3L 4M5SA 1SQ2N 3VXRB 1OSPL 1U91A 3MRLA 3U4BH 5AW6B 2P4AB 5C3IA 1FO0A 2LHAA 3OLIA 5LXGL 1C8PA 3E6FB 2FQDA 5HGGS 4XI5C 3RAJL 2WHVA 4LRNL 1HZHL 3EOAB 3LD8B 2BSSA 4LOEA 3VGEA 3EGDA 1FFQA 4GIOA 3GIVB 4Q74A 2EIMB 1GIGL 2C1OB 4XH2A 4PV1C 4X8GA 5MENB 3SQOL 1BFTA 4EI5A 3DVIA 3MRBA 4X5RA 3TWCH 5JR1L 3T8XB 2NY1C 1F4XL 2I07B 2QGDA 2ADGA 3D34A 4GMTL 5T33H 1MFUA 4UT9H 1I31A 2DQIH 3C6LA 3BAYA 3OR6A 3ASOB 5B1KA 3HKZA 1MVFA 4PIBA 5AW1B 2JI2A 3WTUA 1R5WB 1DQDL 4ZMWA 2FSEB 2OQJB 3HN3A 4S2SB 5D71H 4PVMA 3A67L 4PWGA 4UTBH 3L3HA 1UXSB 4I7ZC 4FHJA 4OLVL 1II4E 5HHQB 1JF5A 1KB5H 4YDVA 5JIPA 5DD0H 2FWSA 4URKA 2BJML 2WZPA 5AQ0A 4JPWL 3LH8A 4NRXB 3WEXB 1P84J 5FUOL 5GGUA 3IVKB 3WEOA 1G84A 4AEIH 1VFBA 5B8CB 3PHOA 2V7HA 3QC5X 3X3GH 2CKBB 2NNAA 3AAZB 4LLMB 4RNRB 1CLYL 1TOXA 1MHHB 1TPXC 1VGEH 3DBSA 4AXWA 5JQ6L 3I2CL 2OBGA 3LSOB 4OU3A 1B3IA 1BVOA 3IU3A 3SJVD 4UZGA 4H8VA 3MLWH 1F86A 4HGMA 4PJ9C 3VFPB 4X8JA 4N2AA 5IGXH 4UM9D 4PJ6A 3OZKA 3ULVF 2H41A 3BAKA 4BHUI 1QWNA 4N20A 3RI5K 4JO1H 1IV8A 4AE0A 1DSYA 1AOHA 1UYWH 3KPSA 5E2WL 3VA6A 4NPYA 5IB5B 1YNTA 3CHRA 1V3MA 3NSDA 2APTA 5AKSA 4UAOC 4X5QA 4X7TA 2BC4B 4C8XA 4BK8A 4QAWA 4Y5VC 4JFQA 3T2PA 1C1EL 4N24A 3X1BA 4KKAC 2ITDB 2NYYD 3LS4L 4W68A 5HD8C 3OSKA 1RUAL 5IOKA 4L8BB 1J1PH 2QTEA 3SE3C 1F8TL 5JHLL 1X7SA 1HKLH 1DQMH 3DO7A 1UWEH 1B2WH 1UWGH 1DBKH 1IB5A 2B1OA 2YGOA 5HGDB 2YC1A 4BQBA 1JPFA 3PL6D 3QIBB 4F5CE 4KKZA 4YH6A 3AXLA 1TQCC 4FNLL 4GINA 4Y2OA 4XAWL 3IGAA 2Y9RT 3N40F 4PJ5B 1F58L 3V6ZB 1MH5A 3KNBB 3CN2A 3TX4A 2YOCA 2XWJB 2DKUA 4P59L 3L9RB 3NIDF 4P2QA 4KK8D 3QUYB 1S9YA 5EUKA 4N5ED 4XGZA 3D39B 3FT4B 3KCPB 2FLRT 1Z5LA 1I3GL 1QTPA 3SYCA 1QW9A 4OFDA 4DUVA 4NUMA 2NXYD 1FZKA 2XT1B 5J5EA 3HUJB 5CD5C 2CR6A 3RL2A 3S9DB 2H3NA 1EMTL 2E9IA 5T5FA 4XMKH 3NEEA 1VACB 1VAHA 1CIUA 4DKDC 4RMQA 5GZOA 2FECI 4IKIA 2XOTA 5IY5B 1G94A 1ZA3B 2GSMB 2PYFB 4YFDB 1MCIA 3V4VB 4GO9A 2JIXA 2ZG2A 3DSNB 3PNWB 3MLPA 5C9JA 4YAQB 4C4KT 5EMYA 3GS4A 1C8QA 2E6QA 1VDGA 3K2KA 4HJIA 1U95A 3SKNA 3LEYL 4YHOL 5IJKA 3CSYB 3KPRE 1TZGH 2VZUA 4Z3HA 2IVFC 1U8HB 3WXWL 4DESA 1G0XA 3DIDA 1RJZA 5ANMA 1N68A 2GK0B 3BPLC 3HS9A 3NRFA 2HRLA 2LE9A 4JLRB 5IBLD 5MP6H 4FEMA 3WJMB 4IGBA 3NSFA 1EO7A 1M9WA 3EYFA 3GSUB 1FCGA 1YEDA 5F6IB 4J8RA 3SOBL 2DDQL 4RGOL 4Y16D 5CEZE 1RZJL 1GPOH 1VEPA 1QUNB 1OD9A 4OGAD 2R0WL 1U3HC 1FBIL 2BIOA 4N8CL 1SXCA 3HPJB 4S0HA 2OMZB 3QNYB 4KX9A 4L23A 4GKSA 2WBJD 5ITFB 3SQBB 2I9TA 3GXPA 2JKNA 1I8IB 5K59F 3OPUA 3ECQA 4FJZA 5MHSE 2MOQA 3P0GB 4JCLA 3KPNA 4X0NA 4ZPTA 1ITCA 4QHUB 1TR7A 5I8KL 3U0WL 5E4AA 3HVNA 3NJKA 4WFEE 2Q20A 1YYML 2GI7A 3GHBH 1HHGB 3PGDB 1S3KL 1C12B 4JBSA 5DUML 3W0WA 3QCUH 4FYTA 1G7PB 1PFCA 5IVXB 1TUPA 3D3VA 3HN8A 4PCSA 3RP1A 3K0YA 3MPCA 4BD4A 2LU3A 1NGPL 1MI5A 1DL7L 2O4EA 3G04B 5GJTH 3KYOB 3VSVA 3CBKB 2EILB 4BK4A 3S3SA 3E3QC 4QIRA 2DQGL 2AJVL 3QJXA 3ZIYA 2DPKA 1ZSDA 1NCBH 2F7QA 3G6JF 3BSGA 1TZAA 4BH7A 4EIUA 3LOWA 4NAMA 1EZUA 1OGTA 1CWVA 5DLML 4F7TA 5K9QG 1HHIB 1MUJB 1TEYA 4GAGL 4HLEA 3WY1A 1FVDA 2DYSB 1V10A 5HGAB 4Y9BA 1AOZA 3JV4A 5A2JH 5DYFA 3QQ3A 3T0WA 2ZXGA 2RJMA 1A3ZA 3FTXA 1A3LH 3QT2A 4YHZH 1F1AA 4BZ2L 1T03L 3O6FD 2C3VB 5DF0A 2IANB 1JYNA 1AZVA 3SPVA 3SY0B 3JTSB 3ET9F 4J3OF 3KHOA 2K4AA 1WAAA 4PTUB 3UCRA 1MFVA 5KSUB 3GXIA 2WK2A 3PWJB 4JM2C 5I16A 1PS3A 5CXPA 4DEUA 1KG0A 3MRGB 3HC0A 1H9DA 2Y3AA 4K3JL 3ULUE 5DJXA 4MTMA 1SXZA 3T8VA 4M7JH 1VFAA 1R5IA 2NZ1A 3C5ZD 3JBG7 4GXVL 1MN4A 1UH2A 5LGKA 2BVOA 3MHZA 2MCMA 5BVPH 2WMPA 5J9PB 3S4SA 4O5LH 2A6IA 2XA3A 3I02B 1KSRA 3RGVC 4WI0A 3TN0C 1YY8B 4DPBX 5GSRA 3TZVB 1AMXA 3WUWG 1IARB 1UM5H 4KKBC 1MJUL 1J5HA 4P5TD 5HHMB 5EDXA 3MLUL 1DSWA 2ZX7A 4M7ZC 2IC2A 3UBXI 4B9GA 4AL8C 4YX2H 1MCKA 3QZBA 3I9IA 1IJ9A 4DP5X 1J88A 3GEWB 3KWTA 5KSAD 3MUZ1 5BW7A 2ZOWA 1G7JB 3EJJX 4RFOH 2E7LC 2VZVA 1O5PA 1TKWA 2F8OA 3I6GB 4Y4HC 4Z7VF 5CFHA 1NL0H 2E74C 2D2CC 2KHAA 1E2VA 1RK1A 1SDYA 4MQXD 3OZ9H 3C5SB 4BSJA 2CDEA 2C5DC 5KVEL 1WWWX 4JUTA 3PQYE 3QFJA 1T5WA 1WZAA 2XZAL 5EOCL 3JV6A 3IBEA 3DX6B 4HDIA 4U6XB 1ZMYA 2CO7A 3FNKA 1V8HA 3L3GA 1M7DB 3IS1X 1IE4A 2JKTM 3UMTA 3TWYA 2CO6A 2P52A 4XP6H 1MHPL 1EERB 2IOIA 3NZHH 4IJ3C 1SNRA 5DHXB 2Q7YA 2HLAB 3EYVA 5IK3B 4S1SL 4UDTB 5JHLA 2V5MA 4XTRC 1V7ML 4PRHB 3WFCH 3RKDD 2XSKA 4AQ1C 5IBUB 3WNMA 4WJ5B 1BQKA 2Z7ZA 2DLHA 3OAUL 4PJCF 1KTDA 5ALBH 3CLWA 2WM0A 4TSBH 2X0UA 5EN2A 1I9JH 2DQMA 3MJ8A 3DRQA 5T1MA 3RURA 43C9B 2YD3A 1J0YA 2VR4A 5D1XA 2J55A 4OCSL 1KCWA 1LE9A 5FGCB 4JG1H 5CU5A 2G4EA 1K9TA 3NZ8B 4GAYA 1TQBC 3BN9C 1L7TH 3ZTJH 3ZIMA 3K5SA 4F57L 5I28A 2HAZA 4GI9A 4YSDA 2HTLC 2HVKB 4NGHL 3FT2A 4HUUB 4KZDH 3I6KA 1OTSC 3QI9A 1S7SB 3BX7C 2CNZA 4ZDHB 2BNQA 2OJZH 3FB8A 4JQIL 4JAMB 4JO3H 3W2DH 4J39A 4QO1A 4KK6C 5EUOB 1AHWA 1QLEB 5GS2D 1QWUA 2B5IC 1QABA 2IIJA 4LHUB 2YWZA 5JTWA 3QEHA 1NFIB 3V4PL 1NEZA 1HXYA 4KI5C 4P57B 2K8QA 4B0MM 2R0LL 1HHKA 4XPFH 5D1ZC 