2JQYA

Outer membrane protein g
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
280
structure length
280
Chain Sequence
b'EERNDWHFNIGAMYEIENVEGYGEDMDGLAEPSVYFNAANGPWRIALAYYQEGPVDYSAGKRGTWFDRPELEVHYQFLENDDFSFGLTGGFRNYGYHYVDEPGKDTANMQRWKIAPDWDVKLTDDLRFNGWLSMYKFANDLNTTGYADTRVETETGLQYTFNETVALRVNYYLERGFNMDDSRNNGEFSTQEIRAYLPLTLGNHSVTPYTRIGLDRWSNWDWQDDIEREGHDFNRVGLFYGYDFQNGLSVSLEYAFEWQDHDEGDSDKFHYAGVGVNYSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein G
publication title Structure of outer membrane protein G by solution NMR spectroscopy.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 28
structure length 280
sequence length 280
ec nomenclature
pdb deposition date 2007-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09381 Porin_OmpG Outer membrane protein G (OmpG)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 2jqyA00
4CTDA 2X9KA 2F1CX 2IWWA 4FQEA 2WJQA 2WVPA 2WJRA 2IWVA 2JQYA 4PR7A
chains in the Genus database with same CATH superfamily
3LK3A 3PORA 4RL9A 1GFOA 6PRNA 2PORA 2F1VA 3A0BO 2WVPA 4FSOA 4UB8O 3VE1A 3KZIO 4D5UA 5IYUA 4N59A 2IWVA 3AA7A 3VY9X 2JQYA 4FESA 3HOLA 3POXA 2Y0HA 2R8AA 2LFUA 2R4OA 3AA6B 3SY7A 3DWOX 3QRCA 1E54A 3UU2A 3VZTX 3AAAA 4RJXA 4FUVA 1YS5A 3SY9A 5G38A 3VE2A 2X9KA 4E1TA 2K4TA 5G3AA 3BS0A 3V8UA 5GTIO 5EE2A 1MM4A 2W81C 1ZHWA 4AYDC 1PHOA 4IL6O 2R4PA 2XE1A 3PF1A 3PGSA 3LK3B 4XNKA 2Y2XA 2Y0LA 3K19A 4AKRA 5GV0A 1BXWA 3PGRA 3PQSA 4N74A 3LK42 1GFPA 2XTRA 3AA7B 4GCPA 5G26A 3POUA 4C69X 4E1SA 3T24A 2PRNA 2Y7SA 4AYNA 1HXUA 3A2SX 2KXPA 3G7GA 4CTDA 3BRYA 1T16A 2XMXA 3AAAB 3AAEA 4QQ1A 5G39A 2FGRA 2F1CX 4BUMX 5AFUK 3SYBA 2R88A 2YPVA 2XE2A 3DZMA 4FMSA 4O3XB 4O3YA 1OSMA 5B66O 2JMMA 4K3BA 4U9CA 5DL7A 4N58A 4GHBA 1GFMA 3DWNA 2M06A 1H6S1 1IZNA 4FZMA 2QTKA 3HWBA 4PUXA 2N2MA 3VZUX 3RBHA 4AKRB 3TZGA 2WJRA 5JDPA 3JCUO 3O0EA 3SYSA 3T20A 3SZVA 2R4NA 3HW9A 3LK2A 4FSPA 4G75A 3QRAA 3JTYA 3VY8X 4FQEA 2O4VA 2XG6A 4FOZA 4C4VA 2KXPB 3BRZA 4JFBA 3DA4A 2OMFA 4FZNA 3UAQA 4C00A 2XTQA 4FRTA 3AAEB 1ZHZA 4LSEA 2KZ7A 2MNHA 2YNKA 1BH3A 2ODJA 3EMNX 3AA0A 4G76A 4KR4A 4AKMA 1BT9A 1THQA 2XE5A 