2JQZA

Solution structure of the c2 domain of human smurf2
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
131
structure length
131
Chain Sequence
b'GPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPKWNQHYDLYIGKSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKLGPNDNDTVRGQIVVSLQSRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase SMURF2
publication title Autoinhibition of the HECT-Type Ubiquitin Ligase Smurf2 through Its C2 Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 17
structure length 131
sequence length 131
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2007-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2jqzA00
5H4YA 2B3RA 1UGKA 3APCA 1K5WA 4WWPA 4MJJA 3APDA 4L1LA 4AOFA 3QARA 4ANXA 4KITB 3FBKA 2UZPA 5CCJA 2FJUB 5JHAA 3R7RA 3NZSA 3QR0A 4BFRA 2ENQA 2K45A 4AJWA 2ENPA 2EP6A 2NSQA 1UOVA 4GNKB 4XE0A 5KJ7E 1E7UA 2WXJA 4KZ0A 3L9BA 4FA6A 2WXHA 1DJHA 2WXLA 2BWQA 1BDYA 4ANUA 3CSFA 2ENJA 4L23A 2WXFA 4FADA 4F93B 3DBSA 3ZVVA 4EZLA 4F1SA 4PS3A 3SD5A 4TUUA 3MJWA 3L08A 1E8WA 3ML8A 2A4ZA 4URKA 3FDWA 3QJZA 4KZCA 1E7VA 1DJGA 4PS7A 4G11A 4HLEA 2ISDA 3PRZA 3F01A 1DSYA 3HIZA 3M7FB 2K8MA 3PREA 3N5AA 4DNLA 5T8IA 2CM5A 2WXOA 2WXRA 4XZ4A 2WXMA 2V4LA 3OAWA 4Y1TA 3TJPA 4WEEA 5G2NA 2CJTA 1QASA 1E90A 2NCEA 4ICWA 1DJYA 2WXGA 3W57A 4FHJA 2D8KA 2KI6A 2X38A 2Y3AA 2A5UA 2JQZA 4ICXA 4IQHA 4LT7A 4OVVA 3TL5A 2WXPA 3F05A 1E8XA 3NSJA 4JPSA 4PS8A 2Q3XA 2CHDA 3L17A 2QZQA 3NZUA 3OHMB 3PFQA 2CM6A 4FJZA 4LCVA 3KWTA 4J6IA 4HVBA 3T8MA 1CJYA 3ENEA 4F91B 3IBEA 2YRBA 1RSYA 1DQVA 2CHXA 4WAFA 4L2YA 4FJYA 1YRKA 1TJMA 2NQ3A 5G55A 2CHZA 1DJIA 4GB9A 4F92B 1DJXA 1E8YA 4XX5A 2N1TE 2WXQA 3QK0A 3TWYA 4QJ3B 3F00A 1WFMA 4FHKA 2Q0ZX 1W16A 3RDJA 2LHAA 2Z0UA 3HN8A 4FLHA 4BGDA 1W15A 3PS6A 1DJZA 2YOAA 4NS0A 1TJXA 4QJ4B 5CCHE 1A25A 1BYNA 1DJWA 4Y1SA 4DK5A 3ZIMA 2K4AA 3LJ3A 4NPJA 3F04A 1WFJA 3HHMA 3QAQA 1RH8A 3IM1A 3L13A 3R7QA 4EZKA 4TS6A 1E8ZA 4IHBA 3W56A 3CSTA 2QZ5A 2WXKA 4TV3A 1HE8A 2CHWA 5H4ZA 3ML9A 3GPEA 3L54A 4LDCA 4WWOA 3S2AA 4QAMB 3RPBA 1BCIA 5JHBA 3JZYA 2DMHA 1GMIA 2RD0A 2ZKMX 3QR1A 4A55A 1V27A 3DPDA 4L1BA 4WWNA 4OVUA 4ANVA 2FK9A 3PYCA 3B7YA 2CJSA 4NP9A 3KWUA 4ANWA 4V11A 4QJ5B 4EZJA 5EDSA 3L4CA 1UOWA 3APFA 1RLWA 2DMGA 5CCGE 4FULA 2WXIA 3L16A 2K3HA 3ZW3A 4NPKA 2R83A 2WXNA 1QATA 3P2BA
chains in the Genus database with same CATH superfamily
1H5BA 3I75A 1ZANH 4CMMB 1AXTH 4N8VA 3L7EA 1UOLA 3GNMH 1Y18A 1WH0A 3ULAB 3PABB 3VO0A 1HYSD 4IBQA 3O2VH 1SBBA 2J57A 2R0KL 4IGBB 5ES4B 5I66A 4QRPA 2PTTB 2L3BA 4J3XA 2QQNL 5FUOL 1F3JA 4P2RD 3MSPA 5JHDD 4DQOH 5FUCE 2OMVA 4N0FA 4HETA 4L5FE 3HRZB 1P53A 3FK3A 4PVLA 3SQOL 1A6AA 5AUMB 3VWKC 3OSKA 1G9HA 3DURA 2W0FB 1PZ5B 4LLUA 3O6LH 2GG1A 3LNIA 2FB4H 1G7IA 1UD6A 2J6EA 1BQLH 2CGRH 2KQMA 1UWEL 1UASA 1P0SE 3LCYA 1I1AC 1YC8A 3ESOA 4AIXA 2Y3NA 4JDTH 4HH9B 5SX5H 5J06A 1RHHB 1OAUL 3R19A 3IDJA 4P5TD 1DQLL 3AS1A 1GA2A 2FJFB 4ONFL 1X5JA 2D8KA 3O3BB 3HS0B 1T7ZA 1WBYB 3CG8A 1Y1UA 4N2DA 3DX8B 4G8GB 4WUKL 1F90L 4DEWA 5HDBE 4FFWD 1WISA 4BZ2A 1BVNT 4LCVA 1I9JL 4YHIA 2ZPKH 2I24N 3UG4A 4I48B 1VIWA 3CK0H 3O2DA 3VWJD 4MZRA 4BFFA 5CWSA 5FUOH 2WWKO 3M07A 3MC0A 4XRCB 2V6HA 4LXFA 3RVVD 3W0WA 3OXSA 3CQFA 4ABUA 5C0AA 1R19A 4KO7A 1A7RH 5MEOB 1KXTA 1J87A 4P23D 4QJ3B 5T3XH 1S7RB 3C5SB 5ALBH 2F74B 4JRXA 5E4OA 1R33A 1KIQA 2MEJB 4UAOC 1SXNA 1YMHA 2OMZA 1XGUA 6TAAA 2OTUB 2EEFA 4MD0B 1PNDA 1VCAA 3FTGB 4XBEH 2PW2B 1NFIA 1X5GA 4IM8A 1QWHA 3EBHA 4XT1C 3KDPB 1DQLH 2WNWA 1CD0A 1MFNA 3CV5A 4FQXD 4BFNA 4EUPG 1BJMA 1U8IA 2BOBB 2HTKC 2Z6FA 4WUKH 4FQHA 4N5ED 1F90H 3J2PA 2FLMA 3VYNA 1BXXA 3IDYB 3MJ8A 1I1FB 3KAAA 3T09A 4RH4A 4G7YH 1ND0B 1TTBA 5DJAB 5GGUB 4QXTB 4KUCF 3FMGH 4HCRL 5LHDA 1T1XB 1VKXA 1FCCA 5EF2A 2X9YA 1F42A 4ZUSB 2A6IB 4K7FA 2KLRA 3ARDB 3KWXA 4WUUD 3C6LA 4FYTA 3ARZA 3N40P 2F7RA 2PPDA 4RDBA 5GS1C 2P5WB 3OKDB 3VGGA 4X5QA 4MFHA 3RWGA 1MFEL 2ZG3A 4NNYA 5CGMA 4QHUA 5IEKA 4ZG1A 2QEJA 3O0LA 3AQDA 5D7LD 3FUNA 4LOFA 4MZ3A 2XIBA 2G3XA 1XF2B 4PRPA 1IC1A 4WO4D 2K45A 1KB9J 3EYQC 4H0IA 2Y1VA 4AQ1B 2R56L 2NQDA 3HI6H 2YPVL 4JKMA 4CMHC 1U6AH 1DL7L 3WY2A 3TV3L 2IFGA 4HCRH 4Z8FH 1YMMB 4GYBA 5ETUA 5IR1B 5I6LA 