1HCZA 2IADB 2MTPA 3L8QA 4W6YB 4W9HC 2VLKE 3QA3A 5A6MA 1IX2A 3GQFA 3BH8A 2JKXA 3L4YA 4K3EH 2BY1A 2HPTA 2EEAA 3VXUB 4OLEA 4OTXL 3B9KC 1CIDA 1KB9K 1PBYA 3VI3A 1JTTA 3FYEB 3UCQA 3RIKA 5JYMA 2N7SA 3R8QA 1AGFA 2R23A 3QNFA 4X6EB 2AK4A 2B9AA 3WIIH 5I73C 1PW3A 4HIHB 4R7NA 2PO6A 1RUQL 4QRSA 2ICEB 3UX9B 1TTFA 2AZAA 2VERN 1MEXH 5GRVL 4FQHB 4GRWE 1MWAL 1T3FB 3B37A 5CD3A 4U3CA 4E68A 5HGBB 2VZTA 5IMKA 4DEWA 4K5MA 4L3CA 5EZPA 5EIIA 5IUSA 3EKCA 3K4ZA 3MRKA 2DJMA 3VXTB 5DC0A 2Y06H 4GJTB 1UQSB 5A2FA 2QADC 3PXJA 4NZ8A 5DSCB 5T8IA 1CDHA 4JQXA 5F9JB 5CCHE 1S5HB 2VN4A 5CEYA 1ZANH 2ZXEB 1FZOB 5ISZE 1KYAA 1NH6A 3Q6GL 1JIBA 3MV7E 1T5KA 4D0BB 3CFDA 4E9XA 4M8VA 2AK1H 4XCFH 5I76A 2EE9A 5FO7A 2M26A 3PE9A 4XCCL 4YUEL 3BPOC 3IN0A 1Y1UA 4L9LB 3FQWA 3JVGA 5D2NE 2GIMA 2YUVA 3MUHL 1T4KB 2IH3A 1WBYA 5DDHB 1H6TA 5C7ZA 5IBTH 1BXUA 2C1PB 2ZOTA 2A9DA 1U2HA 3QNXA 4FXGB 2WXKA 1HVXA 1P5UB 3D4ZA 5BUAA 2XVLA 2I24N 1OCWH 1WSST 5E95B 5AG8A 3OHMB 3O3BB 1XGQA 2WO3B 3KR3H 4Y7OC 5DEGB 3RGHA 3UPAA 4CC4C 1YPZE 2IFFH 3SZKC 4KUZL 2X4SA 1BVKA 3DVNB 5DD1L 1PQZA 2BSTB 2JK5B 2AKRB 4E36A 2FBJH 3H7BB 4BZ2A 1E2WA 4NQXB 2GBVA 5IB1A 4IRSD 5K9QI 1YNLH 4OZHB 3BP4A 3PPSA 2X3BA 2NY0C 1HIML 4K94C 1NANI 3WD5L 2JLLA 3HG1E 3OV6A 4MJ4A 4XWGH 1EV2E 3SBPA 4YDLB 4ZFGL 3CZSA 3EZ8A 5B3SB 1U2CA 4G7VH 5CLTA 3X12A 5IB2B 4KVCH 1KNOB 3A6BL 4P4KB 4JGMA 5JHDA 4YIQB 4GP8B 5DD5H 4HG4J 1IM9A 1WGOA 4ZMPA 3AQYA 4Y4FB 2GJ6D 2NY3C 1OB1A 4KWUA 2NSQA 1E8ZA 4I1RA 2J12B 4LPWA 5SX5K 3BPNB 5EFIB 3V0WH 4PJ8C 3HE7A 2BFGA 2QELA 3FU7A 4LCYB 1GH7A 1JN6B 5IT2L 1H3VA 1EFXD 3NQKA 2DWDB 1ZLSL 2A73B 1QBMH 2ERJC 4JM4L 1K2DB 5T1KA 4PGDB 4OZIB 1FN4A 3APNA 2FTAA 5D1QE 5DFTA 4BFGA 4PRID 4QTIH 2AQTA 2Q86B 3DMMB 4XNZC 3VM5A 4ZT1A 5FO9A 3OF6D 2ICWA 4HJSA 2JKIS 3RWIA 4K9EC 4X6DE 5DC4B 5J6SA 3TNNB 1G9MC 1QSFA 4DKEL 3FHEA 2AS5M 5DT1H 2AEQL 4F7MB 3OKEA 2KPNA 4K23L 5DK0A 4AX3A 2CIIA 5I1IH 5CN2A 2LVCA 1Q90A 1X5KA 2IV9A 3RKPA 2EIJB 1LO4H 4WO0A 5FA4A 3SE3A 2XFXB 4H4NA 2ARWA 4NKIH 3SPIA 4GLRI 5D6DA 3FQNB 4RLDA 5AEAA 4UU9B 2E9BA 2X89D 3AXIA 4J1UA 5TK2A 1PNDA 3S37H 1EEZB 3Q44A 5CZRA 3PWPE 5FM8A 1NOLA 4OLUH 5I8CA 1E4WL 2X10A 1F02I 1E9QA 1TQTA 4HSQA 4UV7L 4V11A 3U6XS 2FEEL 3CZFA 1MHCA 2ZTBA 5H4YA 1O7DC 1H5BB 1QBLL 2XHNA 2ZCLL 5AD0B 1IGTB 4ODHL 3RWFB 1N6UA 3KE0A 2KQMA 1UURA 3I75A 5F7DA 6CGTA 3J2PA 4X50A 2J1ZA 2X2HA 1O6VA 5I66A 3CVHB 1NCAH 3OHXA 3V52H 2F7IA 2CRYA 1U2YA 2VDNB 2HFEA 2KERA 3LN5A 4HP5A 4B97A 2Z1PA 5DUPL 3H9SE 2W0LA 4JANA 1A3RH 5CILL 1DLFH 1Z5YD 1T7YA 3H0TB 4JQIA 1WITA 4MNQE 1M1SA 4OKDA 3MJ7A 2OR7A 2AMGA 3ISYA 5KYUB 1KDJA 2EUWA 1A2YB 3QXUA 4RZCB 3SSGA 4KTGA 3S6CA 3TNMB 4FLHA 3CWGA 3FSAA 4HS3A 3AQZA 3HUJF 3NGBC 4WFFD 1L6XA 3TH4T 3V4PA 3CX5K 3GTTA 3DPDA 4NHCL 4P07A 5DZLA 2ZUQC 3P9MA 1AQKH 3QRBA 4C47A 5E94B 3IT8D 4HOMA 2HX7A 4I4WA 1FVEA 1WG3A 5AYUL 1UHVA 2A6KB 3S8FB 4JB9L 4I0PC 4PJEA 1OOAA 2GHZA 4QY8A 3QHFH 1A47A 1MRFL 2BW4A 4NENB 4BDVB 1TTAA 1BFOB 4F15B 1U3HA 3NIGE 2APXA 3ZTNL 5I2IA 1CQYA 5K9JH 3FU5A 2F58L 4LSQH 1DHKA 3O6MH 2IBZY 3A4FA 4CSZA 2XPGA 3UO1L 3VGAB 1MWAA 3CFBB 5I6MA 4MKTA 15C8L 5FHBL 1YEGH 4PVLA 5I0ZA 2XG4A 4PEEA 3FOMA 1HTYA 2XRAH 5TDOA 1OPGL 2BMKB 1N2RB 3TT3H 2QGBA 2OMYA 2Z4QA 3GDBA 1XGYL 5IVNA 2VRQA 3OX8A 1NSNH 3QIUD 3D8MA 1QZNA 3B7YA 4F58L 5HHPB 2WUBH 2NXZD 4XBEH 1XF2B 3BH9B 5A43C 1P7KB 3DURA 2HG0A 3WIFA 3FFCB 1XMWA 3FMGH 4R6UA 1OARH 3RVTD 3GBEA 4K5PA 4NN5C 3CMOL 4X99B 2RMNA 5IQ9A 1FL6B 2XI9A 3TF7C 4U6HB 2G3ZA 5GGTL 5IVXF 3VQ2C 4F2MA 4QNPF 5CUSL 2AW2A 2WJ5A 2R51A 5EEVA 4PJGE 4KUCF 4D9RE 1FNSH 5J11C 3KXFE 4U1SA 3ETSA 2VDOB 4FQJH 3P2TA 3MXVL 5C71A 3V0AC 2PTTA 1IGCH 1IFHL 1MF2H 4PTTB 1I1FA 5FCUH 3BZEB 1AE6H 4K94L 1YECH 1PKOA 1I53A 1E5AA 4JM2A 3UTPE 4YSCA 1HILA 3TA3A 5AW7B 3KPRB 4ZS7H 3MUGB 3QFDB 4ZNCD 2CIKB 3S3PA 3ZYIA 4N28A 3GMPA 4I3RH 5IV2B 3O3EA 4LP8A 4CGTA 4OI9A 3MDJA 3U9UA 3GLAA 4L8CA 5JXEC 4BK5A 2VR9A 1N3NB 3VXOB 3KPTA 2V5RA 1FV1A 1CFSB 1R3LA 1HS6A 1UTDA 3RPIA 3QORB 1GAFL 3ZYOA 4LHJB 2GVYA 5KSBA 4G11A 4N2HA 2V3EA 3TBWA 2ZXDA 4OF8A 1JV2A 3WIAA 3CQQA 2AJUH 4P2OC 5BS0D 5DRXB 4DK3A 5IESH 1EBAA 4OD1L 1JGEA 1KGIA 1WYJA 2VSDA 3OGOE 3F7YB 3ISWA 4G8GA 3LZQA 4GBXC 1RULL 1FG2A 4B9KC 5I1LA 4WK4B 2NY5L 4KX8A 4PVNA 4TUJA 3QZLA 5HY9B 4AKQA 1ZT7B 4WGKA 3MNVB 3LZRA 3RWJB 5GPRA 3N1MC 4QRTB 4HJEA 1G9ML 3CDFA 3CHXA 3QDGE 5AVXB 3KYMB 5I8EA 3VQMA 1SJEB 2KYIA 4I1PA 2N01B 4RWHA 1LEIB 5C0NC 1EJ6A 3GHEL 4L2YA 3QUZB 4GS7C 3S36L 3GMNB 4MXWL 5I6OA 1C16A 1AI1H 1B6UA 1JGUL 4KDTC 4NZRL 4R26H 2H2PD 4DVRH 4CN6A 1A9VA 1HL4A 1KCRH 1PZDA 1A6PA 2EYSA 2YQBA 5H37H 4DGWC 2ORBH 4H2AA 4IBVA 1T21A 4TVPE 2D7OA 1WS8A 3GKZA 2A3TA 4FI7A 5IQLA 3KYNB 1BPVA 5HDLA 3K1KC 2DV6A 2OTUA 4AIZB 1E4XH 1SEBA 2GC7C 2HTKD 2O5ZL 4U6TA 3U0TB 2JKLA 3IJEA 5MEND 5BVJA 2EO1A 1UZGA 5CZKA 1JYWA 2IALA 5KSVB 3BUYB 5EBMA 3F7KA 3QIWA 5DZOA 4IS6B 