2JQIA

Nmr structure of the rad53 fha1 domain in complex with a phosphothreonien peptide derived from rad53 scd1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
151
structure length
151
Chain Sequence
ATQRFLIEKFSQEQIGENIVCRVICTTGQIPIRDLSADISQVLKEKRSIKKVWTFGRNPACDYHLGNISRLSNKHFQILLGEDGNLLLNDISTNGTWLNGQKVEKNSNQLLSQGDEITVGVGVESDILSLVIFINDKFKQCLEQNKVDRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diphosphothreonine-specific interaction between an SQ/TQ cluster and an FHA domain in the Rad53-Dun1 kinase cascade.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
molecule keywords Serine/threonine-protein kinase RAD53
total genus 19
structure length 151
sequence length 151
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2007-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 2jqiA00
1LGQA 2PIEA 4D9VA 3I6WA 3VA1A 3PO8A 4H87A 1YJMA 2FF4A 4EGXA 1K3NA 1LGPA 1MZKA 3ELSA 3GQSA 3I0NA 3I6UA 2G1LA 1UHTA 3OUNA 2KFUA 2JKDA 2JPEA 4EJQA 1G3GA 4QCJA 2LC1A 3HUEA 4JONA 1G6GA 3I0MA 1UJXA 1WLNA 2A0TA 1FHRA 1J4LA 2AFFA 5A8IA 1DMZA 1QU5A 2CSWA 1YJ5C 2JQJA 3UMZA 3VPYA 2KB4A 1K2NA 1J4KA 3VA4A 1J4OA 1J4PA 2FEZA 1GXCA 4G2SA 3UN0A 1K3JA 1R21A 3POAA 2KB3A 4A0EA 2JQLA 1K2MA 1WV3A 1K3QA 3KT9A 3ELVA 2BRFA 5DJOA 5E50A 1FHQA 2KKLA 3MDBA 2XT9B 3FM8A 3UNMA 3UOTA 1J4QA 2EH0A 3UV0A 3HUFA 3HX1A 2W3OA 3UNNA 2JQIA
chains in the Genus database with same CATH superfamily
3VA1A 4H87A 1YJMA 2I2CA 4L02A 2I2BA 3GQSA 2P1RA 3OUNA 2JPEA 3AFOA 4QCJA 3HUEA 1UJXA 1WLNA 3UMZA 2I29A 5EJIA 4HAOA 5EJFA 3V8RA 2KB3A 4A0EA 2QV7A 5DJOA 2KKLA 2XT9B 3UOTA 1J2FA 3UV0A 2W3OA 2JQIA 1LGQA 5EJHA 1U7VB 4JIWD 1MJSA 3V7WA 3V7UA 1U0RA 2KFUA 2JKDA 2Q5FA 2XXSA 1G3GA 1KHUA 2BONA 2LC1A 4JONA 1G6GA 1U7FA 3I0MA 2A0TA 1U0TA 1J4LA 2JGRA 1DMZA 1QU5A 2AN1A 4DY6A 3VPYA 1J4KA 1J4OA 5JEOA 1GXCA 5JERA 1WV3A 3VZDA 4V24A 5JEKA 3ELVA 1MR1A 2BRFA 3DITA 2I1WA 3A77A 5E50A 1FHQA 3FM8A 1MK2A 3V8PA 2EH0A 3HUFA 3HX1A 4WRRA 2PIEA 4D9VA 3V80A 2I2FA 5EJGA 3PO8A 1DEVA 5DHQA 1YT5A 1Z0UA 3I0NA 2QVLA 3VZBA 1QWTA 1UHTA 3V8NA 1Y3HA 5DHRA 4JIVD 2I2AA 1Y3IA 1FHRA 5DHTA 5A8IA 5BVIA 1U7FB 1YJ5C 1K2NA 2KB4A 3VA4A 3V8MA 1K3JA 2FEZA 1ZOQA 3UN0A 1DD1A 1U7VA 5JEMA 1KHXA 1K3QA 4WERA 3MDBA 3GMJA 3UNMA 1Z0ZA 3UNNA 1Z0SA 3PFNA 4KU0D 3I6WA 3V7YA 2FF4A 4EGXA 1K3NA 1LGPA 3DSHA 1MZKA 3ELSA 3I6UA 3T5PA 2G1LA 1YGSA 4R9PA 4EJQA 5JEJA 5DHUA 1G88A 5DHPA 5JELA 5C4VA 3V8QA 2AFFA 2I2DA 2CSWA 2JQJA 3VZCA 1J4PA 4G2SA 1SUWA 3S40A 1R21A 3POAA 2JQLA 1K2MA 3KT9A 5DHSA 1J4QA 4A4YA
