2JQYA

Outer membrane protein g
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
280
structure length
280
Chain Sequence
EERNDWHFNIGAMYEIENVEGYGEDMDGLAEPSVYFNAANGPWRIALAYYQEGPVDYSAGKRGTWFDRPELEVHYQFLENDDFSFGLTGGFRNYGYHYVDEPGKDTANMQRWKIAPDWDVKLTDDLRFNGWLSMYKFANDLNTTGYADTRVETETGLQYTFNETVALRVNYYLERGFNMDDSRNNGEFSTQEIRAYLPLTLGNHSVTPYTRIGLDRWSNWDWQDDIEREGHDFNRVGLFYGYDFQNGLSVSLEYAFEWQDHDEGDSDKFHYAGVGVNYSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein G
publication title Structure of outer membrane protein G by solution NMR spectroscopy.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 28
structure length 280
sequence length 280
ec nomenclature
pdb deposition date 2007-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09381 Porin_OmpG Outer membrane protein G (OmpG)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 2jqyA00
2IWWA 2WVPA 2F1CX 2X9KA 4FQEA 4PR7A 2IWVA 4CTDA 2WJRA 2JQYA 2WJQA
chains in the Genus database with same CATH superfamily
2J4UP 2JMMA 2GE4A 2R4OA 4FZNA 2LHFA 4N59A 1ZHZA 2MHLA 4FRXA 4K3CA 4C4VB 1QJ8A 3T20A 2ERVA 3RBHA 5DL7A 3UPGA 5TISO 3WI4A 4D64A 3VZTX 2O4VA 2YPVA 3PRNA 4PUXA 1BT9A 2R4PA 2KZ7A 1PRNA 5AFUK 1OPFA 2N2MA 2PRNA 3BRZA 3POUA 3JCUO 4FMSA 3QRAA 5DL5A 2KZ7B 2F1TA 4AYID 4O3YA 2XE3A 1GFNA 3LK2B 4AZLA 5G3AA 3WU2O 4AFKA 2FGRA 3FYXA 1ORMA 1PHOA 3PGSA 3NSGA 1S5LO 2IWWA 2J1NA 3DA4A 3SYSA 3AA7B 4AYEC 3SY9A 2Y0LA 1E54A 4K3BA 4FRTA 4JFBA 4O3ZA 4D5UA 1GFPA 2JQYA 3AAEA 2R4LA 3AA6A 4JCHA 4N74A 3LK41 5GV0A 3EMNX 3LK3A 3SYBA 2XE5A 4FQEA 4O49A 2ZFGA 3NJTA 4PR7A 2KXPA 5E79O 3AAEB 2N2LA 3AA6B 4FSOA 4RL9A 3SZVA 4GCQA 4N75A 7PRNA 3DA3A 2Y7SA 2WVPA 2KXPB 4O4XA 5GTHO 2WJRA 1GFQA 2KC0A 1ZHYA 1OSMA 3A2SX 3AA1A 4FSPA 3C5OA 1Q9GA 3G7GA 4C69X 4RJXA 1ZHXA 3DZMA 3KVDD 3HWBA 4LSIA 3HOEA 4E1SA 3PQSA 5AFUL 3SZDA 2R89A 3AA1B 4RJWA 2F1VA 4G76A 1ZHTA 5GTIO 1T16A 4AYDC 3UAQA 2XG6A 3KZIO 2M06A 2ZLDA 2F1CX 1HXUA 3AA0A 1MM5A 4O3XB 3VE2A 4AYMC 4U9CA 5PRNA 2KDYA 2XE2A 4LSHA 5DL8A 3BS0A 3DWNA 2R4NA 5JDPA 3AA0B 5DL6A 5G26A 3PQUA 1MM4A 3BRYA 5FVNA 4FT6A 5H2FO 3AAAA 3UU2A 3LK42 2QTKA 1THQA 