3D2UA 2ISDA 4ENED 3NN8B 1HX0A 2OI9B 4P2OD 2I5YL 4HJ0D 1QLEL 2NY2B 1P4LB 3BIAX 1BPVA 4ALAL 1IBDA 3FU3A 3MNVA 3EFFA 1FO0B 1I7ZB 2DMBA 1OW0A 3MRLA 4E9YA 4ELMA 4PCTA 5HY9B 1RZ7L 1FJ1A 1X6NA 4HVBA 1N59B 3KHOA 3IETA 4QLRA 2BNRB 3B9KB 3Q01A 2ZSVA 1M2VB 2O6EA 3GMLB 2RQ8A 5J12B 4TQEL 4N0YL 1E5AA 2XICA 5GRJH 3VXME 1BEXA 2YPVH 4O2CB 3WTVA 1CI5A 1T1YB 1GW0A 4O51B 5F1IB 5ACZB 1FYTB 3KEDA 3TV3H 3TO2B 1VESA 5C0BA 3ARED 4CSTA 3CHXA 4GBXC 5L8JB 5D2LF 2VDKL 4RA3A 4HUXB 1YQ2A 5C97A 3LRSB 5AW8B 1HN1A 1OT1A 1VFOA 2EH7L 1U8OB 3L13A 1KV3A 1ASQA 2YBGA 3UYOD 3P73A 2ZOLA 3IGUA 4APQD 5J57B 3CZJA 3EJYD 4PTTA 4PGCA 1RZ7H 2J4WL 1GYUA 4EI6B 3DO3A 5BRQA 2DI9A 2BSBA 4M1DL 4N1CA 4Q2ZB 4NBYB 5FAAA 1N0LB 3SODB 3DXAE 2WJ7A 4TQEH 4RQQB 3WFZA 1BMZA 5BV7B 2OMWA 3B7UX 3BGFC 4IRSD 5J1SC 5C3LD 3IDNA 3CPUA 3HG4A 3QWRA 2FO4B 1F2QA 4I9XA 4Z3TA 3WFBL 1XBDA 3GM8A 4FFZA 3DX0A 5KVFE 1UZGA 2A9BA 2UZXA 3TNMB 4JM2A 4XAKE 3S96A 1RIHH 5IOPB 5E6UB 2GKIA 1F11A 3MCLH 2EE0A 1QZ1A 1K4CA 5B4MD 1S4IA 3NPSB 2BNQA 1QD0A 1XAUA 2EH7H 2J6EH 2XKNB 1KBBA 2VDRB 3EO1A 2V2WA 3M45A 4K71C 4KJYA 1YNLH 5EZPA 1FFPB 1IGIL 4JFQB 2R59A 4XE0A 5KJ7E 5IROC 7TAAA 2K6WA 1BFVH 1JNHB 3KD4A 4RGNE 2CUHA 3KH4A 1MQ8A 1S7SA 3BPCB 2WANA 1W0VA 3HI5H 4F27A 2WIIB 1P4UA 1L0YA 3HUJF 2P47B 4M1DH 3VJ6A 9CGTA 2YKLL 1XSJA 5DFVD 3TO4C 1KB5B 1QSFA 4IOFC 5CFAA 3GXNA 2QADB 1E9OA 1RK0A 3UYPB 4BZ2H 5IIEA 1G0XA 3KYOA 2PCXA 3GMRA 1P4IH 3GI9L 3WFBH 1A7PL 1B0GB 1OOWA 2Z91B 4TN9A 5D1XD 3BVWA 4JUTA 3J07A 1G0DA 3IEAA 1J0JA 1L7IL 4IHOB 5FW7A 4NN7C 4B6ZA 1S9XB 4KY1H 3L4WA 4U1GB 1ZE3H 3MUY1 4IW4C 3QUZD 1RSYA 1IBZA 4GQ9L 1HYRC 1KXHA 2IOOA 3TZVD 3ARFB 2BNUB 4R2GB 3STLA 4N1EA 4D7PA 4GSRA 2GJZB 1Z9PA 4NPYB 2XV0A 4AMKH 2YKLH 4OZIE 4FLHA 5IB4A 1TPXB 1DJZA 4NS0A 1IFHH 3WCYA 3ZHLA 1Z5LB 1PKQA 3C2AL 3MV8E 4PTUA 4NO3A 4FP8L 4YHZH 3GHBH 4GKOA 1XGZA 4AYMC 3QNXA 1ZVNA 4AX3A 4BK4A 3IMVA 1T1ZB 5F93C 1XEDA 4A2GA 5B3SB 3W9DA 3QDGB 4Y5VB 1JTTA 1Q90A 3MV9A 2H32A 4EIUA 2V5SA 5EUOA 5AL0A 2VLJD 2JI2A 2VM4A 2FJGA 2NY4D 2VKWA 5FB8A 2X4RB 4G8FA 1A7QL 4D0DA 4OCNC 3PYCA 4PJ9A 2FL5A 5ITBL 1NICA 5CAYB 3TCXA 3MOQA 1ZGLA 4P5SA 3OR7A 1NPNA 4F57H 3BKML 5DRNB 1IUZA 3V0JA 3VI4B 4BBWA 3QJFA 2OP4H 3H6JA 3GUTB 3WNPA 3MJ9A 1G9EA 2IGLA 4F33A 4LKCB 5E1AA 2HJKB 4BFGA 1J18A 1OP5H 4ZBJA 5H4YA 4XCFH 3C2AH 2DKMA 2ZOUA 4X4KA 2PYEE 5IK3B 1KZQA 2EVHA 3UIYA 1LDPL 2F5BL 3VRLF 3FSVA 1VACB 2EC9U 2ZXDA 2FLRT 1HOCB 2YD1A 3UIZA 3HE6D 4PGZA 4QHLB 3T0EE 2X70A 2ZD0A 4ZMQA 3AT8A 2FJHB 3EH4B 3KXFE 2WXFA 4R4BB 4LESA 4NZJA 4PRHA 3UJJH 2WP3O 2VISB 3IU4L 5TDNB 1BAWA 1RZFH 1MHCB 3FRPG 5EHFA 1S7XB 1UXLA 1W0WB 3VQ1C 4A7TA 4IGBA 1AS6A 1SM3L 2PTTA 5HVWA 2VB5A 3LPFA 4M4RB 1JZ5A 4BFEA 1MOEA 4GEJA 3DGDA 3QWOB 4DUXA 1H6TA 1IM3B 1MLBA 4D7BA 3K1DA 5AUMA 4IQHA 4GG6A 1N70A 5DMKB 4UTAL 2W0FA 3QEHA 4CL7A 5DUBA 3KVPA 3VWKB 3MRQB 4KROD 3AVEA 2HMID 4HH9A 3ARPA 2GJPA 2JKRM 3S7GA 5GS0L 2JTDA 1W9XA 4CADA 4BZ1L 1I1AB 4PJIE 4M43H 2A0LC 4L9LC 5C0RL 3NFNB 3E8VA 2XTLA 3HS0A 1MCIA 1WBYA 3RHWF 4BGDA 1DFBL 3DX8A 2X7LB 5I6NA 1HHKA 3VRJB 4XCEA 3SE8L 4RSVA 3Q6FB 2UXTA 3FHEA 1SM3H 2WTRB 1JRHI 4I48A 2CPCA 4YBLC 3SGEH 1WBZB 2JCCE 1WGVA 4LKXB 4Q0XL 3VU2A 5KSAD 3UG3A 4PD4J 5MEOA 3T2PA 2AK4B 4UTAH 5I0XA 4F8LA 1GS7A 2WSKA 2PP8A 3WEXA 2GAZB 2GSMB 2RD0A 5AVWB 1EVUA 5C0NC 3BVTA 4OLWH 3C5ZD 4YLCA 1XGQB 4EIBA 2YMOA 3CVBA 4N9OB 4UMSA 1Z3GH 3PWUB 2PW2A 4WWID 3U48A 4HG4K 1CDCA 1SEQL 4UAOB 4ALAC 2P8MB 4BZ1H 2NYKA 1R3JA 1XT5A 2XA3A 2HVKB 1GCFA 1GCYA 2BOBA 3U9PL 1KLUA 1DFBH 2VH5H 1WA0X 1PJ9A 5HP5A 1PNCA 2AAAA 5DJ6B 3IKCA 4I2XB 4J3OC 3FQUB 4MJ5B 1HS6A 4NP4L 4BK5A 2VLRD 4OFIA 4JO2L 1CZ8L 1H8NA 1QWNA 4PWKA 1OV8A 2CQVA 4ZUSA 1CK0H 1BFOA 3Q6GH 3PAYA 3ARDA 2VR8A 2RCSH 1PKOA 2Q8BH 5ANHA 2VLKE 2M83A 4GAJL 4XN7A 2CO1A 3OKDA 3VB8A 3IE4A 4B50A 2F19L 1HXMA 3FT4A 3MJWA 5D9SB 4J3WA 2X12A 4LOUC 1J0IA 1WWAX 2MRYA 4U1LB 1BG1A 4ELMF 4ZMYA 5GS1B 1U8QA 1XF2A 1NWOA 1ASPA 3MLRL 4TVPE 3LZPA 4UV7L 4H26B 3A6BH 3QUML 2CNYA 2NY3D 2FQGA 2GJRA 3UMNA 3MX0A 2VLMD 4NUQA 2VKXA 4NO0B 5T33H 4AQ1A 2JKNA 4QPEA 1PIGA 2N56A 5JXEC 5CS7A 4YGAB 1HHJB 3JWNH 2NXZD 4U3HA 4UV4L 1UXWB 3TCLB 4NP4H 4EIZC 2WOYA 3FCSB 1YMMA 4JO2H 1CZ8H 4RMSA 3BP4A 