1E9PA 3NIFB 4UTBL 3PIQB 5C0CE 2YPVL 2GK2A 3DV6B 4G8FA 1CFQA 3F58H 1BX2A 1J0KA 2GITA 5DD0L 1PG7H 4KKCC 4YSTA 3ZMNA 3IFPA 1WD9A 4PP2B 4LEOA 1J87A 1ND0B 3IFOB 4AEIL 3KPMB 1ZD6A 1GOFA 1S7RA 4GG6A 1A1MB 2QVKA 1OGPA 3BEWA 3GSXB 4ABVA 3S4SG 3RL1A 1NPNA 1UH4A 3PP4H 3KDMB 4M9PA 3C09C 2GEQA 3O81A 4H2CA 3L95B 4IOSD 5FYJL 4CVWA 1R3IH 5D1ZA 4UMSA 3ZHKA 2WYZA 1E7VA 4FLQA 4LCCC 4QXTA 1DBBL 4JFYA 1I8LC 2YBRA 4I87A 4QYOB 4Y9EA 1ZK9A 4CVUA 5EUOF 3BUTA 3LMJH 1JI2A 3ZKMC 4MA1B 1EBPA 1XQ4A 1BBDH 1KJ3L 3BSZA 3UTSA 2A5UA 2OP4L 3ZX1A 4K7FA 4YWGH 5IW6A 3VDBA 3U6RA 3PQYB 2YAMA 4QRRA 1UYWL 3HIZA 5DS2A 5DJAA 5ALCL 4R9HA 1INEL 1KXTA 5DJDA 1KBGL 2XG5B 4WY7H 3TVMB 5JNYA 5GRJH 2I32A 1GS7A 2W65A 3NCXA 2YAOA 1OAZL 2CGYA 3W37A 4PS4H 2NY7H 4KXDA 3SYQA 5BRZB 2VXQL 2H0JA 4G5AA 3QEQE 4I1NB 4PS7A 4G6JH 3ZL4H 3B3IA 1XVSA 2XA8H 4WUUB 4N1EA 2RAMA 4KK5D 1KJ2H 5ID1A 3PFUA 5IFHH 1U8JB 4BM7A 3FH5A 2Y1ZA 3E80A 4PJ5D 1NDGA 3NCYS 1MSPA 1F00I 1JVLA 1Y6KR 1L7IH 1DQLL 2O72A 3HZKB 3O6KH 4NC2B 4ALAL 1DBAH 2VDPB 5GGTA 2ISDA 3QUYD 1H0DB 4UIKH 1TJHL 4NNXA 4OCYH 3D39D 4FNRA 2XTLA 1T1XA 2DWSA 4XMKL 5A1AA 1QO3A 1OQOA 2WQWA 2ZJSH 3ETBF 3LKQA 4K3DL 1XCQA 2J5WA 3QYMA 1SF3A 4XCEB 4H20H 1MDAA 2XQ0A 1MFBH 3CBRA 4NNYA 3V8OA 1NFAA 1LQSR 4GAFB 5HPMB 3QP3A 4M43L 3MO1A 3U4AA 1U6AH 4DGVL 5E4EC 1MIMH 4ZUTA 5GS0H 2WVUA 2EDHA 4JE0A 4TQ8A 4RMBA 5J6HA 3RLSA 3KPSE 1NEZG 2VLKB 3QEGL 4HT1H 4LKCA 4JFEA 5C09D 1IAOA 2WGNB 3PWUB 1T1ZA 2H7WA 1IEHA 1X4YA 3O9WC 4WEMB 5I15L 4IU3B 1KN4L 1YN6A 2DL9A 1B88A 2WQ8A 3BWSA 3DO3A 5D7LA 1CF1A 3QZPA 1A6UL 4FFWD 3QULB 1RCYA 1I7ZB 4ZX4A 4XN5A 4X9HA 2K9FB 4MA7L 3P30H 5C2BH 2JF1A 5F9WC 1LXMA 3ULAB 4OZHF 4UF7C 4Z5RA 2PPEA 4XBGB 3KS0H 1ET5A 2HJLA 3MX0A 1J12A 1X5LA 2UUDH 1CICB 2V17L 1U33A 5E6IB 4BWUA 1UJ3C 3P69A 4Y2DA 4H0GA 3THMH 1BM3H 1DJSA 4L5FE 4JS7A 2BVQA 25C8L 4P2QE 1P5VA 5EIIG 3GHBL 4RIRA 4JPSA 4LB8A 1JZ2A 2G2RA 5MI0C 5CP3H 4HX1A 3UADA 3CUPB 3WN5C 3PF2A 5LWYL 5ISZB 4HAGA 2EDEA 5GJTL 1HYRC 3MV7B 3BJLA 5FW8A 4NEHB 4PI0A 1NLDL 2ZCHL 4R7VA 3U4KA 4HWUA 4ZTPH 5KYNA 4AQ8A 1IC5L 2ZUXA 5D2NB 3MCG1 4OZIF 2CGRL 4R2GB 5I19H 1QSEA 3OWEA 4ODVH 3GK8L 4KUCD 4Z7WB 4ODUA 4F8PA 4P23C 1ZHNA 3GUTA 3HE6D 1G0DA 1ZHKB 1EZVY 3P4OB 2J73A 3WMSA 4F9PA 3V6FB 3TH2T 1YPZB 3GD1C 3KPPA 3NCMA 3EOTL 3GMLB 5ANME 4CMMA 3QWOA 5F9OL 2V3FA 3NJJA 3MFGB 1N0XH 1Y6NR 1WFTA 4NFCA 4NT6A 4Z0BH 5KJ4A 3II3A 2FO4B 1KCKA 3PV6A 5ICXA 3L9YA 3HG1B 3MCLH 2QPUA 1NKRA 1BF8A 2AEWA 3DTXA 2DQTH 2VQ4A 1ZAGA 1A1NB 1JPGA 3MMEA 1Q1JL 4NUJA 1ONQB 2ZYIA 4S0TD 1FH5L 3QE5A 1S7QA 3AM8C 4WWOA 3MLVL 1IBBA 2D3VA 4MNHA 1UKQA 3DUSA 3INUL 3S88L 2FX7H 2O1AA 2VQ1B 2GUYA 2Y69B 4YSOA 5FYLL 3W0WE 1NICA 3E6HB 2YHGA 4XP4L 2A77H 3D3VE 3CVIH 4FULA 3OKOB 4ZAKC 1JHKL 1MI5E 2X4TB 3GB7B 4MDJA 3TZVD 5CCGE 5DEFB 5HHNA 4K15A 3W5MA 3LXCA 2ZSVA 2PYED 3EDKA 4MJ2A 4OLXL 1XF3A 4A7QA 3UDWC 2V2WA 3UTTA 4LGSB 4C56A 4IBWA 5ENWB 3KCWA 5L8LB 2BVEA 4I0PA 4JN1H 4MCYB 4QJ4B 4ZUUB 4GNKB 4P5KA 4ZSOE 4AWJC 5I0WA 5B39A 1RZ8A 1GGBL 4B9CA 1MCCA 2FO1A 5DCCA 4F7KA 4BXSV 2RCSH 1DQQB 3MV8A 4FN0A 3DX4A 4X6DB 4OUUA 5F70A 1DFBL 1SBBA 4KJPD 2XKNA 5I18L 1MCWW 2UY7A 3BDXA 2EDKA 5H2BB 3TIEA 5E8NB 4PGJA 2IG2H 2VDRL 2XZQH 2Q76B 3N40P 4UT6L 4TQEL 1QLFB 5FGSA 4DZ8A 1D2OA 4BYHA 3NJXA 2FJFB 3NZHL 4L4TA 4ZFOL 3ILPA 4L0YA 3HG3A 3GC3A 4LQFL 2ITCA 1RUKL 1BLIA 1WAAE 1XH3A 3QFGA 4L8SB 2XETA 3IKCB 1XSIA 2KZKA 2O5YL 3D4GA 2VXQA 3PWPB 1F4HA 1HK6A 3MRPA 4X7SH 1U8LA 3BIBX 1P4LA 3HJ0A 3JZ7A 4QHNB 3GRWH 3GSQA 4A2LA 3K71B 3IE9A 3VXSE 1EJOL 1S9VB 1ASQA 2YUXA 4JG1L 3EH3B 3WNIA 1A5FL 3MACH 1H6UA 3O3AB 5GZNC 3KAAA 3V5DA 5C7XL 3L5WB 3AREB 4M3HA 1T66D 3OKDB 1GW0A 4PBDA 1PVHA 3DJSA 3ELQA 2LTQB 1QW8A 1D5ZB 4HA1A 4QHPA 3IJSB 1IAKA 1AGBB 3C08L 5EEXA 5F7KC 2EXSA 3CDCA 4GFTB 4NUGL 2ZUWA 3H9SB 2WKGA 3PGCA 3C8KB 3G5XB 5CJQH 4A68A 1NC4B 5DJCB 3G5YA 1NBVH 4IBUA 3BVNB 1AD0A 1ZDQA 1J10A 1PKQA 1GYUA 1HX0A 3F64A 4XVTL 3PJLA 2JI3A 3DJZA 4QF1B 5HTSA 4EMZA 3V4UH 3QFJE 1YN7A 5CZVH 4YDNA 3SKJH 3FCTB 3GBNH 2VISB 3B2XA 3VWKA 1PLCA 3P0YL 3ULVL 3RWDA 5I0VA 3ORJA 3GMQB 3HI1A 3OXRB 5T5NG 3DV4A 1DCEA 1SHXA 5I6XC 2WQVA 2BNUA 2FL5B 3DSFH 3Q6FB 4ZUWA 1BGXL 3HNTL 1D7FA 3CZGA 2H8PB 3MRIA 3PLYA 4JR9L 3NOIA 5IQOA 3NIGB 5A2LH 5CJXA 3MROB 4RFEA 4LSUL 1E4JA 3QUXD 4LU5H 1OVZA 2AVGA 2ZPKL 4UNUA 1ZEAL 4MSWA 3L3IB 4J12A 1ZCRA 4U1HB 4G3YL 4M62L 1JK8A 3MYJA 5FDWA 2BVPA 1DQTA 2PXYC 1ZKAA 5AVTB 2X4RA 2O61B 5D1XE 5FECB 3WTYA 4X9GA 4FP8L 3L4UA 4A6YA 3V5HB 2KH2B 3NCFB 4UB0L 4CNIB 3OTTA 3CDGB 2MPAH 4YR6B 3X14B 1ZANL 1D5BB 2W91A 4Z1PA 4X9BA 2GAZB 1FRGH 3IETA 3S8WA 4F1SA 2WYHA 3JWNC 3GMRB 5C97A 1NAKH 4HYTB 1MNNA 3LS5H 4NJAL 4F7CA 4Z18A 4PREA 4ANKA 4JX0A 3BD4A 5CBEA 3WE6A 1P53A 2BNQE 3ES6A 3IAQA 4KDTA 2NMSA 4WDIA 5FB8B 1KEGL 5IBTL 4YS4A 3W39A 5TQ2H 1TQVA 5KTEL 1XAKA 1DBML 5EOQL 3VRIA 1QKZH 1M7IA 1Q0YH 2ICWJ 