2Y0KA 2WJQA 3HOLA 5EE2A 1T1LA 4FZLA 4KRAA 4LSEA 4PJ0O 5G39A 2Y0HA 5ADXL 3AAAB 3LK3B 3PF1A 4BUMX 2OMFA 2LFUA 4QQ1A 4IL6O 4KR8A 8PRNA 3PORA 2K4TA 4GF4A 5KAFO 2X27X 3VY9X 4F4BA 1IZNA 1MPFA 4GCPA 4FUVA 5IYUA 2R8AA 1QJ9A 5T5FA 1BH3A 5B66O 5G38A 3VE1A 3A0BO 1IZNB 4GCSA 4XNKA 3GP6A 1H6S1 4C00A 3T0SA 3DWOX 2XTQA 1YS5A 2R88A 2XTRA 4KR4A 4GHBA 4RLCA 5B5EO 4G75A 1Q9FA 4LSFA 1QJPA 2W81C 4N58A 3A0HO 4O3WA 4AYNA 1G90A 3VZUX 2FGQX 4CTDA 2IWVA 2XMXA 3PGRA 4UB6O 2AXTO 2ODJA 4D65A 4FOZA 5D5DA 3V8UA 4UB8O 2MNHA 2X9KA 4RLBA 4XNLA 3VY8X 1GFMA 4FESA 3LK2A 4O4UA 1BXWA 3PGUA 4Z3TA 3QRCA 3HW9A 3O0EA 5KAIO 2YNKA 3VZWX 4AUIA 2XE1A 2Y2XA 3T24A 1HXTA 2W80C 3AA7A 3POQA 4B61A 3JTYA 3SY7A 1GFOA 3POXA 2PORA 6PRNA 4FZMA 1ZHWA 2M07A 4E1TA 4AKRA 1P4TA 3WI5A 2K0LA 4AKMA 3TZGA 3K19A 5ADXK 4AKRB 4C4VA 1HXXA
chains in the Genus database with same CATH topology
2IWWA 2WVPA 2F1CX 2X9KA 4FQEA 4PR7A 2IWVA 4CTDA 2WJRA 2JQYA 2WJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IWW A;  2WVP A;  2F1C X;  2X9K A;  4FQE A;  4PR7 A;  2IWV A;  4CTD A;  2WJR A;  2JQY A;  2WJQ A; 
#chains in the Genus database with same CATH topology
 2J4U P;  2JMM A;  2GE4 A;  2R4O A;  4FZN A;  2LHF A;  4N59 A;  1ZHZ A;  2MHL A;  4FRX A;  4K3C A;  4C4V B;  1QJ8 A;  3T20 A;  2ERV A;  3RBH A;  5DL7 A;  3UPG A;  5TIS O;  3WI4 A;  4D64 A;  3VZT X;  2O4V A;  2YPV A;  3PRN A;  4PUX A;  1BT9 A;  2R4P A;  2KZ7 A;  1PRN A;  5AFU K;  1OPF A;  2N2M A;  2PRN A;  3BRZ A;  3POU A;  3JCU O;  4FMS A;  3QRA A;  5DL5 A;  2KZ7 B;  2F1T A;  4AYI D;  4O3Y A;  2XE3 A;  1GFN A;  3LK2 B;  4AZL A;  5G3A A;  3WU2 O;  4AFK A;  2FGR A;  3FYX A;  1ORM A;  1PHO A;  3PGS A;  3NSG A;  1S5L O;  2IWW A;  2J1N A;  3DA4 A;  3SYS A;  3AA7 B;  4AYE C;  3SY9 A;  2Y0L A;  1E54 A;  4K3B A;  4FRT A;  4JFB A;  4O3Z A;  4D5U A;  1GFP A;  2JQY A;  3AAE A;  2R4L A;  3AA6 A;  4JCH A;  4N74 A;  3LK4 1;  5GV0 A;  3EMN X;  3LK3 A;  3SYB A;  2XE5 A;  4FQE A;  4O49 A;  2ZFG A;  3NJT A;  4PR7 A;  2KXP A;  5E79 O;  3AAE B;  2N2L A;  3AA6 B;  4FSO A;  4RL9 A;  3SZV A;  4GCQ A;  4N75 A;  7PRN A;  3DA3 A;  2Y7S