1H8SA 2CDGB 5I8EB 2GIMA 1Z5HA 32C2A 3NACL 3RJDA 2AERT 4FI6A 1CT8B 1TQCC 4GAJH 2X53A 4IEFA 4NQDD 3PWPD 2F19H 2XYBA 2HFGH 1I7ZA 3PG2A 3RIAF 3ZN6A 4FHKA 1IGMH 1W16A 4JPWH 4R7DB 1BZ9B 2W60B 4V33A 4D9LL 2UXGA 2FT7A 5FYKE 4HIJB 3PJSA 1M7UA 2AXGA 1ZTXH 4GXFA 2BNRA 2OYMA 2G60L 4JQVA 4MQXD 4XMXA 1M2VA 1ZE3C 3QUMH 3P40A 3GMLA 3QO1B 1QFHA 4U31A 1JK9B 2ZOKA 4GRWH 2X2HA 3O11A 3JZ7A 4O2CA 1T1YA 3N40F 4W6WB 5ACZA 2EIKB 1ZEAH 4O51A 2NY6D 3KYKL 1FYTA 5F1IA 3IFOB 3HBGA 3TO2A 2VN3A 1NPJA 3FB7A 2DQEL 3T04D 1AGCB 3QRBA 2ZKMX 1HINL 2QFRA 1KT2B 1OGAD 3O6FC 4HUXA 4PV8B 4AMWA 3H9HB 5AKVA 3WAJA 2D0FA 2LAGB 4MYWB 4UOW0 1FA4A 1BQHB 1H8OA 4MAUH 5DLMH 4OLEA 4HXBL 3WFEL 2EDQA 4JEGB 4WHDA 3ELAT 1ZWIB 4M6NH 4X0KA 2UZIL 3HHSB 3ZJAA 4ZAKD 4M61B 3RTQD 5A16B 1YAIA 1OLLA 4EI6A 1FG2B 2NW3B 2OXGB 4Q2ZA 3ASNB 3AWFA 1N0LA 1DVUA 2M2DA 1WE5A 1ZHLA 5IZ7A 3V8CA 2N3JA 2Q87A 4U6TA 3HVNA 3KYKH 1FGVH 1GGYA 1YEIL 3BGFB 4L23A 5DT1L 5IHUL 2DBLH 4N2OA 1HINH 3ESUF 2D31B 2X87A 1RZJL 3OB0H 4XN5A 4Z7WE 3TNMA 4PJXE 3BN3B 4K5MA 1S6NA 5EC2A 5C92A 2AHIA 5CFHA 3RWDA 4JZJC 2ATPB 4GAYB 3ASWA 4F7CB 5DJ8A 3PREA 1QTPA 1FFPA 2OMXB 4JFQA 4RFOL 3WFEH 3S37X 2QVTA 3U36B 2D7QA 3QYCA 1X7TA 4F2EA 4L29A 5D1ZD 1CFVL 1HIML 2L7QA 2P5EB 1SFHA 2PP7A 2W5PA 4YDJB 2R8SH 2UX7A 3UYPA 2WQRA 5DSCB 2XXGA 3FQ2A 3ZQ9A 4X6BB 2ZXGA 2BZDA 1NEZG 4PJHB 3U2SB 3TO4B 1AVAA 1EFXB 5FGBA 3KLDA 5DZ9A 1QZNA 1RPUA 5I8CB 1B0GA 1TYRA 2Z91A 3G9AB 1PPIA 4X50A 3RKDC 4XX5A 5FO8B 2K6YA 5IHUH 5JHMA 1SGKA 3QG7H 5A6LA 4BH7B 2HKFL 1RZJH 3NJGA 4YHYC 3K3QA 1Q4NX 1S9XA 4NGHH 3RURA 3EDFA 1E9PB 3SJVD 4JNXA 3QQ3B 5EUOF 1XD0A 1S8DB 3A4EA 3ZDYB 4EF3A 3OKLA 4G80B 3TU6A 3H42L 4NN7B 1M57B 3FCGA 3ZE0E 2NT0A 3QAQA 4QOKD 3R7QA 2NLJA 4Z0XB 3MRBB 4IBTA 3D0LA 4ZTOH 3NJHA 1WIUA 2WKLA 4NZRL 4C47A 2J8UF 1VZIA 1DQMH 2ZSWA 1W0YT 3ROLB 5EH1A 1PSKH 2NNCA 3LKSA 5DHYB 1KGIA 4GIOA 1ZLVH 2JB6A 3FOMB 1VHPA 1Z5LA 5SWZB 3RYMA 4I3SL 2PCFB 3CJJA 1HCYA 4J39A 3V0GA 3POHA 4BKLB 2NNRA 5KYXA 4XGZB 1Z3RA 5EBGA 1CS6A 2ODHA 3D48R 5EMYA 3V0VB 4B9JA 2FEDC 2HKFH 2XOTA 4OBRA 2QPEB 3D18B 2YPLA 3QDGA 4Y5VA 3UTOA 4AT6B 5I2IB 3N6YA 1RFDL 1GJIA 3ZY7A 1X9RA 5I0WA 1HXYA 3SDDD 3UTZB 4OUUA 4Y4HA 5KVMC 5F9AC 2X4RA 3H42H 1KCWA 3I6GA 2VRQA 1IJ9A 4BSVB 4E0RB 4HZ1A 5ESQB 4ECNA 4B95C 4Z23A 4XOBA 5JPMC 1UOVA 1NDMA 5DRNA 5GS0C 4KXZI 3VI4A 2HT2C 3WLWD 3GUTA 4LLVB 2QTVA 2JLLA 4LKCA 2HJKA 2K9UA 3ET9F 3UTSB 4N2FA 4EO5A 4NI3A 5GZND 1B9ZA 1ADQA 3DYOA 4XPBL 4I3SH 4GG6F 1OD9A 5IK3A 3TFBA 5DJDB 1E3ZA 3KLAA 4RMWA 4ADJA 1EMTL 3VW3L 5JZ7C 4MXQD 3B3IA 4FA7B 4QHLA 5AAWA 5LUMA 1BHGA 1ZLWK 3DIFB 4UT7L 4POYA 3SDCA 1U4EA 1S9YB 5EN2B 4JVWA 4R4BA 2GCYB 4QRBA 4E9WA 3G3LA 5IVNA 2VISA 1INDL 3SCMD 4XVJL 1N26A 2UZYB 1VRSA 5AB9A 3EH2A 2A4CA 3N42F 3QCVH 1F3RB 1A1MB 1D9KC 1FVEA 2ZAGA 3RFZA 1XIWD 5D7KE 2YAOA 1L6PA 3B6SB 1M42A 1YRKA 1HILA 2FRGP 3PJLA 4AIZB 1WAPA 2XTJD 1TEYA 2VITB 3QWQB 4WI0B 4TNWF 5EG6C 2HG5B 2LV4A 5IQ9B 5EF3A 2H2SC 5T1DH 2WAQA 2OW7A 1MVYA 1EMTH 3BZDA 3U83A 3STBA 3VWKA 3VNYA 5HXMA 5MHSE 4PJBB 2M1KA 3CVHA 2WYHA 3LS5H 5DTFB 3SPJA 1PG7W 1IAIL 2P24B 2BVOB 1TQSA 4JCMA 4KKAC 4V2BA 2FCBA 3HLAA 4ONHA 2WZPD 3ME0B 4Z7NE 1O7DC 2R2CA 3NFNA 1INDH 3IDMB 1Q9OB 2HSIA 3AS0A 3BCDA 2KLSA 3ATDA 1T6VN 3CFTA 3LXUX 5LBSH 3K6DA 2HB0A 1DN2A 3HZMB 4L9LB 4JM4L 3DVIA 4PJFB 4U1NB 3U4KA 3WBDA 2WTRA 5JPNC 1NC2D 2WLLB 3PGDA 4X5LA 2MWCA 1MAJA 4QTHB 5EDSA 1JZDC 4KNTA 4ZUWB 3LNHA 4YBLB 5GJSL 3DJRA 4D3CL 2WCPA 4XVTL 3WIIL 2AK4A 1KCVH 4PR5A 4P2QA 3P0VL 4DH2A 3T6ZA 2LTQC 3MV11 1K5WA 1G7HB 2Y7QB 3HN3A 1A47A 3C09C 5KJ4A 1DE4A 5TF1L 3SYPA 1XGQA 3QFDA 4TSCH 3L2LA 1S3KH 5J1AB 1SEBB 2DQCL 5FYJL 1OAKH 2BP8A 4HC1A 1FLTX 2P8MA 3NIGF 2WXJA 3KPSA 4JO5A 2HVKA 4MAYD 1KJ2L 4O00A 5IHLB 4GW1A 3LN4A 2WSDA 3IT8D 5ISZA 4UDTB 1IKFL 2FX9H 1YN6B 1QLEB 4XAWH 2H0JA 4D9RD 3NJFA 5KWYC 1XHHA 2BO0A 1EEZB 3T3PE 1LQBC 3MOBH 4HXAL 3QA3B 4CU8A 4MJ5A 3B8YA 4I2XA 3FQUA 5LJYH 2VZTA 1NAMH 2EECA 5L4FA 1BOGA 2Q3ZA 3HIZA 5D71H 2TSAA 3QW9A 1LQSR 3MRFB 2EICA 3QQ9D 4XVTH 2QMJA 3WIIH 1H3XA 4NCC1 2ZONA 3LKQA 4M6AA 3GIVA 1QASA 3E3QE 4GI9A 4M1CD 4OT1L 3EJQA 2UY6B 1FFTB 3UTTD 3AMKA 4FQ2L 2W0PA 4PVMA 5TF1H 2GJ6E 5D9SA 5M95B 2OA9A 5IJCC 4I9WD 