2XVGA 4NQVA 2XNAB 3MA7B 1TJIH 5B3NA 1JHTA 3M1BB 2PCFB 3TU6A 2V9QA 4HK3J 1F4YL 4AIXA 2G9HA 1PZ2A 1MCLA 2UXVA 1KTLB 4WAFA 5EOCJ 4WQOA 5JDJA 3F6JA 2X2JA 3FO2A 2A74B 5GJSL 4H0LC 3FCBA 5H94B 1WAPA 3VI3E 5CJBA 4JZJC 2ALAA 2EVFA 2UY6B 2Z34A 5F88B 3GI9H 4LP5A 2VIRA 1O7VA 3P0VL 4JY6B 1I75A 1EO8L 1MZZA 1HQ4B 2AK4E 3MRHA 1SHMA 4IMLA 4WO4A 4XB7A 5CCJA 3VFNB 3C6SB 4O58H 4ODBD 5KOMC 1WD8A 3BQUA 1CFVL 4C4BA 4NNPH 5EO9B 5EOTA 5CJOH 3SGJA 3VXNB 2QHRL 2CKNA 2R2BB 5DK2B 5LGJB 2ICCA 1F3DH 1JPEA 3MV11 4UIMB 4OV5B 1FGNH 4JPKL 4AGNA 4J28A 4LEEA 5LXVA 3FUIA 3QJRB 4P4KD 1ED3A 1HNYA 3RZCA 3FTZA 1TCRA 4WEBL 4YVUA 3ULUF 1XV8A 1FIEA 1OAQL 3SGEH 3MJ9L 2XU9A 3KBEA 4CU8A 1KOAA 5DR5L 5AG9A 5B1AB 4M7LH 1I8LA 1ANUA 2IEPA 2CG9X 4TVUA 1DANU 3NK3A 5EU3B 5F3BB 1MAMH 3BW9B 1XO8A 2EZ0D 3CFCL 5SWZB 1UD8A 5ITBH 4FNSA 3TURA 3LZFL 3J27A 3EUUA 3QDGB 4OFYD 1U8CB 1FZMB 2VMJA 3WFEH 3BI9X 4P9ML 2VW4A 2A9CA 4R5XA 3EUDA 3QUMH 3DMMD 4ILDA 4QJ5B 4YHLH 1Z9MA 4YHPA 2WNWA 2MIZA 3KYAA 1CT8A 4YHYC 4MAYB 4U1NB 2EH8L 2OSXA 2CUAA 4J3BA 3NZSA 1HQRB 2B0SL 3V10A 1WO2A 4UT6A 4YDMA 2CA3A 3LN4A 4HWEH 4RAVA 3GXMA 1K6QH 2ZP9A 1K5NB 1RZKC 5DMYA 4BRVA 1BM7A 4NZDA 4XXDA 4XPGH 1YAIA 3WIHL 3EJYC 1JDDA 1WH0A 3VD7A 1CD1B 1LVEA 2EIZA 3HLKA 3ZSSA 5E7FA 1Z9NA 2WKLA 2X42A 3LEXA 5DQJA 5G5DB 2AQ3A 3WXVL 2ZD0A 5JHDE 3CHOA 2PF6A 1KEMH 2N3JA 3GNMH 2QR0B 5C0CB 4NO5A 3ATFA 4LPCA 4KY2A 3V52L 2OAAA 1W6WA 5F0LB 3APDA 5E51A 1P4BL 1OP5H 2X2YA 1XMEB 3O2DH 1A7OL 2C7FA 2F7OA 2IWFA 2WW8A 4GUPB 3SBWA 5IWLC 1XD1A 1MELA 3HHMA 3MGAA 3T09A 1MRDL 3WY4A 1BVZA 2X9XA 2W0KA 4JO4H 2OMUB 1RKRA 5ANHA 4GFXA 5CLXA 1HI6B 1EXUA 3AB0B 4OV6F 5IFAH 4QUOA 4MDIB 1UATA 3NCJL 4FDWA 3OPZH 1U8NB 3GMOA 5JPNC 5EF1A 2QQLL 3MLYL 5KVEE 3L5XH 1U91B 4YOKA 4FTVA 1DJIA 3ZQWA 2KT6A 3MRLB 1QSFE 4MZIA 2K8MA 2ADJA 2MSPA 1FO0B 1LILA 3IDUA 2EUVA 3L5IA 2TRHA 3MTXA 3Q3GA 3TJPA 5D2LB 4Q14A 4QXGH 4TYUA 3QHFL 3FHAA 2ZSWA 2ZF9A 2E9GA 3DRTA 4XVUC 4ZUVB 4F8NA 3L4WA 3K6OA 5IOPA 4KJQC 4X5PA 1L9QA 3EGDB 4TF4A 4FQXC 2P43B 1PSKL 2B1AL 4M6MH 4P46C 4QGYA 4XH2B 5E1AA 1ZXKA 2OCFD 4FNTA 4EI5B 2BVTA 2ZP8A 1IC7L 3MRBB 4LKXA 3C9NA 3GTVA 2Y72A 4K71B 2ADGB 3U2JA 3A6CH 3MLRH 1Z3GL 1XT5A 3EJUA 3HAEA 4ENED 5KS9A 3OR6B 4FQIH 1H3PH 3LQAL 1RH8A 4FFZH 2OK0L 4OFVA 1XF5A 4JJOA 5TGBA 5DMGC 3RX9A 1PJ9A 3QARA 2GJRA 3LHAA 4GQ9H 3QEQB 4FCAA 4L37A 3WN5A 5DRWA 4LMQE 2W81C 1INDL 3L3HB 2E6PA 1GJIA 2WUBL 3QS3A 4GKLA 4YDVB 3D9AH 2VT0A 4MD4A 1OSZA 3K81A 2AI0H 2XXFA 3EO9L 1E42A 2VITA 3ZL2A 4O4YL 4MWFA 5GGUB 2WLLB 1GJUA 4R90H 1PLGH 1VFBB 3HBQA 2QV4A 2V7HB 3DX3A 3PHOB 3ZN6A 1NBCA 2NNAB 3EFOB 3OB0H 1L0QA 3EJZD 4W9ZA 1FL5B 5EA0H 3NZUA 2D7TH 2DQJH 1VPOH 5F7EH 4DP9X 1YQ2A 2YJLA 2FJUB 1DVYA 3D5OF 2WXJA 4YL9A 1CYXA 1MCDA 4AQAA 3OM3B 4JHWL 4OCWH 5LBSL 3T6XA 4N90E 5AW5B 2QPSA 4PN6A 5DJZA 2Y24A 3RTQA 1I1AA 4MA8L 1YQVH 1BXXA 4HWZA 3TBTB 4ZMLA 3QH3A 3V6BR 2G3XA 4Z7WF 4WI2A 3SDDC 2WN2A 1CFTB 4CBPA 5ADOH 3Q5OA 4NZTH 3L1FA 4PJEE 1MVUA 3Q05A 3MLXL 1ETA1 3KGRA 2YJQA 4PRPA 5I1GL 1SOSA 4HMDA 4MB5A 4TTGA 4NPYB 3CXDH 1W0YT 4WW2C 4I3RL 3O0RL 1YNTB 1YPZF 1N8ZA 3FZUC 4XVJL 3DVGA 4ZYKA 3BP7A 4NQQA 1KYOK 1KENH 5GS1C 3Q2LA 3WLWD 5JXAH 1WUNT 1UEMA 4AM0A 1MQKH 3L4TA 4G1EB 2YC1B 4XHJD 5INDA 2AJUL 1D7CA 4KQ4H 1YUHA 2WYTA 3AXLB 5CEZD 4IBZA 3APCA 4NRYA 1IAIH 2M8XA 3ROOA 1U3ZA 3MJ9A 3E3QE 1E8XA 2CRMA 3UDWA 3VD9A 4P2QB 4N2DA 5MHSD 3FU0A 1FL3A 1GW6A 4P3CL 3RY6C 1S9YB 5EUKB 3BFWA 1RJLA 2WC7A 2E27H 1Z5LB 1CN4A 3T9WA 2PW2A 4F2ME 4WFED 1QI4A 1CXFA 1FZKB 5EC2A 5CGBA 4FNQA 2FYYA 3RL2B 2DMGA 3EJRA 1JTPA 4IHOB 5DXWA 3V0VA 2FRGP 1I3VA 2BVYA 1AI1L 3TIDA 1I8KA 3UAJC 4S1QH 3ZHDA 2FGWH 1RZKL 1TVBB 2B2XH 5CCKL 1A7QL 2JIXB 4FFYL 3C87A 4PH8A 1ZGLP 3SKNB 2COVD 3O6LL 4X6DF 3GM8A 1I9RL 4ETQA 4L3EA 1J8HA 1AIZA 3WIHA 3CXHK 4MAZA 4J2QA 2GTQA 3RVXD 1OK8A 3NCYP 5ANMB 4NN6B 3D52A 3O2VL 4IGBB 3HZMA 3MKKA 5GZNA 2DTSA 5HDQH 3EYFB 5KUKA 1YEDB 5HPOA 1HC1A 4J8RB 1P7QD 3ZTCC 1R46A 1ROCA 3U1QA 3TXAA 5KSBE 1BMGA 1QA9B 1XIWC 1CTMA 4GKSB 3DXAA 1PG7L 3DJRA 2I9TB 3DHMA 1XBDA 3IJYA 1A7NH 4YHNA 5DA4A 3TV3L 2G60H 4G70B 5A2CA 3H42H 3K72B 4PBVC 3KPNB 4ZPTB 2VMEA 5I9QB 1HXKA 2UZXA 4QJ3B 4MD0A 4G8GE 5I30L 2G3NA 3GMMA 2GY5A 4N1HB 2FEEI 3ZKQD 2OLDA 2XXMB 4W6WB 3V5KA 1GKEA 5A6IA 3W0WB 4MBRA 3M7FB 3SDAC 2K6WA 4HIEB 3RBGA 1MY7A 3D3VB 2BXYA 2IWEA 2DQDL 4HK0A 4NSKB 3U0PA 3IF1A 2GG1A 4P2YA 5EEYA 1GL4B 4JFZH 3ARRA 3CFKB 1TNNA 5DJ0A 3O4OB 2VXTH 5DURD 2CKBL 3MRNA 1AZUA 3WENA 1ZSDB 1PZUB 4DKFL 4ZSOB 4BH7B 4XN4A 1X5HA 3D69A 5TQ0H 3US9A 3EH5B 1OGTB 1YEEH 2WLYA 4F7TB 4QR7A 1MFCL 5B39G 4XPHH 3T0EA 2D0GA 2OX5B 1WBXA 4XODA 5EC1A 1QFUH 2DICA 2JTDA 3ARBD 4Y4KC 3JV4B 3QQ3B 3BAJA 1QG3A 1W0VA 4OIBA 1G87A 1PZ3A 4RH4A 6FABL 3QJFA 1KXVC 3BAXA 5GS2H 4X4XA 4Q9CA 5KOVC 2PXYA 1YLBB 4MS8C 5FV2A 5HYQB 3EFFA 3SPVB 1NMCC 2J25A 1IVLA 3KG5A 3NBNA 3NIGF 4ZFZA 3V7AG 