chains in the Genus database with same CATH topology
3VA1A 4H87A 1YJMA 4L02A 3GQSA 2P1RA 3OUNA 2JPEA 4QCJA 3HUEA 1UJXA 1WLNA 3UMZA 2KB3A 4A0EA 2QV7A 5DJOA 2KKLA 2XT9B 3UOTA 1J2FA 3UV0A 2W3OA 2JQIA 1LGQA 1U7VB 4JIWD 1MJSA 1G3GA 2KFUA 2JKDA 2XXSA 1KHUA 2BONA 2LC1A 4JONA 1G6GA 1U7FA 3I0MA 2A0TA 1J4LA 2JGRA 1DMZA 1QU5A 3VPYA 1J4KA 1J4OA 5JEOA 1GXCA 5JERA 1WV3A 3VZDA 4V24A 5JEKA 3ELVA 1MR1A 2BRFA 3DITA 5E50A 3A77A 1FHQA 3FM8A 1MK2A 2EH0A 3HUFA 3HX1A 4WRRA 2PIEA 4D9VA 3PO8A 1DEVA 3I0NA 2QVLA 3VZBA 1QWTA 1UHTA 4JIVD 1FHRA 5A8IA 5BVIA 1U7FB 1YJ5C 1K2NA 2KB4A 3VA4A 1K3JA 2FEZA 1ZOQA 3UN0A 1DD1A 1U7VA 5JEMA 1KHXA 1K3QA 4WERA 3MDBA 3GMJA 3UNMA 3UNNA 4KU0D 3I6WA 2FF4A 4EGXA 1K3NA 1LGPA 3DSHA 1MZKA 3ELSA 3I6UA 3T5PA 2G1LA 1YGSA 4R9PA 4EJQA 5JEJA 1G88A 5JELA 5C4VA 2AFFA 2CSWA 2JQJA 3VZCA 1J4PA 4G2SA 3S40A 1R21A 3POAA 2JQLA 1K2MA 3KT9A 1J4QA 4A4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LGQ A;  2PIE A;  4D9V A;  3I6W A;  3VA1 A;  3PO8 A;  4H87 A;  1YJM A;  2FF4 A;  4EGX A;  1K3N A;  1LGP A;  1MZK A;  3ELS A;  3GQS A;  3I0N A;  3I6U A;  2G1L A;  1UHT A;  3OUN A;  2KFU A;  2JKD A;  2JPE A;  4EJQ A;  1G3G A;  4QCJ A;  2LC1 A;  3HUE A;  4JON A;  1G6G A;  3I0M A;  1UJX A;  1WLN A;  2A0T A;  1FHR A;  1J4L A;  2AFF A;  5A8I A;  1DMZ A;  1QU5 A;  2CSW A;  1YJ5 C;  2JQJ A;  3UMZ A;  3VPY A;  2KB4 A;  1K2N A;  1J4K A;  3VA4 A;  1J4O A;  1J4P A;  2FEZ A;  1GXC A;  4G2S A;  3UN0 A;  1K3J A;  1R21 A;  3POA A;  2KB3 A;  4A0E A;  2JQL A;  1K2M A;  1WV3 A;  1K3Q A;  3KT9 A;  3ELV A;  2BRF A;  5DJO A;  5E50 A;  1FHQ A;  2KKL A;  3MDB A;  2XT9 B;  3FM8 A;  3UNM A;  3UOT A;  1J4Q A;  2EH0 A;  3UV0 A;  3HUF A;  3HX1 A;  2W3O A;  3UNN A;  2JQI A; 
#chains in the Genus database with same CATH topology
 3VA1 A;  4H87 A;  1YJM A;  2I2C A;  4L02 A;  2I2B A;  3GQS A;  2P1R A;  3OUN A;  2JPE A;  3AFO A;  4QCJ A;  3HUE A;  1UJX A;  1WLN A;  3UMZ A;  2I29 A;  5EJI A;  4HAO A;  5EJF A;  3V8R A;  2KB3 A;  4A0E A;  2QV7 A;  5DJO A;  2KKL A;  2XT9 B;  3UOT A;  1J2F A;  3UV0 A;  2W3O A;  2JQI A;  1LGQ A;  5EJH A;  1U7V B;  4JIW D;  1MJS A;  3V7W A;  3V7U A;  1U0R A;  2KFU A;  2JKD A;  2Q5F A;  2XXS A;  1G3G A;  1KHU A;  2BON A;  2LC1 A;  4JON A;  1G6G A;  1U7F A;  3I0M A;  2A0T A;  1U0T A;  1J4L A;  2JGR A;  1DMZ A;  1QU5 A;  2AN1 