4DN3L 2DQCH 3UH8A 5SWSD 1W8EA 5EDXA 5JHLL 1KBGL 4H26A 2PN5A 2CBOA 1IBFA 4HJIA 5EZIH 4KO9A 3Q8AA 4ODWA 2DQHH 4XNUH 2VDKB 5E2JA 2MJWA 4PRIE 2WBJD 1IKFH 2O61A 2GTWB 1EDHA 1HHJA 1TT6A 4PJ5A 5DURB 1UXWA 3PF2A 5BVPL 3NTCL 3FF7A 3FCSA 3HE7B 1HYSC 5E2UL 4F80A 5DHMC 4U1IB 2CDGA 5I8EA 3V4PA 4ZW8A 3ROOA 3HG1A 3ZYOA 3UTPE 3KPTA 1ZT1B 4XOCA 5F96L 4BQ6A 2VDNL 4P9MH 4NYLB 2CR0A 2D3JA 5BS0B 4R7DA 1BZ9A 1RZJC 1TQCB 1MUJB 1Z9OA 3JZYA 5HVGB 3FCTB 1D7FA 3DPDA 5EOTB 1G94A 2QPUA 4CSPA 1KBGH 1ZIAA 3UGUA 3CFUA 1TLMA 5DJYB 5KVEL 5EU4B 3QO1A 5AW7B 1NL0L 4L1DA 4G6FD 4NB7A 3W38A 1X7QB 3KS0H 5KVDL 2AJSL 3A4FA 3SPGA 4M9PA 1NCAL 4YHLH 3VD2A 2HH0H 4PS4H 1DEEA 4KZDL 2J25A 3BLKA 3IFOA 5BVPH 1HH9B 4FFWC 2NOYA 3MLVL 4YWGL 3NP4A 4NKOB 3VWJC 3RVVC 4YSUA 3H9HA 4Q9QL 3HG5A 2QJDA 2B5IB 2VE6A 3HN5A 4AGQA 1GJUA 2ENQA 3Q2LA 1BQHA 3ZRSA 1VCBC 1AI1L 3O8XD 1T7WA 3O6FB 2B0SL 4L3EE 4A7GA 5MEPA 1ZWIA 5J13C 4H1LG 1YPZA 4ZMTA 4KC3B 2AQTA 5HI4D 1TTUA 1J5IA 3MBWB 2GIYA 3O4LE 4PJ8C 2NW3A 2OXGA 1NSNH 2CMRL 3CZGA 3PNWA 3CX5K 4Y19E 1NL0H 4FDWA 4WTQA 2APBA 3QAZC 4PG9B 5KVDH 1JZ3A 2AJSH 3L2NA 1NCAH 3GIZH 3BXNA 4KZDH 2JH2A 4DPRA 4N5EC 1CFSA 3N1FC 3U82B 3ZDZF 5I1HH 3MLVH 1B4RA 2D31A 5DMGD 2WXPA 4NQEB 4YWGH 1J8HA 1TJHL 1X4YA 3NOIA 1J05A 3P4MA 3S34L 2P46B 4Q9QH 3IAPA 1MNUL 3K6FA 4LMQE 1AO7D 2MPAH 3TIEB 5GS2H 2FT8A 4GAYA 4F7CA 3BKJL 2YWYA 4PP2B 3CVHH 1DJIA 2L8AA 4NNPL 1Y6KR 4JZJB 2BHFA 2N1TE 2OK0L 3BSHA 3Q8CA 2P5EA 5EZJB 2X0WA 2ALAA 5IROA 1U92A 1Z32X 4BFIB 1EUUA 1KPRB 4OLUH 4B97A 4Z18A 4WO4C 1J11A 2VW6A 2PR4L 4X6BA 4H8WH 3DVFA 3WDIA 4PJHA 3U2SA 3F85A 2XPYA 3TO4A 1BIIB 1TITA 4ZFOA 1EFXA 1M05B 5I8CA 2F53D 3HR6A 3N04A 2D73A 1GTFA 2I9TB 4N3UA 5FEBA 3G5ZB 1TJHH 3D4CA 5HI5D 5L8KB 3S34H 4YSOA 4Q7DA 1HJCA 1E9PA 1I75A 1CDHA 3QQ3A 1S8DA 1GZHC 3ILDA 4ACPA 4YHYB 4HJ0C 4E2OA 3ZQXA 2WVVB 3D39B 4UTBH 3FPXA 5CZVH 3T9WA 4CNIB 4NNPH 2R1WB 2I9LB 1ODAA 4OV6F 4Z0XA 3MRBA 2AABH 4OI9A 2YD9A 4AEHL 4Z3FA 2OK0H 3CXDH 3ABMB 1CPUA 2D3NA 1KOAA 4M6OL 3ECBB 3VI4F 4ZTPL 5KS9B 3ROLA 3VXRB 4X8CA 1XSKA 1YYML 3V7AG 4TNVF 4N0UE 2XQYK 2PTUA 3N85H 3FOMA 2AJ3B 3L3HA 4K4KA 2PR4H 5SWZA 1JRHL 3NT0A 5I6OA 4Z3GA 5D1QD 2ZG2A 3L4ZA 4WW2F 5LAPA 2QGCA 5E99L 4A2DA 4XGZA 1CL7I 3WUWB 4JDVB 1MFVA 3OG4B 5GRVK 4Z6AT 1UD5A 3NRFA 1A64A 4KQ4H 3V0VA 2QPDB 4F5CE 1QLRA 2ZKXA 5EFIB 1ZDSA 3AREC 3D18A 4AT6A 5HGHB 2BW5A 5I2IA 4LSPL 2ROYA 2IOMA 3VXSE 3UTZA 1BVOA 3RWCA 4KX8A 2IDFA 4FNUA 3KLSA 4JGUA 1ACYL 4E0RA 2DL2A 3GSWB 2FX8H 5D2NA 3K0WA 4AEHH 3V4UL 2YAFA 3D50A 4M6OH 2ZCZA 3GKWL 3KYMB 2CKBL 3VFVB 1U0QA 4LLVA 4PIRF 4APQC 1HI6A 3FQTB 5TJWK 3REVB 5JPMB 3UTSA 3VXPB 3BX7C 4MRBA 5AVRB 3U9UB 3VFPB 1JRHH 1NFDA 1RK7A 3CZSA 1MFDL 1WHPA 2P49B 5DJDA 1CGYA 3CFDB 4OLVL 4P4RB 3ARQA 2XACC 3IBEA 1QRKA 3KPRE 3I6SA 4OM0L 3QIBD 5JOEA 3ZSSA 2Y5QA 2OZ4L 4YO0A 1SOSA 1BX2A 2UUDK 3KZ8A 1RULL 1RURH 2Y07L 3ARBB 1B4TA 1JMZA 1FFQA 4LSPH 5IVXB 1I3VA 2DWDA 3OKNB 1OALA 4QXUL 1HNFA 4B7IA 2GCYA 5EIIB 1C7TA 1CG9B 3A4DA 5T3XE 1QA9A 4PJ7B 3GSRB 2P43B 2UZYA 3MRCA 4YMPA 5PCYA 3FTSA 1TU2A 3V4UH 1FWXA 2PETA 2GEEA 4GIAA 4NPJA 4RLDA 5D2LE 3PHOA 3GKWH 3B6SA 2CKBH 4FJ6A 2RA1A 1NGXB 4Y1AD 5E2WL 3WN5C 1RZPA 4AIZA 2V7NB 3VGBA 1QTYT 2AFNA 3DUSB 3II3A 2QZ5A 2VITA 2Q7YB 3TJEL 2UVFA 1D9KB 3VQLA 3FFCA 3L4UA 2VTFA 3C8DA 3MLZL 3NCMA 2BVTA 4YEFA 2HG5A 1WWCA 4NKIH 4MAZA 2NNAB 3E80A 4TULL 5DFVC 1UENA 4RX4D 5IQ9A 3RPBA 1PYWA 4I1PA 5GGRY 4XXWA 3BFQG 2ZQKA 1S5IL 3M86A 4OM0H 1GVIA 2HFEB 4AYDC 4PJBA 2OZ4H 3DBXB 2MH4A 3JVGC 4UQIM 5DTFA 1RULH 1JSYA 3RJOA 4XOEA 5M94B 2ICES 2P8LB 1NCBL 5D1XC 4MDJB 1EXUB 2DRUA 3ME0A 4XPTH 4WTXA 5F7EH 1RUAH 1EANA 3IDMA 3W5MA 3VXOA 3LRKA 1UOKA 3OZ9H 2QVFB 4WWKD 3FO0L 3HZMA 4L9LA 1IE4A 1CYGA 3WMPA 4PJCA 4QHKI 1JK8A 3TZVC 5E2WH 3S2CA 1A1OB 5JORB 2WLLA 5ADOL 5DJZB 2DQDL 5HJDA 1BJ8A 3BQUD 3PP4H 3ZE1F 3ULVD 4ZUWA 3I9IA 4JDEB 2MCPL 4UYPA 2GQHA 4TULH 5JPNB 1KFGA 2OR7A 2J2ZB 1XAKA 4UNIA 4F9LC 4HEME 5AOZA 3CH8A 4WHCA 2H0EA 2E47A 3B8SA 1QW8A 3BWAB 1G7HA 1WWWX 3L3OA 1JZ6A 3HUJE 3ZMNA 5L7XL 4KXDA 5J1AA 4JFFE 2LTQB 5F8RC 2CE6A 4E9RA 2WHVA 1XGPB 3C09B 2W88A 3L5XL 4OZFB 2XG4B 1LWRA 4Y1TA 5B7EA 5JW4N 2QKIA 4QDGA 4ICWA 1YN6A 1RUPL 4FCAA 2O5XH 4HFWB 