1G6RL 3NN8A 5I16B 1KG0B 3HS8A 5E2UH 5I1EL 4I85A 2F5AL 3CK0H 3GDCA 3AT8A 2ZCZA 1C5BL 1ID5I 2BP5M 3ARSA 3VXSB 3NH7L 1JYXA 1VFAB 2QKIA 1EA9C 1R5IB 5EO1A 3WOVA 5MEPA 4F37F 3QG7H 1SHWA 5L9DL 4GG6E 4KKLC 3S4SB 3ASNB 4RMUA 4WWPA 2A6IB 1O75A 5T3ZL 2DIJA 2O30A 1IM3A 1CE1H 4WI0B 2CRIA 4HIXH 3UAAA 2J1WA 3ZRCC 2XQYA 2IMMA 4X4KA 2ZX8A 3EXLA 1GS6X 1PCSA 4OGYL 3W5NA 1S78D 2IAMA 4NAJA 3QJHA 1K4CA 4TSAH 3DECA 1F2QA 4FZ8H 3KPLA 5FR3A 4Y1AA 5LBSA 1H3UA 2E56A 4ZMNA 3AQXA 2F7PA 3MNWA 2P45B 5AWNH 4ZMTA 2V9TA 3QQDA 5TE7H 3SDCB 4OR1A 2WUCH 1TKWB 4E41A 2J71A 4UQEA 2AGJH 3AVEA 3UZEC 1KJMA 4UQ9A 3QAQA 2QQQA 1CG9A 4N5UA 3UTSE 1HESA 4KROC 4M7KL 2CDEB 1N5AB 3IMUA 3QFJB 4Z95H 4QRRE 3JV6B 5IHBA 4HDIB 1X5MA 3E8VA 1HCYA 2CO7B 3MI6A 4GRLD 4LSTH 3VX0A 3L5HA 3H54A 3L3GB 2W5PA 2J8UB 3RU8H 2CO6B 2VLKD 2JQZA 2X09A 5EF0A 2C8NA 4UILH 3GGWA 4HJJL 2F53A 3VH8B 2Q7YB 4Z3IA 4PJXE 2ZXBA 4G2AA 1IAIM 4BFIA 5A6LA 2B4CH 1GVIA 3CJJA 3KVDD 1A02N 3ARGD 1A4KA 3E2HC 2QLVB 3SD5A 1KTDB 4BA8A 1AHKA 5E8DH 1HDMB 3DRQB 5D1XB 1SLXA 4X0KA 2DTMH 1KLGB 2I7SA 5F7NC 5DHVA 1LE9B 1YEKL 2X4UA 1ZTXH 1RURL 4PRDA 4DWHA 5B4MD 2A9NL 4GAYB 4DJMA 1IE5A 2F19L 5IJVA 3P11H 4A2EA 1IO4C 2MJWA 3RWGA 4HETA 4H26A 3FT2B 4DSYA 2X12A 2P8PA 3DDGA 5FUCC 2EXYC 4TPRH 1GSKA 2ZWKA 5AUMA 2BNQB 3MV7D 5KW9L 1ACXA 1EJFA 4QO1B 4APQC 1QFWH 2P9RA 1AHWB 5DMKA 4K8RD 4X80H 1MW0A 1WFIA 3QEHB 3HHRB 4FYQA 2F1BA 4PQXA 2H6UA 4B3EA 2BWDA 4AYFA 1U8MA 4FFYA 5IG7B 3TTSA 1NCDL 1HXYB 3CHSA 3NJNA 4LASH 1HHKB 4DERA 1ACCA 1ESOA 1WBZA 4P5MA 4JFEE 3BH8B 2Y7QA 3B34A 5DO8A 3NPSC 5C0EB 4IIQC 1C9SA 3WMPA 1LDSA 2IGFL 2P46B 4N2OA 1O5DT 5D7LE 4JZNA 3VI3B 3AY4A 3VFWB 3ZE2E 3LRMA 3UC0H 2YA2A 3GIVA 1L4IA 5L7XL 3FUEA 3L9EA 2R23B 4MZ3A 3OJVC 2VDLH 4MAUH 4R7NB 2PO6B 4M02A 5KVGL 5CD3B 3H53A 2VZOA 3HG1D 3KLSA 5IMKB 1J8KA 3MREB 4JFVA 3KWXA 4Q4IA 5EIIB 3WUZA 5FA3A 1R5WA 3MRKB 2D7NA 1HEHC 3N42B 3QRLA 2OQJA 5F1SA 4LDEB 2CO2A 3BXNA 3VA2C 3OGCA 1TVHB 4CL7A 5HHQA 3IM1A 3WLBB 4OFQA 1PDKA 5IROD 3CVIL 1JNLH 3IDXL 4GSDH 1GY1A 2G75A 2JJTA 3ENEA 5JPNA 5BZXA 1DUZB 3CFDB 2EIBA 4HZ1A 4R8WH 3ZMEA 5FO7B 4RX4A 1KELL 3K2UL 3DA0A 3CLEL 4M6NL 4D3CL 5AVYB 3FQWB 5LCVL 1LO5A 2X6CA 2CKBA 3AAZA 2IH3B 2VERA 1WBYB 4LLMA 4QT5A 1QSEE 4J3XA 3FULA 3HNVH 3LVEA 5A40E 4OJEH 2DD8L 3BWZA 5D1QD 2FH8A 3QNXB 2EDXA 2Q8AL 1OE3A 4EQ2A 4WHTA 2F15A 3LSOA 2K3TA 3SDXA 2MOGA 3TJHD 1TIUA 4W9JC 3NP3A 2GTZA 4Y9GA 5BQ7A 1XGQB 4ZMXA 4J8QA 2ZXQA 2NY1B 2AXWA 3AC0A 1JFQH 4HCRH 2X4SB 1BVKB 1K3IA 1O7DE 5D2LF 4O2CA 3BVVA 4CKVX 3UPCA 2XTJD 3AABA 3KBHE 4LESA 5IB1B 2P5WD 2YMOA 4NO0A 1NTDA 3UYRH 4RISH 3MAWA 4YDIL 3H3KA 1XZ0A 1M56B 1YEFH 5GIRA 1NCIA 2A9ML 2UUDK 5I71C 4Y19E 4NQEA 3Q2WA 1G6RA 2HFTA 3HRPA 2AABL 5J13C 3X12B 1XAUA 2RACA 2IDQA 4P04A 2ITDA 3PWPD 3TEZA 5BV7L 1ZGLA 5JHDB 3IN2A 4L8BA 2HX9A 4BA0A 4LARH 4M5YH 1UD5A 5EEZA 1IM9B 2B7DT 1ZDSA 2A9AA 4WCYH 2X3CA 1X5FA 1ZPUA 5HGDA 1AANA 1OB1B 1Q0XL 2YKLH 2YSTA 1TPXB 1NAML 1LMKA 1IBGL 1EANA 2O5XH 4N9GB 2X87A 3ZYJA 1NGQL 4N6QA 1P6AB 3FU7B 5CEXB 1TMQA 5AKVA 2VO8A 3B9VA 3LH2H 1CL7H 3OMZA 1XGUA 4KTDH 4PJ9B 5FYKL 5FYJE 5T1KB 2NYYC 3L9RA 4PSPA 3S2CA 3EFDH 3QCTH 4L29A 1PYWB 1FN4B 1M2VA 1LO2L 3IRZA 3UTTE 4C56E 1S7UB 3KCPA 1KGXA 2ZKXA 1Z9SA 3BMWA 4R7DB 3BCFA 3PL6C 1F1DA 2QDWA 5FM5M 3W56A 5FO9B 2ICWB 4HIPA 4MNQD 3RWIB 2OXGA 2B1HL 1FFTB 1X5YA 3L2LA 2MCPL 3SKJL 2BCKB 2ZYHA 3PWNA 1VACA 1VZHA 2C9XA 2J1XA 4EIGB 3OKEB 3SD2A 4UAOB 1IQWH 1JCVA 2HKAA 4KK8C 4Y5VB 1PX3A 1J48A 1LP9B 3H85A 2CIIB 1DBJH 1ZA3A 4NIYE 4N5EC 1G7LA 2V4LA 4XO4A 3V4VA 4CUCA 1A7RH 2FE0A 3NFNB 4L4TE 1OM9A 4M4RA 3PHQA 1I1RA 2NXYC 3V7AE 4LNVA 5BXFA 4EOWL 1GOHA 2KL6A 3WKMH 2FUQA 1YNTF 5I8CB 4HJ0D 2R4RH 4KY1L 3T3PE 1HAUA 1FPTH 1E9QB 2GK0A 5AZEH 2A0LD 1AQ8A 3HNSH 2YGPA 2AQSA 3B8SA 5FKPA 3CX2A 2VMFA 3HMWH 3HAEG 3I75B 3RY6A 5L2KA 5F7DB 3AGVA 4OLYH 3N43B 1GTFA 3CFEB 4E9LA 4BKSC 1FDLH 2MPAL 2UWEA 4Z3GA 5I66B 2OMZA 3QNYA 1SYVB 2PR4L 1RUPL 5AVSB 2IBBA 5E1IA 2KMWA 4L1SA 3IMBA 2GJPA 1BQLL 2HFEB 3T4AC 1OKEA 1QFWM 1AJ7H 2VM9A 3LN5B 4E9SA 3WJJA 3QXWA 1IEBA 5IBLC 3VXMA 2HT3D 4JGNA 1F6AB 3OAYK 3VDAA 3Q1SL 4JANB 3VGBA 2I9LA 2BP3A 2VSCA 2NW3B 4AGOA 1JUFB 3SDYH 4Y16C 4LVOC 5SWQB 5TPWL 3MJ7B 4OGAC 4LNRB 3VFUA 4EBQL 1JSYA 3WBDA 2CLVA 2EH7H 2W94A 4AVJA 5J4MA 5F1NA 1DVZA 1PKQE 4JO2L 1KWGA 3G04A 1VKXA 3SB3A 2WBJC 3EBGA 3T2NH 1U92A 4HS3B 1R17A 1XH1A 3FAXA 4WEUD 2CCWA 1MCWM 3V4PB 3Q2NA 1W15A 3P9MB 2AJXH 3K5RA 3BPLB 4NN7C 4D9RD 4I4WB 1FVEB 3KXFD 4PW4A 1UCTA 2NUPA 3SPGA 4PJEB 4ANUA 2PCXA 4QY8B 1HHIA 1MUJA 3BT2H 4OM0L 2CXKA 5AAMC 2OL3L 1E3ZA 1U3HB 4ZW3A 3FQ2A 1XIWA 5IVZA 1VJSA 5M95B 3CDZA 1FWXA 3UTPD 2VC2H 4S1RH 3MBED 4MVBD 4X98B 3Q7JA 3CZLA 5CZXD 4G8AC 2IANA 1MWAB 3QR2A 3JTSA 1M6UA 3BEVB 2PCYA 2VDMB 1V3JA 4N8VG 2XG4B 4BUHA 2MWCA 4PTUA 1N64L 3FOMB 3PWJA 5GISL 3SDAA 4UAHA 5HVHB 2CLRA 2D9QB 2G9KA 