5T5FA 4PJ0O 4O3ZA 5AFUL 4AYID 2X27X 4O4UA 1OPFA 4RLCA 1ZHXA 2J4UP 1IZNB 1ZHTA 4AYEC 5E79O 2AXTO 4FRXA 1QJPA 4RLBA 5KAFO 4PR7A 1Q9FA 5DL5A 4K3CA 3WI4A 3LK2B 4XNLA 5B5EO 2MHLA 1G90A 4O4XA 2ERVA 4AUIA 1PRNA 4GCQA 7PRNA 2ZFGA 5D5DA 3T0SA 8PRNA 1S5LO 4C4VB 4JCHA 3AA1A 1P4TA 1HXTA 2FGQX 2KZ7B 3POQA 4GCSA 1T1LA 5PRNA 4Z3TA 3AA0B 2Y0KA 5KAIO 1ZHYA 5DL6A 3WI5A 3GP6A 4GF4A 3FYXA 3HOEA 4KRAA 1MM5A 1QJ8A 2ZLDA 2R4LA 4F4BA 3SZDA 4FZLA 4AYMC 3NJTA 4AFKA 4B61A 1ORMA 3KVDD 2J1NA 1MPFA 2R89A 2WJQA 2M07A 1GFNA 4O3WA 4N75A 2KDYA 2KC0A 4D64A 4LSFA 4RJWA 2GE4A 4O49A 3AA6A 4LSHA 5TISO 5FVNA 3VZWX 4FT6A 3LK41 5H2FO 5ADXL 3C5OA 1QJ9A 4D65A 3NSGA 3AA1B 1Q9GA 4LSIA 2K0LA 5GTHO 2N2LA 2W80C 5ADXK 4KR8A 2LHFA 1HXXA 3A0HO 3PGUA 2XE3A 3DA3A 4UB6O 2IWWA 3UPGA 4AZLA 3PRNA 1GFQA 3PQUA 3WU2O 2F1TA 5DL8A
chains in the Genus database with same CATH topology
4CTDA 2X9KA 2F1CX 2IWWA 4FQEA 2WJQA 2WVPA 2WJRA 2IWVA 2JQYA 4PR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CTD A;  2X9K A;  2F1C X;  2IWW A;  4FQE A;  2WJQ A;  2WVP A;  2WJR A;  2IWV A;  2JQY A;  4PR7 A; 
#chains in the Genus database with same CATH topology
 3LK3 A;  3POR A;  4RL9 A;  1GFO A;  6PRN A;  2POR A;  2F1V A;  3A0B O;  2WVP A;  4FSO A;  4UB8 O;  3VE1 A;  3KZI O;  4D5U A;  5IYU A;  4N59 A;  2IWV A;  3AA7 A;  3VY9 X;  2JQY A;  4FES A;  3HOL A;  3POX A;  2Y0H A;  2R8A A;  2LFU A;  2R4O A;  3AA6 B;  3SY7 A;  3DWO X;  3QRC A;  1E54 A;  3UU2 A;  3VZT X;  3AAA A;  4RJX A;  4FUV A;  1YS5 A;  3SY9 A;  5G38 A;  3VE2 A;  2X9K A;  4E1T A;  2K4T A;  5G3A A;  3BS0 A;  3V8U A;  5GTI O;  5EE2 A;  1MM4 A;  2W81 C;  1ZHW A;  4AYD C;  1PHO A;  4IL6 O;  2R4P A;  2XE1 A;  3PF1 A;  3PGS A;  3LK3 B;  4XNK A;  2Y2X A;  2Y0L A;  3K19 A;  4AKR A;  5GV0 A;  1BXW A;  3PGR A;  3PQS A;  4N74 A;  3LK4 2;  1GFP A;  2XTR A;  3AA7 B;  4GCP A;  5G26 A;  3POU A;  4C69 X;  4E1S A;  3T24 A;  2PRN A;  2Y7S A;  4AYN A;  1HXU A;  3A2S X;  2KXP A;  3G7G A;  4CTD A;  3BRY A;  1T16 A;  2XMX A;  3AAA B;  3AAE A;  4QQ1 A;  5G39 A;  2FGR A;  2F1C X;  4BUM X;  5AFU K;  3SYB A;  2R88 A;  2YPV A;  2XE2 