3DV4B 2NY4C 1BJ1H 1M9WA 2ZKHL 3FO0H 3G6JA 4M02A 3RI5K 3QA3A 2Y23A 3U4EA 5MEND 1I3RB 4R90L 1WV7T 5CO1A 1CJYA 3I3DA 4GRLD 2Q7NA 1I9EA 5ADOH 1NM9A 1DQVA 4LARH 5I1IH 2QTEA 2XN9E 4MMYB 5TTRA 2BOLA 5EZOL 1VLXA 3MRFA 2XC8A 1FAIL 1OK0A 2HTLD 3GS0A 3CFBB 4PVNA 4M7LL 1TTGA 2XRAL 4CVXB 1GIGL 1WFNA 4XC1L 4R26H 1U95B 4YDNA 4ZMWA 1MCCA 4OFQA 5L7XH 3QFJE 3L95A 5T1KD 1LNUB 3SOTA 1FNEB 4G9FD 2G30A 3D30A 4JFDD 3HE6C 3L5XH 4OJEH 1CI3M 2R27A 2XWEA 4LCWD 3FZUD 4MQSB 3IM1A 4NC2B 3ZRFC 4UIMB 4FLQA 1GOGA 3VG0L 1T0PB 3CE1A 1UWYA 2Z8SA 2GTWA 3SD2A 5FLUA 3WMQA 3WY1A 4R90H 4UM9A 4K3JH 3HE7A 5I6PA 3S88L 4X8JB 4LBEB 4YVUA 1J1XH 3WTTA 4U1IA 2CCLA 5HYSG 1WTLA 3VD9A 2PLTA 3CLFL 1T6WA 1OM9A 5EZOH 5CF3A 1DQJB 1FGNL 3IMWA 3BRGC 4QTIL 1BBJB 2XRAH 1GIGH 3LZFH 2DQFA 1IVLA 1RKRA 2NSMA 3IK2A 4QRPE 4A7GF 4NYLA 1KCUH 5JHDB 1F86A 3UZVB 3DX2A 3ZZQA 2EEBA 1YPZF 3L5IA 1BVKB 4TPRH 3FCTA 2Y2TA 4MJJA 2ICEA 4CKQA 4ZMPA 2HMIC 2ITEA 4F3FB 5CR1A 5DJYA 1CLOL 3S35H 4GUQA 3RWFB 2NSQA 3VG0H 3VRLE 2VWEC 1WF5A 2AQRA 5FGRA 3V95A 5CUSL 4KDWA 4KFMA 2DLHA 3AG4B 4R3SA 2PXYD 4IDJH 4JPVL 5CEZH 5HHVH 2H4EA 5F97E 4YQXH 3LIUA 3QG6B 5FA3B 2OMNA 1N6VA 1NGQL 2YQ2A 3V52L 3HFMH 2NX5D 4AJYV 2XDHA 3GJFB 4NKOA 1GTNA 4G11A 2EXSA 4WTZG 5LGYA 1MFUA 1AZUA 3NVQA 4M8UA 4AL8H 2W0KA 4ZPVB 4B3VA 5KSAC 3FO2B 2R69A 3B5TA 3O6FA 3VWJB 1QUPA 1AANA 3W0WE 2H6OA 2IH1B 3LRHA 1KTCA 2YGPA 5DRWB 4N6RB 3B9EA 2YXMA 2Y0SA 5C0AE 1PFCA 2H9GB 2BIIA 3GRBA 3H4FA 1NINA 3NJMA 4P05A 4EDWL 4YXHH 5J13B 3DX1A 1A6WL 5C0CA 4HW6A 2FEJA 1CLOH 4RCAA 1OOAA 4PJ8B 3DX6A 5IG7A 4PG9A 4J8RB 4W9IC 3BT2L 4JPVH 3NDYE 3ZTNH 5C07B 4HMDA 3QAZB 1QUNB 1NGQH 4BEIA 3M1BA 1TNNA 1AD0B 2O5YH 4YHMH 5C0DB 1L9NA 5ERWB 1B6DA 2W9EH 1NOAA 1CF8L 1CGWA 4DEPB 2ZX9A 2W80C 4KK5C 2G75B 4PP2A 3WD5L 1JTOA 1WC7B 2H3XC 4R0LC 5HYFA 2NXYD 4JZJA 3W56A 2XI9A 2WXKA 4X7EC 2FQFA 2JWYA 4MA7L 5EZJA 3QCTL 2E75C 3BAKA 1ZHKB 5CD5C 4UQ3B 3V0WL 4BFIA 2VUKA 1KPRA 5HDQL 3EJZC 1D5MB 5GSVA 3MUJA 4EOWH 4KXZH 2EVFA 4F15C 4U6HB 5D7JC 5D7LB 5B21A 1I7TA 3DWTA 3QRFM 2FTAA 1M05A 2JSFA 4MS8C 3GXUB 4WO4B 1ZMYA 2IGFH 4PRPE 2VDMH 2N4IA 2I9TA 3V0AC 1P1VA 1WT5C 1JZIA 3FU0A 3H9YA 3BRDA 2XUWA 4KK6D 2N0KA 3PHSA 2HP4A 4YOKA 5JMRA 1CF8H 4DIXA 1S7WB 4RAVB 3IN2A 1L6ZA 3P4NB 2BZ7A 2R1WA 5KOMC 1X44A 1E3XA 4OFDA 1TVHB 2W9DL 3T1FB 5I17B 1R0AL 4MA7H 5KS9A 3DA0A 4NIKB 1JV2B 5KTEH 3A23A 2K9FB 4PRNB 3AS2A 4MQXC 4Q56A 2AJ3A 3MUUA 5AVQB 4YSRA 1MFCL 1NFDF 5LXGH 1CBJA 1OAZL 4NO5B 1G7JB 4ELME 3WUWA 3LPWA 1GGIL 1BLNB 1MEXL 1I7RB 1OF2A 1WK0A 3UACA 3F6IA 3IJHB 5EFIA 2WIMA 4LQFL 1IGJB 2C3XA 3FUIA 4H8VA 2J12B 1ZA6B 1F02I 3KWTA 4MNQE 3WKYA 2EYTB 3AREB 35C8L 4JG1L 3ZKNC 5HD8C 2R0WH 3GSWA 1EEUA 1YUHA 5E4AA 2MNWA 2HRGA 4PGDA 3JYBA 4NOBA 2W9DH 2UWEF 4HKJB 4HUCA 5E95B 3KYMA 3VFVA 1HXKA 4CU6A 3VD7A 3NCXA 4QXVA 3REVA 4F24A 4JE4B 3D12B 1RUQL 3MO1A 4ZZKA 1T7XA 1ZS2A 3OAYK 4APQB 2MNJB 3A3YB 5F0LB 3KLHD 2Z7ZA 3CFDA 4P4RA 1T89C 1LEIB 1V5JA 4UF7C 1EFQA 3KJ6L 5IUSA 5E6SB 4G6ML 5IESL 1KYOK 3FKUS 2B2XH 2MQGA 5DWUH 3F3HA 3ARBA 4IRSB 4G6KL 5IVXA 2FT6A 1U3HA 5CM1A 3HC4H 4HLZG 1UJ3A 5EIIA 1CG9A 1G9ML 35C8H 1NUNB 2AVGA 4JG1H 3RDTD 4PVBA 3RVWD 1L9PA 3NCWA 3SO5A 5AW0B 3SGJA 3WNLA 4AUJA 1FV1B 2VYRE 3N9GH 3QUXD 4PJCF 2DS4A 2V5TA 5I73C 4HT1L 5DHVA 1AJ7L 2V7NA 1YEKL 1ZVSB 3EDDA 4TXVB 5D1ZC 4ZNCD 1TQBC 2Q7YA 1F1DA 1Q72L 2F1BA 1D9KA 2NUTB 2R2EA 4K9EL 3ZHKA 2VDOH 5E2TL 4G43B 4FQQB 1QQDB 4L2LA 4N86A 5B38G 1GRWA 3VFMA 3WN5B 3H7BB 4FHBD 4OFKA 2P7TB 1KJ2B 2J44A 5FA4A 5HDWA 5I5MA 2FWUA 5CEXA 3KJ6H 4HUUA 5IESH 3DBXA 3N2JA 4POZC 1Z9SB 1QSFE 1YN7A 1A2YA 2P8LA 1HKFA 1T1WB 4G6KH 4PGEB 4LLQB 1F4YL 3CZFA 5AW1B 4XX1E 1HL4A 5ICXB 4Q9CA 2Z4TA 1OPGL 1RY7B 1SDDB 5D1XB 4RRPM 3V5DA 3A6OA 3JV5A 3VMOA 4KK9D 3GRWL 4I18C 4XXDB 4JANA 3G6JF 4NO2A 3KS0J 3BAXA 1INEH 2IG2L 1YEJH 4KTDH 3BRFA 2BDNL 4DTGL 4WSJA 5DJXB 4D0BA 2OYPA 3I6KB 2EJ1A 4JDEA 1R75A 3TZVB 5JPNA 2OZNA 4FTVA 2J2ZA 3NUKA 2OJEB 4P4KA 1THAA 4JKPH 5BJTA 4LP8A 3GSXB 1SMAA 5DVNA 4PS8A 3JWNE 4FJZA 4MJIB 4NQVB 4QD2E 1R3KB 4ZO8A 4JRYA 5JR1L 2XYCA 4P3DA 3V55A 5AD0A 3FCBA 2AJXL 3DETC 3QDMA 3VRIB 1I53A 4DEUA 2UX6A 2DH3A 1F4YH 4HS3B 4OZFA 1PKQE 1TENA 3KL3A 1TF4A 1A9EB 1GC1H 1JZGA 