3QHZL 3OX8B 4LFHG 4U7MA 3NACH 5EBWA 3H9HB 3VW3H 1IAII 2UZPA 3O6FC 4B3VA 2Y2WA 1SMAA 2CR0A 5C3LD 2B3RA 2IOMA 2NTFA 3I02A 5IQ9B 3GWJA 3KYKH 5LCVA 3SHSA 3WCYA 1C5CH 2I5YL 4GAJL 4Z8FL 4LRIA 1KGCE 3UGUA 4YSPA 5E08L 4JVPA 3IE4A 1E6OH 2NQ3A 5IHUH 2W95A 5CGYD 3C5ZC 4KPHH 4HF5L 4HPHA 4U1SB 3ZPDA 3DETD 3EAKA 1MFAL 4CMHC 1MAKA 1OLLA 4QXUH 1SVCP 2PTTB 4WHYH 3QAZB 2XJLA 4N8PA 2D03H 3US1A 2R7EB 3C8DA 1RD6A 4P5TC 5GGVY 4JM2B 2AXFB 3P4MA 4HHGA 1S5IH 1HILB 2H2SD 3TA3B 4DFIA 1FAIL 4I77L 5SWSA 4HPYL 4P3WA 4U6XA 1S3RA 2F8XC 1AY1H 4P2RD 3BD5A 1PZAA 5KSAC 3LTVA 4PHZA 2APFA 4K07A 4M6OH 4TVPD 3U9UB 3GJEB 4UBDD 5K93A 2L0DA 5SV4A 1FV1B 2X88A 1R3LB 3HW7A 4XZ4A 5HHVL 3RPIB 3C2AH 4MQXC 2HLAA 5JW4R 5IK3A 1YEHL 1NLBH 1DTUA 3MRRA 5F96L 3MA9H 3RGVB 4J3OG 3S97C 3S36X 1ZHBA 1P4IH 4PRHA 3TN0B 5KSBB 3EXJA 3TBWB 3S8GB 1JTOA 1EWHA 4WJ5A 1NAMA 1JV2B 4KNTA 4M7ZB 5DFAA 1U8PB 3Q2VA 5FYLE 1M53A 3O3DB 5B38A 1JGEB 5L6YL 43C9A 1FLRH 2V37A 1URZA 4HMEA 4NYLA 3ZZQA 4EVNA 1FG2B 4ZZFA 5I1LB 2PMZA 3A3YB 4Y5XC 2OZ4L 3FTVA 4J2XA 3RKDC 4F33A 5IFAL 1TTUA 1FNLA 1A64A 4IU2A 2HVKA 4PV8A 1CMOA 1MY5A 2DY2A 4HUUA 2G30A 5DD6A 4JG0L 5I8EB 4LLUA 3X13A 4M7LT 1GGYA 3BZDA 1BVNT 1RIHL 1S7SA 4ZDHA 4JAMA 4A39A 5FGBC 3A5VA 3GO1H 1C16B 1GY2A 1Q1PA 1IU1A 2DEYX 1UD4A 1MQ8A 1RK0B 1UCBH 2PUQT 2N4IA 3MBXH 4LHUA 1SEQL 5E99H 4IK6A 3I6LE 4Z0XA 1NFIA 1YJDC 4M6ML 3HVDA 2EYSB 1JZ5A 4AQEA 1T21B 1M42A 3MRQB 2OI9C 4NERA 4G5ZL 5A2IH 1EO5A 3R06A 1P7BA 2OYLA 2J57A 2PCPA 1HEJC 2J8UF 1K85A 2OMWA 1D7BA 2VR7A 2WOYA 4EI5D 5BVJB 4HWBL 1EAJA 4W9GC 1LMIA 2IALB 4Q6IC 5EBMB 4GQ9L 3NQIA 4OD3H 3WHE0 1TQBB 3NSXA 5IMOB 2C9PA 3EJPA 3QIWB 4WKZB 4JMNA 4X6EA 2WD0A 1E9PB 32C2B 3C6LD 3RFZC 5EU6A 3QRGH 2V9RA 4Z3FA 3CZKA 5KYYA 3EJQA 1UA6L 1CFQB 1BX2B 4AYDC 2GITB 5JOFA 2WAQA 1RMFL 3IFPB 3JWNG 4EDWL 1KN2H 4LEOB 2OZNA 2YK1L 2WZAA 1S7RB 3VXTA 2AITA 2Z35A 2I27N 5EA0L 2A4EA 3BEWB 3LDBC 2B5IB 1KBKA 1FE8H 4N26A 2WZPD 3HFML 1S5HA 1WUZA 5EEWA 4HOZA 4JKPH 4B7LA 4E42B 1EXHA 4D0BA 2XQYG 2NNRA 4GKZB 5D1ZB 4TNVF 1CZ8H 2P28B 3WU1A 4QXTB 1E30A 4JFYB 4FTVE 5FFLA 2X4NA 3T1FB 1VZGA 4HOXA 5I0YA 1NGXA 3GJFB 4NZTL 3WFBL 3ULVE 1SUJA 2H6OA 4AEHH 1BZ8A 3UTSB 1S7XB 4OAWA 5IW6B 4K7FB 4IKJA 3KJ6H 4N1CA 3U6RB 1R5VA 4H88L 4QRRB 2OTWA 2OL3A 5I73B 3PAVA 4LL1A 5DJAB 3VACA 4GW5A 3NUKA 5DJDB 5IFJA 1GGIL 1CVSC 2NYZA 3DVNA 4OLWL 4PCTA 3KPSD 2AKRA 2DAVA 2W65B 3IEAA 1IC4H 3H7BA 3VI3F 5KS9E 1NUFA 4G7RB 4PJXB 4UTCA 4OZHA 1NJ9A 4MQ7B 3P3RA 3X3FH 2B59B 3DIVA 1CLCA 1K8IA 4KQ4L 4LCIH 5HGHA 4ORZC 2B4CC 5EZOH 4R4BA 1OP5K 3CZJA 2XWRA 4QRUB 2Z3FA 1NCOA 1Q4NX 3KBPA 3B3IB 1UGNA 4AVIA 1NC2B 3BPOB 3VFOA 2YGQA 3FH7A 3WHXB 2KLTA 2YPLE 2BS71 4IRSC 3CN4A 4TULH 2ADIA 1NDGB 1J9TA 1AXIB 5TF1L 5A7BA 1BMWA 4P2QD 3VXQB 3US0A 5DRZA 4POYA 1IZJA 5LNDA 4NNXB 4OGXH 2QKSA 3N55A 1K2DA 1B2YA 1T1XB 1QO3B 3FCSA 3LKQB 4EF3A 2F1EA 1XCQB 3PGFL 5GRUH 2DQFA 5D7JA 4KKRA 2DJSA 1OEZW 1QFWI 3E9UA 4NZUH 4NNYB 2Q86A 3M8OL 4K3HA 3RJDA 4NKQB 2W07A 1G9NL 3NAAH 3Q13A 2C4XA 4G7QB 2NY0B 2M83A 3FN0L 4UINL 5ILTL 5GZOD 2VXVH 4PYGA 3TNNA 2AF2A 3D1MC 1CR9H 4PRPE 5J6HB 2VLME 1ZVSA 4LKCB 3P2BA 1J0HA 1T1ZB 3TL5A 4X8CA 5HVFB 3EYUL 4LE8A 1KGUA 4PB0H 5F3HA 5D7LB 4YHML 3ZZ1A 4OM1L 3L54A 5I1HL 1MVYA 4XE0A 4BUGA 1GGCH 1S7TB 3FQNA 4HIIA 4CA4A 4EN3D 4Z5RB 3FSVA 4WJG3 2HJLB 3MX0B 1WF5A 5BOJA 1T4WA 2WY3B 2XN2A 3DROA 2G60L 5TE6L 5K59E 3QCVL 4JHAH 4NWUL 1ZGLM 1OE2A 2ERJB 3LN9A 5AD0A 1IGTA 4Y2DB 3RUGE 5DS1A 5D7SH 3ZDZE 1LO0L 2K70A 4OJFH 5JHMA 4TL4A 1P5VB 3OB0K 5BZDB 4EZKA 4QRPA 4RIRB 4YPJA 3IXAB 3N42F 4XNZB 4KRPD 2G2RB 2YLHA 1IQDA 4FZEH 3RX5A 4WJKB 1DVFA 2OZ4A 4NS0A 3L5JA 4G6ML 2KQNA 4YE4H 2WQSA 2Y7MA 3RRQA 3OVUB 3W0WD 3WKYA 2GEEA 4DTGH 2D7QA 1MHEB 4MHHI 3D3VD 3VD5A 2AHIA 3H0TA 4MJHA 1MI5D 3VRLE 3VI4A 3U4EB 1F4WH 4RETB 3UC2A 5JA8B 4XVSL 4OSUH 4ODUB 1ZHNB 1YJDL 1GR7A 2Q9OA 4AY0A 5EU5A 3GUTB 1YAZA 3EHBD 4BWTA 3C2SA 4DZBA 1IKFL 3EO1A 4NQDA 2YFOA 3A6OA 4L3EE 3UJJL 3H2PA 3KPPB 4PGZA 1UD6A 4JJ5A 2NY6D 3BGFC 4MMXC 5DFVD 3IKKA 4Q8BA 5FYJU 4CMMB 3QJTB 2EVJA 3C8HA 4W9KC 1QLEH 1ZOXA 4NT6B 1BFOA 3D25A 4HWBA 4HD9A 2R15A 2I60L 1QR1A 5TDNA 1AXSB 4Y19B 1H3GA 2YEZA 2HRGA 1BEYH 3B2VH 5AW2B 1A6AA 3T4AA 2K4WA 5FUZL 3DXAE 4JFHE 2AJ3B 3HI6L 4W1TA 3CFBA 1JPGB 4NUJB 3BGMA 3DGGA 2OW7A 4HBCL 3N43F 2QVFB 3DUSB 2HLFD 3GSNL 2WINB 1N2RA 3ZL1A 4F5CA 1KULA 4H44C 1I9IH 2WBJA 4JQVA 1A8JH 5C6TL 4OCLC 4QCIB 5DQDH 3X2QB 5HHPA 4NUQA 4KTYA 1KIPB 3R8BB 1TJGH 3FH8A 5DVMA 1KCUL 2VLJA 2EIKB 2ZUQB 3FFCA 3R0MA 1AKJB 4FZ8L 5HHNB 1SXNA 2JLPA 2ZSVB 3WFDH 3MZGB 1DJXA 2BP0A 1MLBB 1XF3B 4ATWA 1UOLA 1WWCA 2VXSH 4KAQL 2BPBA 1OF0A 4WWKD 3UTTB 4C56B 4I0PB 4U6HA 1MWOA 4FOMA 5EZIH 5I5RA 4WKXA 3D4CA 1RZ8B 5C07A 2B9BA 4U6VH 1DVSA 3ZHNA 4HUXA 5ESAA 3QIUC 5JQHC 4K5OA 1JHLH 2NPLX 2QJDA 3WEBA 4FF9A 2NXZC 3T0EE 4M29A 1HINL 3IU4H 4ZOCA 1IGYB 4PM1A 2XKNB 