A;  3DZM A;  4FMS A;  4O3X B;  4O3Y A;  1OSM A;  5B66 O;  2JMM A;  4K3B A;  4U9C A;  5DL7 A;  4N58 A;  4GHB A;  1GFM A;  3DWN A;  2M06 A;  1H6S 1;  1IZN A;  4FZM A;  2QTK A;  3HWB A;  4PUX A;  2N2M A;  3VZU X;  3RBH A;  4AKR B;  3TZG A;  2WJR A;  5JDP A;  3JCU O;  3O0E A;  3SYS A;  3T20 A;  3SZV A;  2R4N A;  3HW9 A;  3LK2 A;  4FSP A;  4G75 A;  3QRA A;  3JTY A;  3VY8 X;  4FQE A;  2O4V A;  2XG6 A;  4FOZ A;  4C4V A;  2KXP B;  3BRZ A;  4JFB A;  3DA4 A;  2OMF A;  4FZN A;  3UAQ A;  4C00 A;  2XTQ A;  4FRT A;  3AAE B;  1ZHZ A;  4LSE A;  2KZ7 A;  2MNH A;  2YNK A;  1BH3 A;  2ODJ A;  3EMN X;  3AA0 A;  4G76 A;  4KR4 A;  4AKM A;  1BT9 A;  1THQ A;  2XE5 A;  5T5F A;  4PJ0 O;  4O3Z A;  5AFU L;  4AYI D;  2X27 X;  4O4U A;  1OPF A;  4RLC A;  1ZHX A;  2J4U P;  1IZN B;  1ZHT A;  4AYE C;  5E79 O;  2AXT O;  4FRX A;  1QJP A;  4RLB A;  5KAF O;  4PR7 A;  1Q9F A;  5DL5 A;  4K3C A;  3WI4 A;  3LK2 B;  4XNL A;  5B5E O;  2MHL A;  1G90 A;  4O4X A;  2ERV A;  4AUI A;  1PRN A;  4GCQ A;  7PRN A;  2ZFG A;  5D5D A;  3T0S A;  8PRN A;  1S5L O;  4C4V B;  4JCH A;  3AA1 A;  1P4T A;  1HXT A;  2FGQ X;  2KZ7 B;  3POQ A;  4GCS A;  1T1L A;  5PRN A;  4Z3T A;  3AA0 B;  2Y0K A;  5KAI O;  1ZHY A;  5DL6 A;  3WI5 A;  3GP6 A;  4GF4 A;  3FYX A;  3HOE A;  4KRA A;  1MM5 A;  1QJ8 A;  2ZLD A;  2R4L A;  4F4B A;  3SZD A;  4FZL A;  4AYM C;  3NJT A;  4AFK A;  4B61 A;  1ORM A;  3KVD D;  2J1N A;  1MPF A;  2R89 A;  2WJQ A;  2M07 A;  1GFN A;  4O3W A;  4N75 A;  2KDY A;  2KC0 A;  4D64 A;  4LSF A;  4RJW A;  2GE4 A;  4O49 A;  3AA6 A;  4LSH A;  5TIS O;  5FVN A;  3VZW X;  4FT6 A;  3LK4 1;  5H2F O;  5ADX L;  3C5O A;  1QJ9 A;  4D65 A;  3NSG A;  3AA1 B;  1Q9G A;  4LSI A;  2K0L A;  5GTH O;  2N2L A;  2W80 C;  5ADX K;  4KR8 A;  2LHF A;  1HXX A;  3A0H O;  3PGU A;  2XE3 A;  3DA3 A;  4UB6 O;  2IWW A;  3UPG A;  4AZL A;  3PRN A;  1GFQ A;  3PQU A;  3WU2 O;  2F1T A;  5DL8 A; 
#chains in the Genus database with same CATH homology
 4CTD A;  2X9K A;  2F1C X;  2IWW A;  4FQE A;  2WJQ A;  2WVP A;  2WJR A;  2IWV A;  2JQY A;  4PR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...