3E2HC 3JYCA 3CFKB 5CILL 4KGJA 3SBRA 3RHWK 3WENA 1NGZB 2YPKB 3ATFA 3SDDC 2OSYA 3ARSA 3FB5A 2Z31D 3GRWH 4XXCA 2FIKB 3DV4A 4PW9A 4UANA 1W15A 1IAMA 2E7DA 4C58B 2G2RA 4MRCA 1I3RA 5F1SA 2VDNB 4NT6B 3HPJB 4G9DA 2UY7B 2IG2H 3UC2A 3VX0A 4XI5C 5F7HA 2ADIB 2XT1B 3MV9E 4G8IB 5LWYL 1LE5B 2VLJB 5EUOE 1MCWM 2NY4B 5KVGE 3WLWC 3C9NA 1Q1JL 1ZTXE 2HVBA 4MMYA 3O4OC 1J1OL 1RIUL 1W2KT 2OM5A 1MSPA 5LAXA 5GZNC 3LNGA 5I1CL 1U95A 2J8UE 2PYFB 5F6HI 3RGVD 2PPCA 1U93B 5C8JB 1LNUA 4JHUA 2AJXH 1FNEA 1BP3B 4MXQC 3VXMD 3LKPB 4MD5B 4FRWA 2NZ9D 3T0XA 3LZLA 3COOA 5IKCA 4UIMA 4PWEA 1BMGA 5E70A 4UQCA 5D4QA 3HLKA 3HE6B 4DHLA 1D5XB 4HMEA 4P5MA 4P2AA 2JIXD 4XWOD 4C83A 3SCMC 4AQEA 4FNLL 2NMSA 1SN2A 2X6VA 1XH2A 2F5AH 4Z7UB 3CC5B 1ZLSH 5IB5A 4MJ2A 4N0CD 1DN0A 4PLNC 1UM4H 3L4XA 4GMSL 1XIWC 3FRUB 4JREC 3T2NH 1XH3B 3U7WL 3PGFH 4PRHE 5E2VL 3RU8H 1DQJA 1ZRUA 4GNKB 2XXFA 8FABB 1BBJA 2XTJC 1PZ3A 3S5LB 3D4GA 4P2RA 4BGLA 1OZUA 1L5GA 3OAUH 5JHDA 3UZVA 4IMLB 1BVKA 4DGYH 5LGHL 4Q6IA 3H0TB 4URKA 3KBEA 1DQQA 1CXLA 2V3FA 4L4VD 5IW1A 4F3FA 3EJTA 3U6RB 4GG6E 4TOYH 2XNAA 4XMLH 4XPFH 4TUJA 5GQBA 3RWFA 1I1RA 4CBPA 4LHUB 2PTVA 4UINL 3P9LB 4PJGF 4NNXA 4K8RD 2V8MA 4XAKD 4LSSL 3U79A 4FNLH 3K4ZA 2V5MA 3GZQA 3DDFA 4NWUL 4FZ8L 1PQZB 4P5TA 5T5FH 1E8XA 5FA3A 1BA9A 1ZT7B 2OMYB 5BVJB 2IAND 3U7WH 3GJFA 3OKMB 1QHOA 3U2IA 3TFKD 3LXCA 5JW4Q 4BFJA 3QULB 3VWJA 2LVEA 3NRPA 1A6PA 2A4EA 2IH1A 5DRWA 4NUJB 5KSAB 5LGHH 1SXBA 4GQZA 5CP7A 4P23A 5IBLD 3ZOAA 2ZP8A 1GJWA 4W4OA 4HD5A 2GSGA 4AY0A 3Q13A 1OCOB 4JL2A 3F04A 3P4OB 3C12A 4PMEA 4J8RA 4MAYC 4KI5F 4MVBC 2I85A 1H19A 4LSSH 3X2QB 3BUYA 1Z6JT 1UT9A 4CSZA 4NWUH 5GISL 3AQXA 3M17B 2IFFH 4KNUA 2Q10A 4R96A 3KPLB 4FQXA 1QUNA 4X7CC 3QZWB 1QTSA 4X9YA 5C0DA 3S98A 3HTLX 1SVBA 5ERWA 3UO1H 4F7KA 1CL7H 4KRPD 5FC9A 2XFXB 2D9CA 3MVSA 4L3AA 2BVPB 3LRGA 4FQPA 3QQ9C 4PPTA 2VLRB 2JJUA 1FIGL 5ANMA 4X99A 4M1CC 1KEGH 1IEAA 2E86A 4TYUA 1UG9A 3E6FB 4OKVB 4WUUA 2X4NB 1YECH 4R0LB 3H6AA 3QJHB 1ZHKA 4W9DC 1MXGA 4Z0BL 3WELA 3RL1A 1D5MA 1I8IB 3FBKA 4QHNB 4J3SA 4HHAA 5D7LA 4QKXB 3O3EB 3GYRA 4OJAA 2WBJC 3ULVL 4IIQC 1JL8A 5C7XH 1ACXA 5H37A 2ESVB 1GXEA 2Z1PA 2BW4A 4F15B 4WFFE 5D7JB 3NIGE 3NJJA 4Z7VF 1VPOH 1X5MA 2EDJA 1WHOA 4PS3A 3AADB 3CFEA 5EBLA 3L9EA 2KERA 1E50A 1XZ0B 4RAVA 3P4NA 4JMXA 5FKAB 4XNBA 2QR0B 3HNSL 2CUAA 2H0PA 1V8HA 1BZ7B 1GZHA 4P2OA 1U91B 3SE9H 1F4XL 2N7AA 3T1FA 5T3ZD 5I17A 2YO3A 1G9NH 3R18A 2G9HB 1JV2A 2NY5L 2IWGA 4NQDB 1OAJA 5CBEA 4QMEA 1G9MC 2DPKA 5ALCL 2QZQA 4JO3H 1W72L 3LZQA 4XP5L 4UT9A 4NO5A 1G7JA 4K15A 4NBXB 3CN3A 1BLNA 1I7RA 1NBVL 1UUNA 3MRNB 1WFUA 4PUBL 2A6DA 5SWQB 5CMAB 4LLMB 2ZYRA 3IJHA 4JFTA 4K9EC 1JMXA 5IVXF 4R5XA 3KR3L 1HSBB 2C7UB 3FYIB 4JG0H 4CBZA 1U3ZA 3AREA 3AQYA 1JF6A 1WEJL 4WFGD 5E7FA 3HNSH 4MMZA 4ABVA 2AEOA 3PHAA 2DAVA 1OGAB 3KGUA 3GMMB 3W82A 1BJ1J 3RIFF 2ADFL 4HKJA 3SZKC 1NCTA 1A9VA 1OARH 2NY5H 3E8UH 1D5IH 3ZMRA 5CZKA 3PCYA 5B39A 2DQUH 3EYSL 2IAAC 3L3JA 2H6PA 3SKJL 5ENWB 2F7IA 4GKNA 4XP5H 5TPWL 4APQA 1LWHA 1PZ2A 1C1EL 4ZAKB 3HBQA 3MI6A 3RTQB 5DQJA 2BVEA 1LEIA 1JNLL 3JXAA 3UEZA 1O9ZA 4YHKL 5GGSY 2OSLB 1NBVH 1TQUA 4PUBH 5CLXA 4ZUVA 5GSRB 4XMKL 2CLRB 4UI2A 5CCGE 5LLIC 2TSBA 1B0WA 5DRXA 5CLZA 1T22A 4IRSA 3L6FB 1MIMH 3VH8B 3BPLC 1X9QA 2RIKA 1A6ZB 3AW5A 3KR3H 3LXBA 5DMGC 1DBJL 5FGSA 3QEUB 2LR4A 3MGTB 2CO6B 3MCG1 3ZDXB 4NRYB 2QT6A 4F8NA 3W39B 4M7JL 5I6KA 1SVZA 2BFVL 4E5XA 3HJ0A 2ADFH 4GKSB 1L4IA 1EA9C 4I0CC 4NQCE 5BO0D 1U21A 3KCPA 3L9BA 3VYPA 2NUTA 3RAJL 5FDWB 1D6VL 1FVDB 3JSSA 4FQQA 1QQDA 3PL6D 1KB3A 5I73B 4OU3A 5BQ7B 1C1EH 2ADYA 5D1ZB 1TQBB 1JNLH 2F1EA 2GFBB 5LN4A 4H8QA 1N6QL 4XO5A 3WY4A 1AGEA 3CLEL 4JPIA 5K69A 4C4UA 3B9VA 4G8GD 1MCOH 1LO4H 1Q0YL 2AEQH 1T1WA 4OCWH 1JHKL 4KKBD 4LLQA 3UYRL 4PGEA 1IC0A 4YLBA 4KHTL 4WK0B 1DBJH 1QAWA 4WI9A 5HI5C 5ICXA 4LOVA 1P1ZA 1SDDA 3GLZA 3LKOB 5D1XA 3N43F 4UOW1 4D94A 5FYLL 3ZDZE 1IT9L 1NLBH 4XXDA 3ARYA 3HBZA 3JV0A 4M7JH 2BFVH 5F7MC 1BM7A 4M62H 2VLKD 3BP7A 4G2AA 4ZMOA 4HPYH 4HZLA 4I18B 4I1NB 3QUZA 2O6CA 3RX5A 1BYOA 2X4QB 3EOAA 1D6VH 3I6KA 5JHLA 3TZVA 4FS0A 4QOKB 1RXLA 3LKRB 2EADA 2CDEB 2I26N 4IKIA 5E6ID 1TJGH 3AXLB 4NFCA 3GSXA 1XMEB 4ZMVA 4TVPD 1EDQA 1E28B 3WS3B 3TM6A 3NMEA 3RUGA 