3ARYA 4BJLA 2PP8A 1A7BA 2UY7B 3V95A 5KYXA 1VEMA 3RVTC 3TIEB 3ESUF 3NT0A 5T5NF 1BQSA 3GBMH 4DZ8B 3L9BA 3QFJD 5DU7A 5IHWA 2J1KA 1ZSHA 4GT7A 5E2TL 2CSPA 4AK2A 1DZBA 3BZEA 4PJEF 3I50H 4L4TB 3TP4A 4AV4A 3T4YA 4B53A 2UZIL 3KPRA 1T7VA 2CIKA 2HMID 5F7LB 2BRRH 5KJ7E 3MRPB 1U8LB 5FOBA 1P4LB 3T3PB 5IHZA 4I3GA 2ZCKH 5DVPA 2H1LM 2RH0A 1FGVH 2EYTB 2YMXL 2EIDA 3GSQB 3JWNE 3QS2A 3UYOD 4B9FA 4E9TA 3VXOA 1CFSA 4FS0A 5BZWA 4IBTA 1KCVL 5F8QC 3K46A 5K1NA 2ALWA 1RZIB 2CA4A 3L4ZA 1J8RA 3V5DB 4AUUA 4UV4L 2BM3A 5DJ6A 5F2FA 3A24A 4JG9A 3CFJA 2FCBA 2X44D 3OXSA 5DRXA 1IAKB 12E8H 4DAGL 1S7WA 1LO3H 2EYRB 1KBPA 2BZ7A 4FRWA 4FFVC 1TITA 3C5ZA 5J11B 1R3KA 2E0PA 4NP4H 3DK0A 1FZJB 4YDKH 2R0KL 4JM0A 3B2DC 3CH1A 4KFMA 1OXYA 2YD2A 3G5YB 4Y1AE 3FO0L 2ZX6A 3D18A 4N2KA 3BLBA 1AD0B 3QI9D 5CBAA 4ZX3A 3VCLA 2GJZA 4E41E 5I17A 2BNQD 3STBA 1JG9A 5SX4I 3FC8A 3MOQA 1YN7B 5D96C 4I3SL 3CC1A 4EXPX 5KSAA 3QUZA 1T1YA 4FG2A 2DJ4A 4IEFB 3VWKB 5I8OL 1T7ZA 4KC3B 3RWDB 1QTYT 5I82A 4AYMC 1WFNA 3UBFA 3HI1B 4ODSH 3SE8H 3DV4B 3UBGA 1SJVA 2DI8A 1VLXA 5DFWH 1RSFA 2WWMD 2XBDA 3AT0A 1NCCL 4J4PD 1HNGA 3MRIB 4JM2F 1G4MA 2F53E 4RFEB 3ARTA 5AALA 4P2OB 2VJ0A 3KYNA 3VMNA 4MSWB 1HOEA 7PCYA 3GF8A 1OV8A 4AIZA 1JD9A 4N86A 3JWOH 1D5XA 3Q8CA 1LYQA 2AK4D 3WNOA 2H2PC 5FDWB 2BVPB 3B6SA 3I3EA 4GBXB 5CP7A 2PWDA 3HR6A 5I1JH 3PCYA 4AVKA 5KSVA 3UGEA 2XC8A 5LBGA 4IS6A 2JELH 2R2CA 3QPXL 4MZRA 3CFUA 5KSBF 3KBFA 1JVOA 3ECBA 4GXFA 3DV6A 2QQKH 1MNUL 3VMOA 2JCCA 3RDTA 4XNXH 3IETB 1Q9WB 4UQDA 4R8WL 2J6EH 4F27A 2JNZA 1F1GA 3IFOA 2HTKC 1K4DA 1R75A 3D85A 5FGBA 4GS7B 4PREB 2CMRH 3STZA 5CBEB 1HH6A 1HL5A 3I9GH 1AQDA 1Y7VA 3NJHA 4WDIB 3NJMA 2IPTL 1ILSA 1QVOA 4PRBA 3OLGA 1E4KA 4MMZC 3GM0A 4F8TA 1UXWA 4ZODA 1OM3L 3VRIB 3L95A 2CUIA 3HI5H 1M3JA 1UVQA 3NTCL 5AZ2L 5I6PA 3CVHH 4NQVB 2EXWD 4FMVA 1JHTB 3QWRA 3A23A 1NBZA 2VDNH 4F8QA 1DQVA 2GC4C 2G9HB 4IM8A 3NCEB 1JD7A 2ROXA 3B2PA 2P3YA 4XC1L 3PP3H 1RZFL 4Q6IA 2XZCL 3POHA 3PQYA 1FFNB 1KIQB 2OR8A 3UYRL 5B8CC 3NCWA 2BZDA 3DIFB 4P05A 2HWZH 3MRHB 2XG5A 4IMLB 4WO4B 5C0BD 2WNGA 1YZZA 3R1GH 1MCPL 1NBYB 2BDNL 3TVMA 3WS6A 4YLQT 3JWDH 3NJGA 2EDYA 4Q4EA 1W72L 4ONFH 5EOTB 2WTOA 4FHKA 4KMQA 5F1OB 3AS0A 3IMTA 1SY6L 1YEIH 4YSRA 5BRZA 4G6KL 4MBOA 2P8MA 3FBQA 3ZZSA 2YKKA 5I5MA 3GSNA 4KDWA 1ED3B 3BKJH 3IDMA 1GS8A 1I8AA 4NO2A 5CFAA 5KVDE 1IM9D 3NMEA 4WUUA 1A3QA 4JDEA 5B38G 4G8IB 4KXAA 1J11A 4OJDH 1F42A 3HE7D 1KPUA 3FT0A 2F54A 1ETZA 1N7MH 2WQAA 3QXTA 3FRPA 4MXQD 3SKMB 3HBZA 3WNLA 2PN5A 5T1KD 4LSRH 4U4IA 1PY4A 3UFIA 5KJRH 1H0DA 2E9WA 4NWTH 3ZQXA 4ANXA 3W11D 3SDXE 4KK5C 2NUTB 2NR6A 4ENZA 2Y7LA 2FNBA 4ZMVA 4X7FC 4XCEA 1CT8B 1UWFA 3L1OL 2ZWSA 5JZ7D 1RZGA 2LLLA 4U2YA 1BOGB 1CURA 1A7RL 1QSFD 3PABA 2KC0A 4ZMQA 3LN4B 3SPJA 5JMRA 4RAVB 2L7EA 4LHUG 3RB5A 2LQRA 4DOHE 4ZFOB 1AC6A 3FO9A 4ZMYA 3QUYC 5F3BA 4LGRB 3K6SA 4TOYH 4XXDB 3IGKA 4CSPA 2EDRA 3S3CB 2P26A 4NQEE 4Y7MA 2DB8A 3CSTA 5T1DH 1AIFA 2EIZB 2EO7A 4IU3A 3KLQA 3QQ9D 1B3JA 1F45A 2VDOH 3LEXB 5DQJB 5TE4H 4ZW5A 3FCUB 4IRSA 3N1PC 4AC4A 3P3TA 1CYGA 3NPZB 4PJXF 3BISA 2X4OB 1FNHA 4XP1H 1QHQA 1WWBX 1P9MA 1OALA 3GIZH 2DWYA 3MRDA 5AB1A 1EJ8A 1GYVA 2Q2EB 2R1XB 5T3ZE 5M94B 3V79C 3GSOB 3MRCB 4U3HA 4XNBA 3HOGA 4P2CG 5E6IA 1ODAA 4GG8A 1S7VA 4L1BA 1RIUH 1CFMA 4FFWC 3WTTA 2KZWA 4ZTOH 5GGVH 1KTBA 4P9HH 1AO7A 1YVLA 4XXCC 2GJ6A 4ERSL 5E9DB 2HX8A 1HJBC 4U1GC 3AW5A 3GBLA 4QI3A 5E4EB 2FQGA 5CEZH 4KK9D 4FMKA 4Q9RL 5SX5H 1EXUB 3T6WA 3S35L 1E8YA 3CSPA 2C9QA 4ABQA 1CGYA 1MFEH 2FX9L 1RHHA 3GMOB 1G7IA 5GRXG 2X7LA 4EAEA 4FTVB 1OAYH 1IZKA 4UQ3A 3O9WB 5E2VL 2ADJB 4KZEH 4WWID 4Z7WA 2VL5A 3Q3GB 1EDQA 1EGJH 3DRTB 3OF6A 4FI8A 3FQXB 4QHKI 5F9WB 5IOPB 1ZHKA 1E6JH 5TJWK 3VTMA 2ZOUA 5E1AB 1JZJA 1U42A 4YC2B 2XN9D 1G1YA 1YPZA 1E2ZA 4A7TA 4GIAA 5ICZA 4LKXB 5DEJA 4F92B 3C9NB 4M5TA 1UADC 1JGDA 3J07A 3BKYH 1GZPB 4FQ1L 5C8JA 3RA7L 2AXHA 1ZVHA 3HAEB 5KS9B 2WYIA 4JN2B 3TF4A 1XF5B 3BHBB 5TGBB 2FO4A 1IKOP 3HE6C 3MR9A 4B6ZA 5L2KE 5MI0B 1UB6B 2RGSA 1CK0H 3IWUA 4HFUL 1CXHA 4L37B 4V33A 3WN5B 2UWEE 3HMXH 3SODB 3O3UN 1TDQA 2X0WA 1P1VA 1OSZB 1JE6A 4U2ZA 1YMHB 4A7SA 3T0XA 2VITB 2R27A 2YPLB 3NEXA 1F4AA 4MWFB 1BMZA 3VXME 3F7PC 3KLAA 3F3HA 3MBWB 3ATEA 4E2OA 3C5XA 4PY8J 4P23B 4PLJD 5AOIA 5FV1L 3RNQB 2EDDA 1B0RA 1XR9A 4ZO8A 3K91A 5GGQH 1E6OL 3O11A 5GS0D 3GB7A 3HLAA 3FSOA 1IBDA 1MG2C 4S0SD 4AQAB 3ULUH 2DLFH 3AG2B 3QDJA 5DK3A 4OGZA 2ZX5A 1I1AB 1PY0A 2XUWA 2DH3A 4OZFA 2HP4A 1HE8A 1TZOA 2YQGA 1JWUA 3MLSH 3QH3B 4MCYA 2APWA 2HG5A 3IDGB 2D03L 3WN6A 4NC1E 3D0LB 4ORGA 1ML0A 4N0CD 4NXKA 3EGXA 4UWQB 2VE6B 1DQQA 3LKRA 4FKKA 4DN4H 3ROLB 1W80A 2HJFA 3TBYB 5AOKA 2Y07L 3WJLA 2CWRA 3TZVC 2Y2YA 2DN7A 1DVXA 4M6AA 5BUGA 4DP0X 3T2OA 1IL1A 2Q76A 3CFIC 4JM2D 1QLFA 4OIIL 2FUTA 1RP9A 3DVGB 3BP7B 4ZYKB 3TA3D 4N0FA 1U3JA 4N8VB 2L4OA 5KVGE 4GQZA 4ZUSA 4XNYH 3MXWL 4I13B 1PMYA 1KTKE 2DYPB 2FT6A 