A;  4DY6 A;  3VPY A;  1J4K A;  1J4O A;  5JEO A;  1GXC A;  5JER A;  1WV3 A;  3VZD A;  4V24 A;  5JEK A;  3ELV A;  1MR1 A;  2BRF A;  3DIT A;  2I1W A;  3A77 A;  5E50 A;  1FHQ A;  3FM8 A;  1MK2 A;  3V8P A;  2EH0 A;  3HUF A;  3HX1 A;  4WRR A;  2PIE A;  4D9V A;  3V80 A;  2I2F A;  5EJG A;  3PO8 A;  1DEV A;  5DHQ A;  1YT5 A;  1Z0U A;  3I0N A;  2QVL A;  3VZB A;  1QWT A;  1UHT A;  3V8N A;  1Y3H A;  5DHR A;  4JIV D;  2I2A A;  1Y3I A;  1FHR A;  5DHT A;  5A8I A;  5BVI A;  1U7F B;  1YJ5 C;  1K2N A;  2KB4 A;  3VA4 A;  3V8M A;  1K3J A;  2FEZ A;  1ZOQ A;  3UN0 A;  1DD1 A;  1U7V A;  5JEM A;  1KHX A;  1K3Q A;  4WER A;  3MDB A;  3GMJ A;  3UNM A;  1Z0Z A;  3UNN A;  1Z0S A;  3PFN A;  4KU0 D;  3I6W A;  3V7Y A;  2FF4 A;  4EGX A;  1K3N A;  1LGP A;  3DSH A;  1MZK A;  3ELS A;  3I6U A;  3T5P A;  2G1L A;  1YGS A;  4R9P A;  4EJQ A;  5JEJ A;  5DHU A;  1G88 A;  5DHP A;  5JEL A;  5C4V A;  3V8Q A;  2AFF A;  2I2D A;  2CSW A;  2JQJ A;  3VZC A;  1J4P A;  4G2S A;  1SUW A;  3S40 A;  1R21 A;  3POA A;  2JQL A;  1K2M A;  3KT9 A;  5DHS A;  1J4Q A;  4A4Y A; 
#chains in the Genus database with same CATH homology
 3VA1 A;  4H87 A;  1YJM A;  4L02 A;  3GQS A;  2P1R A;  3OUN A;  2JPE A;  4QCJ A;  3HUE A;  1UJX A;  1WLN A;  3UMZ A;  2KB3 A;  4A0E A;  2QV7 A;  5DJO A;  2KKL A;  2XT9 B;  3UOT A;  1J2F A;  3UV0 A;  2W3O A;  2JQI A;  1LGQ A;  1U7V B;  4JIW D;  1MJS A;  1G3G A;  2KFU A;  2JKD A;  2XXS A;  1KHU A;  2BON A;  2LC1 A;  4JON A;  1G6G A;  1U7F A;  3I0M A;  2A0T A;  1J4L A;  2JGR A;  1DMZ A;  1QU5 A;  3VPY A;  1J4K A;  1J4O A;  5JEO A;  1GXC A;  5JER A;  1WV3 A;  3VZD A;  4V24 A;  5JEK A;  3ELV A;  1MR1 A;  2BRF A;  3DIT A;  5E50 A;  3A77 A;  1FHQ A;  3FM8 A;  1MK2 A;  2EH0 A;  3HUF A;  3HX1 A;  4WRR A;  2PIE A;  4D9V A;  3PO8 A;  1DEV A;  3I0N A;  2QVL A;  3VZB A;  1QWT A;  1UHT A;  4JIV D;  1FHR A;  5A8I A;  5BVI A;  1U7F B;  1YJ5 C;  1K2N A;  2KB4 A;  3VA4 A;  1K3J A;  2FEZ A;  1ZOQ A;  3UN0 A;  1DD1 A;  1U7V A;  5JEM A;  1KHX A;  1K3Q A;  4WER A;  3MDB A;  3GMJ A;  3UNM A;  3UNN A;  4KU0 D;  3I6W A;  2FF4 A;  4EGX A;  1K3N A;  1LGP A;  3DSH A;  1MZK A;  3ELS A;  3I6U A;  3T5P A;  2G1L A;  1YGS A;  4R9P A;  4EJQ A;  5JEJ A;  1G88 A;  5JEL A;  5C4V A;  2AFF A;  2CSW A;  2JQJ A;  3VZC A;  1J4P A;  4G2S A;  3S40 A;  1R21 A;  3POA A;  2JQL A;  1K2M A;  3KT9 A;  1J4Q A;  4A4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...