1CVRA 5D1QC 3VG9C 1SYSB 3IJ8A 2VAJA 1R3KA 1FRGH 3KW8A 3L4TA 4HJJH 4LVEA 4F9LA 2WM0A 1U8JB 3VRIA 4HBCH 4JVUA 5D6CA 5AL8A 4KJWD 5A2KH 1JHKH 4KRLB 4MXWL 3UYRH 4HS3A 2F6AA 1XMWA 1EAJA 4G8AC 5FV2A 4ZMZA 1YNTB 4HUMB 3QIUD 4J1UB 3L4VA 1A9EA 4TV3A 3CFKA 3Q2NA 2O30A 1URLA 4KAQH 3H4HA 1R34A 2YPKA 3NZ8B 1ZLVK 1P6AB 3DOIA 4LEEA 3HBPA 5BZXA 5T1LD 3BP6B 4BA0A 3ULUD 2FIKA 4AEFA 2TRHA 3MXWL 1RQ5A 2J55A 1LE9A 1YEGH 3E2HB 1Q9WA 4NRZB 4NT6A 4CGUB 2V9TA 2CA4A 2UY7A 1KJVB 2P5WD 2YPLE 3QDGE 4MCZB 1LE5A 3SDDB 2VLJA 3LNDA 4BCXA 3OLIA 1S78C 3BUPA 3AB0C 3N0PB 4KGLA 4RFNC 3IJYB 4LE8A 3ZR6A 4WQOA 1ACCA 1BEYH 4OR1A 3RWJB 3L1GA 1LXMA 5FXCH 1N4XL 1O9WA 4L8BB 4LPWA 4XPHH 3H9SE 2OULB 2VO8A 4Y7MA 1WAEA 3O4OB 3VI4E 1ZXKA 3WN6A 3DOSA 3G08B 2HT4C 2PYFA 2QV4A 2Z4QB 3JTTB 4OKDA 1T3FB 4YE4H 5LO7A 4KMTL 2CHNA 4NC1C 2ZXQA 4MXWH 5AZEH 5C9JB 1CR9L 1NIAA 2HVJB 1VGEL 4Y4KD 3K0YA 4XE5B 2DIAA 3LRLA 1PDKB 5E5LA 5INCB 3HE6A 2E56A 3G6DL 1DQIA 1JFQL 4D8PA 1D5RA 2NY2D 3MXWH 1BQHG 3QDJB 1WS7A 3NPZB 4MNGB 1OTTC 4Z7UA 3CC5A 2KHAA 4JZNB 2V33A 1BQ5A 1SHSA 1L9QA 3U6XS 1DJGA 1MH5A 3LYRA 3RX8A 1XTMA 2R4SL 3SCMB 3UABA 1XH3A 1B4LA 5EO0B 3CLWA 1T20B 1L3WA 4QGTA 2DKUA 1N4XH 1YEWA 3B9KD 1XIWB 3GZOA 4JREB 3S5LA 4OQ1A 2NYYC 3W37A 1YAZA 2R0LL 1QOKA 2XTJB 2F61A 5BMFL 1QBBA 4A6YL 3H0TA 3CU7A 1MFAL 2VJXA 4FD0A 1CR9H 4L5FL 3BLPX 5TD4A 3AZUA 4HIIA 1ILSA 1UWFA 2FGWH 3GHEL 1X5XA 2WB7A 1TJMA 1WD9A 2ALWA 3CBJB 2DM2A 3P9LA 1JFQH 4O5LL 1DUZB 5FOJA 2ZYSA 1YYCA 3MLTB 3WJLC 1MVUB 4J5VA 4AXWA 4GI8A 5ID0A 4PJAA 5KYWB 2F1AA 1PQZA 3IXAB 5DEFB 4WWKC 1HKLL 1HQ4A 1QRND 1ZT7A 2OMYA 5BVJA 2FD6L 4LF3A 3P2DA 3VM5A 3EOTL 3CMOL 1M71B 4QUOA 5HVHC 3QBTB 4IOSD 2WKOA 2WUCL 1F45A 1X5IA 1NCJA 3FRPB 5ABZA 2RGSA 3ULVC 5CJOL 3QULA 1QNZH 1DVZA 1IIIA 5FO2A 1NC2B 3ZIYA 2EUVA 3EIFA 2H6UA 3T2QA 2D7OA 5BMFH 4NUJA 4A6YH 4ZFGH 5KSAA 4P48A 1UD3A 2VN6A 4L4TB 5E8OA 3BI9X 2AK4E 5MERA 4P2QE 2WLHA 3DSNA 3WJJC 3LNFA 5JW5A 1TETL 2KZBA 1YDPB 3C5ZA 2O5ZL 2ZYHA 5HGAB 1H8LA 4JJHA 4O5LH 2X4TB 4F9PC 2MOVA 3RY5A 4QRSA 2MCAA 5IP4A 4X80H 1XDTT 4KFZC 1HKLH 2NY5C 1OB0A 3RNKB 3BUIA 1BZDA 4MAYB 5LCVL 4KK8D 3KPSE 5F7AA 2E6JA 5ICUA 1LK2B 3TT1L 2FD6H 4KZEH 5C71A 5ISZE 4L1LA 4GRLC 3EOTH 1JGLH 1ORQB 3CMOH 2VN5A 1WAAF 2CK0L 4K2UH 2XFXA 4N1HB 2WUCH 1RZIB 2A9ML 5LN8A 2BVPA 1MAKA 5DEGB 4PCKA 1LO0H 4GP5B 5I19L 2VLRA 3BHBB 2HTLC 4I2XE 4A2HA 3IJ7A 3QXAB 4YBQD 3TEXA 2WXHA 4OZHF 1F6AB 1HJBC 3V0IA 3ZE1E 4OKVA 3ZLQC 4OCRL 5FHAH 1OXYA 1NDGB 3K71B 4PWHA 3GQFA 1TYEB 3QJHA 4S0SD 4YDZA 1DSWA 3L08A 3RWEB 2YRPA 3MDJA 4UYQA 3UTTB 4GO9A 1I8IA 1TETH 2Z92B 2D7PA 1MDAA 4U1JB 1MREL 4WFEE 3O3EA 3TGXA 4XP6L 2UYLB 1Q0XH 4HGKC 1S2EA 3K2UH 1Q1PA 5HJ3B 2J1ZA 5SWSB 1O5DT 1EBAA 1HAUA 3U6XA 4X8GA 3WL9A 1NZRA 2IBZX 3FT3B 3N1MC 5LCVH 1A5FL 1UJTA 2N59A 2WLYA 2IPUG 2WBJB 1D2OA 4IIQB 1II4E 1AYOA 2A1WH 4Q74A 3T65B 3QQ4B 1YG9A 4DAGL 1XZ0A 1KPVA 2A9MH 1NGPL 2FQDA 1WT5A 4PJ5E 1EDYA 5I19H 2GK2A 2BIMA 5A40E 1F8TL 4I5BB 3R8QA 4WU5B 1NUGA 1CLYL 1VFAB 5C6PB 2VW4A 3NJLA 2VDLL 3EYVA 3MLYH 3T71A 4I8DA 2G9HA 2QSVA 3HG1E 5HHPB 1LEGB 3IE9A 4NQDA 3PWPA 1HL8A 4J27A 2ZTBA 4MNHB 2WZ0A 3FQWA 2B59A 1IC7H 5EEZA 2Z0BA 1P7KB 4J6RL 1E2ZA 1MKFA 1XCQB 3U0PA 1AZCA 1FL6B 3IRZA 5IMLB 1AMYA 1E8ZA 2QDWA 3MFGB 3K81A 3B2UD 2PXYC 3AWGA 4LLMA 5HDLA 5I1AA 4WGKA 3Q8EA 4G6FB 2R0ZL 5DS8B 1S7TA 4LCIH 1AY1L 3AT0A 1HSBA 4S1QH 5AALA 2C7UA 2OMTA 3CSBA 1KGCD 3BE1L 2VABB 2R1XB 3BN9D 5E24E 3UAJD 3ALXA 2QKSA 1F8TH 3BGAA 1ZLUH 4FQ1L 1OGAA 4AGNA 1CLYH 1PS3A 1ZGLM 2XPGB 4FQCL 2YD8A 3S5ZA 1DBBL 3UROR 3WI9A 5E5UB 4MXVE 1IFRA 5C2BL 1SJEB 4TNVK 2LAAA 3NIFF 5ENWA 5K9QI 1A4AA 1MCFA 2Z35B 2BY1A 2VZ3A 4ZAKA 4BDVB 3RTQA 4AOFA 1YPZE 2A77L 2H8PB 3IFNL 4NJ9H 3DTUB 4YE0A 4F37F 1GYCA 2OSLA 1KULA 1AS8A 2YAMA 5GSRA 2E9WA 5HDBF 4CN4A 1SN0A 2CLRA 4GS7B 2R0ZH 4FCHA 3MOAH 3L6FA 2WXLA 1YEEH 1K5NB 3R06B 1AY1H 2B4CL 5EO9B 2HFFA 3IYLW 3QEUA 2VXVL 2NTFB 3X12B 1PZUB 4DKDC 2V37A 2WVSA 1ZA3A 3CHOA 3ML8A 3BE1H 4YDVA 1YY8A 2HKHL 2PWDA 3I50L 5C0FA 1IM3D 3T8XB 2OLDA 2E7LC 3GD1C 4Z7OB 4O9HL 4PY7B 3QNFA 4HWUA 3L7FA 1AZVA 1UWXH 4QKTA 5I15L 5KVFL 1J8HE 1N6UA 2JV6A 1UD4A 4GKSA 4WI2A 4FQCH 1AO7B 1DBBH 1EZLA 1B2YA 5IBUB 5C2BH 4OCYH 