A;  2WVP A;  2KXP B;  4O4X A;  5GTH O;  2WJR A;  1GFQ A;  2KC0 A;  1ZHY A;  1OSM A;  3A2S X;  3AA1 A;  4FSP A;  3C5O A;  1Q9G A;  3G7G A;  4C69 X;  4RJX A;  1ZHX A;  3DZM A;  3KVD D;  3HWB A;  4LSI A;  3HOE A;  4E1S A;  3PQS A;  5AFU L;  3SZD A;  2R89 A;  3AA1 B;  4RJW A;  2F1V A;  4G76 A;  1ZHT A;  5GTI O;  1T16 A;  4AYD C;  3UAQ A;  2XG6 A;  3KZI O;  2M06 A;  2ZLD A;  2F1C X;  1HXU A;  3AA0 A;  1MM5 A;  4O3X B;  3VE2 A;  4AYM C;  4U9C A;  5PRN A;  2KDY A;  2XE2 A;  4LSH A;  5DL8 A;  3BS0 A;  3DWN A;  2R4N A;  5JDP A;  3AA0 B;  5DL6 A;  5G26 A;  3PQU A;  1MM4 A;  3BRY A;  5FVN A;  4FT6 A;  5H2F O;  3AAA A;  3UU2 A;  3LK4 2;  2QTK A;  1THQ A;  2Y0K A;  2WJQ A;  3HOL A;  5EE2 A;  1T1L A;  4FZL A;  4KRA A;  4LSE A;  4PJ0 O;  5G39 A;  2Y0H A;  5ADX L;  3AAA B;  3LK3 B;  3PF1 A;  4BUM X;  2OMF A;  2LFU A;  4QQ1 A;  4IL6 O;  4KR8 A;  8PRN A;  3POR A;  2K4T A;  4GF4 A;  5KAF O;  2X27 X;  3VY9 X;  4F4B A;  1IZN A;  1MPF A;  4GCP A;  4FUV A;  5IYU A;  2R8A A;  1QJ9 A;  5T5F A;  1BH3 A;  5B66 O;  5G38 A;  3VE1 A;  3A0B O;  1IZN B;  4GCS A;  4XNK A;  3GP6 A;  1H6S 1;  4C00 A;  3T0S A;  3DWO X;  2XTQ A;  1YS5 A;  2R88 A;  2XTR A;  4KR4 A;  4GHB A;  4RLC A;  5B5E O;  4G75 A;  1Q9F A;  4LSF A;  1QJP A;  2W81 C;  4N58 A;  3A0H O;  4O3W A;  4AYN A;  1G90 A;  3VZU X;  2FGQ X;  4CTD A;  2IWV A;  2XMX A;  3PGR A;  4UB6 O;  2AXT O;  2ODJ A;  4D65 A;  4FOZ A;  5D5D A;  3V8U A;  4UB8 O;  2MNH A;  2X9K A;  4RLB A;  4XNL A;  3VY8 X;  1GFM A;  4FES A;  3LK2 A;  4O4U A;  1BXW A;  3PGU A;  4Z3T A;  3QRC A;  3HW9 A;  3O0E A;  5KAI O;  2YNK A;  3VZW X;  4AUI A;  2XE1 A;  2Y2X A;  3T24 A;  1HXT A;  2W80 C;  3AA7 A;  3POQ A;  4B61 A;  3JTY A;  3SY7 A;  1GFO A;  3POX A;  2POR A;  6PRN A;  4FZM A;  1ZHW A;  2M07 A;  4E1T A;  4AKR A;  1P4T A;  3WI5 A;  2K0L A;  4AKM A;  3TZG A;  3K19 A;  5ADX K;  4AKR B;  4C4V A;  1HXX A; 
#chains in the Genus database with same CATH homology
 2IWW A;  2WVP A;  2F1C X;  2X9K A;  4FQE A;  4PR7 A;  2IWV A;  4CTD A;  2WJR A;  2JQY A;  2WJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...