4AM0B 2JJVA 4KJPC 2YZ8A 4RMVA 1BFVH 4KO9A 4IRJD 1QHOA 5HHXL 1YUHB 2GW5A 5F0PB 1GYWA 4D0CA 2E4TA 1TZIA 4XP9H 4NRYB 3RUGB 3ROOB 1S9VA 3ZDZB 4RWYL 1RFDL 3WV0A 3B5GA 3HHSB 1FL3B 5DJYB 1U4FA 2LFGA 5E2JA 3CAFA 4LDOB 1RJLB 2LOEA 4CN4A 1ZIBA 1TMCB 1SZNA 2K0RA 2X1XR 3H55A 5CMAA 4G8GD 3RJOA 1E5CA 1AGBA 4S1DD 2PW2B 2V8MA 4N87A 2A1WH 5HHME 3CC5A 2N7AA 1VFMA 1N4XH 4IBQA 1F90L 5EC2B 1DSFL 1NIDA 3RQ3A 3S34H 3UMNA 3G5XA 3DHJA 3SZ6A 1NC4A 3RVUD 1NIBA 3V0VB 2YQ2A 5DJCA 3GRGA 1DEDA 2ZF8A 3GO1L 5HBBA 3TIDB 3BVNA 1TT6A 4U1JA 1I8KB 5D4JA 4HJGA 1MJ7H 1T66C 4IHBA 2F74B 2RTTA 5D72L 2HKHL 3SE4A 4PY8I 3CE1A 5B1JC 1XSOA 3ABKB 4GKNB 4M5ZH 4KZ0A 5CINL 1MW2A 1SXBA 1WEJL 5ACMA 1CDJA 4O02L 5B22A 2VDPH 2C3WA 4KKPA 4ETQB 1KWKA 5SWSE 5IF0B 3MNDA 1PZCA 2HZHA 2D4FA 2P5EB 4WSGA 4XXWC 2IH9A 3FQYA 4I0CC 2VLRA 4NPKA 5EZJB 5FX3A 4RQQB 4WLCA 4ZFFB 2FL5A 2H8PA 5CN3A 4HALA 4WGVB 2Z64C 3TOPA 3E8UH 3MLZL 3AQDA 2KI6A 3CU7A 2W9DH 1RVFH 5D6CB 3T3PF 5MEQA 5HYJA 1QNZL 3ZHLA 4XPAH 3QIWD 1KN2L 4DN3H 2VL4A 2YSSB 1BPLB 4F8OA 2GT9A 1N67A 2BO0A 2WLIB 1FSKB 2DWTA 3GMMB 3HC4L 4MFHA 5FYKE 1OP3H 5CN1A 3IDNA 4J6RH 1XWVA 3CDGA 3V5KB 4XNUH 4YR6A 4YHKH 3QUXC 3LKSA 1R4XA 1SJXA 4OD2B 5GHWL 3X11A 1NGWB 3DVFA 1H9VA 3MUY1 5ERWA 2F5BH 2IBGA 2WXNA 5A16B 4MJIA 3QDHA 5CS7A 4AM0Q 4FQ2H 4GRWH 4LSVL 1W8OA 2ICEC 4WZ9A 2OW6A 5FB8A 1NFDA 5D1ZD 7FABL 3ZKSD 4NZJA 1V55B 3D69B 5HJGA 4LOVA 3LQMA 1JMXA 4G9FA 4IRZL 1SJMA 1KC5H 2WV3A 2FEDD 4O51A 3P77A 3M1BA 5EC1B 2WLZA 2PCFA 3WTWA 3EBAA 4AQZA 3WSQL 4TNFA 4ODTL 1W0VB 3QJFB 3QJUB 4YBQD 1WT5A 4QRRD 4X4XB 1CXIA 4FLRA 4AG4L 2PXYB 2YD0A 5EWIL 1S9WA 3EFFB 4K2UL 1WFJA 3Q9QA 5F88A 1IBYA 1WHOA 2G5BB 4ZFZB 3NN8B 1E7UA 2DQHL 1HQ4A 1LEGA 3P3UA 4HW6A 3BAWA 2DEWX 4I8DA 4LSPL 5EU6E 3WAKA 4NKDA 1ACYH 4FXGC 2G4GA 1P5UC 5EO9A 1WZ1H 3KPOA 4QHLA 3VXNA 1JGLH 2D3LA 2QKIB 2R2BA 5LGJA 1E43A 1L0XA 1NKGA 5EO1B 5F7FA 3BWAA 5FUCE 4UIMA 1IKNA 5MEPB 5BO1H 3U9PH 1H19A 3BFOA 5ICYB 1WV7T 1NDMA 3TJEL 4ESKA 2ZICA 3VFGH 1SN5A 1CCZA 8FABA 2IAMB 2NY4D 4KI1A 4KRMB 1QSVA 1TTCA 1BIHA 4ISVA 5GRZA 3K80A 3R4DA 4Y1AB 1RUMH 2H5UA 2Z7YA 3MNWB 5SWZA 3U2IA 3QQDB 4W9CC 3NAAL 1WQVT 5CIPA 4E41B 2BLFA 4KO7A 5C08A 4P4KC 5IW1A 1KJMB 1T7XA 2ZOOA 2EE6A 4FE9A 1U8CA 1CG9B 1FZMA 1W6LA 2OSYA 3QUGA 4OB5L 4AIEA 4EZMA 1CDCA 2CO4A 3X1NA 1FJ1A 5A2KH 1LD9B 3LB6D 2D0HA 4LPUA 3IDYC 4MAYA 3BAIA 3OL2A 3UAEA 2QSCH 2CHXA 5C1MB 1BP3B 1PLBA 2CDFA 2EZ0C 2QFPA 1UB5A 3QO0A 4JFPA 1L5GA 4PIRF 5D4IA 3BAEL 4JFED 5FC9A 3GGWB 4L4JA 5I1KH 4WUKH 3ZU8A 1T6BX 1BAFH 2F53B 4X9YA 5EHFA 2XACC 4DHLA 3BVTA 5D7LD 3H3PH 3U7WH 1A22B 4BFIB 3CTTA 1QPKA 3DMMC 3DOHA 5CF3A 2X1OA 3FQUB 1CBVH 1XD0A 1XDTT 2YRPA 5LGYA 4CSSA 1XSJA 4YE0A 4XMLL 1SBSH 2IQ9L 2Q5BA 4J23A 2XQBL 4N2EA 3JWOC 4OJFL 4X0KB 1CGSH 5DHVB 3SGDH 2ZWLT 4G8EA 2X4UB 2FDBP 4PRDB 4A1RA 5GGRA 4XWOD 3NA9H 1GYCA 4Y2DD 3M45A 5IJVB 3P4LA 1BJ8A 5E0QA 3RWGB 4NJ9H 1NCNA 4GUPA 3AS3A 1JF6A 1MCNA 3HC3L 4YHYB 1E8WA 2ED8A 5AUMB 4YXHH 3PFQA 4DP4X 5E9NA 2OMUA 4B9IA 1UASA 1D5IL 3GLEA 4H8UA 4U31A 3VNYA 1H5BC 3AG3B 3GXNA 2WOBA 3O8XA 3VD3A 3UJTL 1OO2A 2BNRA 3H3BC 1BOYA 4X9FA 4HLZG 2ESVA 1QSED 4Z9KB 1U58B 5HDOA 4NZFA 2WTRA 4GQQA 4O02A 1WBZB 4P5MB 5HI3D 2Y7QB 5EN3A 3DK2A 1WVZA 4LLWB 4XNQA 1UOWA 5D2LA 5TH2A 4ZUVA 4JZNB 1T1WA 1T0OA 5DHMC 2Y25A 2YXVA 3ZBMA 5GS3A 1UM6L 1HEZA 2FO8A 3CVDA 1G9HA 4GLRH 4M3KB 5J1AB 1B0GA 1I7TB 4NQCA 5FCSH 4W9EC 3DX8A 1H8LA 3FKUS 3AG4B 2WSKA 1OGAD 3IJ7A 2GSIA 2ID5A 3KM2A 5LBVA 3JWDC 4RESB 4XMTA 4UTAH 4DUWA 2V2TA 5FA3B 2F7RA 5DWUL 1PU0A 3PYCA 3RDJA 3QEQA 4RMTA 4BEIA 3QDMD 3BXNB 5D4HA 2ZKMX 4QRPE 2DIAA 3OGCB 1U8QB 4GUQA 2LAGB 5FM5O 4Z7UA 4HC1L 1PDKB 2G75B 3L1EA 5JPNB 5EORL 1QYGL 1JPTL 3VWJA 1TXKA 1CDGA 4ENEC 2WLLA 1FG9C 3LYRA 4UOW0 1CXLA 1JAEA 4EI6B 2BINA 1ZV9A 4NCDA 3N85L 5LB1A 2VDKL 1LO5B 4H1LA 3EFOA 4QT5B 3VI4E 1FL5A 5FYJD 2PWHA 4KH2A 3WNJA 4AQOA 1GRWA 3FRPG 3OAWA 4PU2A 4U6VL 5JMOC 1OAXH 3B56A 4LSSH 4N2FA 4CJ1A 2QQNL 4FQXB 1IEAA 3C60D 4WHTB 3UTTD 1DE4B 3TFKD 4P46B 1TTBA 1N10A 2QPDB 1XX9C 4IRZA 3CPLA 3SDXB 2JB5H 4V1DD 4FQLL 4OQTL 1BQHA 4NQDE 2GTZB 4IBYA 5BQ7B 4KHXL 4TS6A 3TBTA 3MV8D 1CFTA 2GKIA 3EJZC 3FS9A 4O2CB 1N0LA 4HGKC 4JRXB 2K9UA 2Z0UA 4DOHB 5ACLA 3HE6A 1E0OB 4MMYB 4NO0B 3LX9A 3G6DH 4NPJA 4M8UA 2UVFA 4GOSA 1XGRA 1XZ0B 4H13C 5GIRB 4L4TD 4NQEB 1G6RB 3GKWL 1AG0A 3QHTC 3D2TA 4HUNB 2TSBA 5KS9F 1X5AA 3FUMA 3MNZB 4HOWA 1KJ2B 1ZGLB 4OBRA 1A7PL 3CQPA 2ZZUT 3W9DB 1NFKA 1LM8V 3RWHA 3LAFA 1OCRB 2H0PA 4G1EA 4XZUA 1OW0C 5CSGA 4R3SA 3UERA 4KFZC 5D7KE 3C12A 3AROA 1XGUB 4UNVA 2VLJE 1NMAH 1ASOA 3FFCE 4HPOH 5T1JA 4L29B 1PZBA 3B1UA 4FQCH 1M2VB 5E7BA 3SDDB 3WLWC 1R47A 1YNKH 3UABA 1TG8A 2R29H 4P9HC 1N6QL 1FYHB 4ZNEA 1Z9SB 4XHJC 5C07E 4HHWA 3ZY7A 2OXGB 4JDTH 4QYAA 1BYNA 1JS4A 1Y1DA 4IHOA 5JLZA 2BH0A 2X9WA 3LY6A 3PWNB 4KXBA 3GZOA 2WWNA 2YOAA 5ID0B 3NFSH 2WXIA 3SE8L