3EUUA 5EWIH 1FVDA 5L2KB 2LLLA 1LP9B 3OKEB 2IQ9H 4JO1L 4K5PA 4LT7A 4K0OA 5BQ7A 3GXMA 2X42A 4X6FB 4OW6A 4IRZL 5EU7E 5D1ZA 1F97A 3ZQWA 5JYMA 3AY2A 4OD1H 1I1AD 3GMOA 3UBXB 4AUUA 5L8LB 2QSCL 3B7TA 2P5EE 4MHHI 3RUGF 1PVHA 3NZHH 2OW6A 2B14A 3B1UA 3PPEA 1HNYA 3QPXH 5TE4L 1Z7JA 3H2PA 1CGTA 5F7LB 5DD6A 5CKGA 5A2JH 1ETA1 5AVYB 1MCKA 1GPOL 3MFFA 2VQTA 4PJHE 2B1HL 2CPUA 1GS8A 2F53B 4KK6C 1SY6L 3T0BA 2YQBA 4O9HH 4R7NB 3GLAA 4JFZL 4MBRA 4AKQA 3BESR 3SJVA 4XMUA 2QFPA 5T5NF 3WKQA 2NR6C 1OAQL 2X4QA 4J23A 2XN2A 5LNGA 1TEGA 4JO1H 4N22A 2GJ6D 4QOKA 3FSZA 3LKRA 1W8NA 5TQ2L 2CDEA 1CGSL 3PU7A 2F54E 4IRZH 1G4RA 4KXAA 1E28A 1PZBA 3WS3A 4TQPA 2QSCH 2P52A 1SYSA 1ZVHA 3RX9A 4KX7A 3HAEB 1AGFB 4OQTA 1IEHA 3SE6A 2AXFB 2OL3A 2EDOA 2GBTA 3FUJA 4O58L 4YDIL 4YIQB 3UTQB 5I23A 5D1QB 2E9IA 3VG9B 5SWZE 1GHFL 2HTKD 1YNTA 3QEGL 1GPOH 3QQXA 4J1UA 4NZTL 4YHOH 5BW7C 4OD2A 1IARB 4R9HA 4X0NA 3NZ8A 3LN5A 3QXUA 2NZ1A 1F56A 2B3RA 1MFBH 2H1LM 4OZGB 3STZB 4JFZH 3V6FA 2BC4A 2AMUA 4NRZA 4KMQA 3L3DB 4AGPA 5FUCC 4Z7UF 4MCZA 3SDDA 3MCKB 3TONA 1SMOA 3PWVA 2R29L 1OAQH 4PRDA 4QRRD 1JPTL 4EE2A 5ACMA 1V7ML 4GRMB 5F7WC 3RWJA 1E4WH 1SXAA 5D2NE 1WSST 2DD8L 2BHUA 4JY4A 1VFMA 1XGRA 5AVZB 3RTLA 6FABL 3AB0B 3NK3A 4L8BA 3NIDB 4RFNB 4AEIL 4X5XB 1FZMB 3INUL 2G3ZA 3DV6B 4EUPH 3G08A 1UD8A 5ITFB 5CEZE 5AG8A 1T3FA 1Z9MA 2VDQL 4R84A 3HZKB 5GZNA 3UTSE 4O58H 4HLEA 4YDIH 1FN4A 4D2NA 5C9JA 3TXAA 2YFOA 2DQJL 1NFDE 1T0MB 4NZTH 5KANG 1MI5D 4KDVA 4KDTC 4DKEL 2ZZUT 1AQKL 1B0IA 1MY5A 3GMQB 3QIBB 5INCA 4V2CB 4AQ8C 3N41B 4LGPB 3VGHA 4HUVB 3WHE0 3CVDA 12E8H 3RDTC 4PSRA 4LMQI 5DK0B 2YD6A 3RVWC 3FBQA 4PJAF 3S3CB 4JZNA 3VGAC 1T0NA 1CDGA 3QUXC 3NABL 3SCMA 4L3ED 4XPGH 5EO0A 1JPTH 5I18L 1RZ8A 4FNRA 1T20A 3DUUB 1R17A 2HWZL 2WKOF 2PR9A 2DD8H 1C5CL 5DJCB 3NJVA 4GMTL 1XIWA 4HUKB 2UWEE 3AFLA 3INUH 5CN2A 2COVD 4DP1X 1TVDA 3SY0B 1CTNA 1A8JH 2VDQH 3ZGHA 2EEXA 4PYGA 3FFCE 1A3QA 2KDGA 1MCPL 1AD9B 4XP9H 1CTOA 2H1XA 3QXDB 4GOSA 3JUZA 5J7CC 2VOTA 3G5VB 3OXRB 1DUZA 4PJBE 3L1EA 1X5AA 3MLTA 4GBXD 3B9AA 5FWQA 5F0JB 1K72A 1NLDH 4KK9C 4AW4A 3IXAA 1DLHA 1O0VA 3DMMD 2WZPA 2A9NL 1CURA 2IADB 2JXMB 3GS4A 2EDLA 3UL4A 1ZKAA 3NABH 5TDPB 5I18H 4RFEA 4W9CC 1M71A 4WWKB 2W95A 3FRPA 3GTTA 2JKLA 1C5CH 4PGBB 4GMTH 3MUGA 4LHJB 3V9EA 6CGTA 2D03H 2FEEI 1NC2A 4OBSA 4PJCE 3SEPA 5D5MA 3FW6A 4E41D 1A7NL 4P04A 1DQKA 2WCGA 4FFYL 1DVFC 5LVEA 3CSPA 1ULVA 1MCPH 4OFPA 4BFOA 5JXAL 3T08A 4Y16A 1C5BH 3EH3B 3MXVH 4UM8B 1DQTA 1NMBL 1TTRA 4AKPA 3I02B 2E7MA 3ECQA 5HGAA 5K5YA 4DP0X 4OSUL 1CO1A 4H40A 1U8NB 3T2LA 4YHPA 1MQKH 1OQOA 3KPNB 4YAQB 1KYAA 4AV5A 4B9CA 4D0CB 3T6WA 4NENB 4FADA 4OGXL 4FQLL 2A9NH 2VR9A 1LK2A 4TUUA 4AQZA 4IJTA 4R4FL 4KUCD 3X14B 2XBDA 1ORQA 1T7YA 3TCTA 1RZIA 3VFMB 2OJZL 3G6JE 5MENB 4LLAA 1CMOA 4G42B 3WIHA 3IPEA 3IWUA 1W72B 3EJRA 3PP3K 4GRLB 1DDTA 2DLGA 3DX9A 3QXAA 3KLLA 2EYSA 4FA8A 4B9ZA 3TBSB 4Z3IA 3WUWG 3K71A 4QRFA 1NDGA 4ABQA 5KJRH 5JXAH 2XFGB 4MX7B 5HYJB 3CHRA 3RGVC 3PV7A 3RWEA 3U7YL 1SUHA 1QVOB 3TWCH 3UTTA 1MJ8H 3TESA 2IQAA 1YEDA 3PLYA 5CGBA 4Q9RH 4U1JA 3LB6C 5T1KB 1WBXB 3HC3L 4OSUH 2UYLA 4CC4A 1CF1A 2PO6D 3OMZA 4X7TB 3I3BA 4GB9A 5SWSA 5AYUL 5F7BA 4LCWB 4OGXH 2KDYA 1BQUA 1PAZA 4XBPA 4XWOC 5H94B 2ORBH 4QTFA 2WBJA 4NXKA 4IIQA 2IH3A 2BCMA 4TVPL 4ZYKB 3TTYA 4BUGA 5I1KH 1Q9LB 4N0CC 3T65A 4NM4H 4PJDB 4AZUA 5DD5H 2W0LA 2OJZH 4Z7AA 3VD1A 4E68A 1U8HA 3VGFA 2GT9B 3TTSA 1TFPA 3MV7B 4OQTH 2E7HA 2JB5L 3CFJA 4LEXL 1ZAGA 2GHWB 4WU5A 2X4OB 1KWKA 3C08L 1MWAL 1VFAA 2E4TA 1GR7A 1NCGA 3H2QA 4GQPH 2B4CC 1VFBB 5AENA 4YGVA 5GRYA 2NCMA 1ID2A 1LEGA 1M4KA 4AKOA 5HHPA 1K85A 1A4JB 2WLIB 3QR1A 4AQOA 5FKPA 3RG1C 4V1DB 4RWYL 2ED6A 2X3CA 4ZMAT 1NJ9A 2BXYA 2EH8L 1P7KA 4U4BA 2XWBB 3FQXB 1XCQA 4EDXB 5TF0A 4DN4L 1DTUA 1FL6A 1ET8A 4L8CB 4K8RC 4AH2A 3ZK0A 5FYKL 4JHWL 3Q9PA 3MV01 5T3XD 3NQIA 3MRKB 1SBSH 4HWBL 3ESVF 2AEPL 3UP1A 1OTUC 3PDGA 2VNCA 1A3ZA 3UXFA 2PXYB 4ODUB 4ZXBC 1PLGL 3S0PA 1SOXA 2F7OA 3RGHA 1CICC 4KVNL 3UEQA 4WK4B 3TFKC 4RGNC 2VABA 1FNAA 2R1XA 3FUKA 5JOFA 4LEXH 2NX5B 3QR0A 1ZLWH 25C8L 3DTXB 3C08H 2KL6A 3BSZH 3WNKA 2XPGA 4EKJA 2R2BB 2OCFD 3FCUB 5GGQL 1SJEA 3O8XA 2A83A 2BRRL 1ZPLA 5IBLC 5CIPB 2WUBL 2HX8A 3CDCA 4HIHB 5DUMH 2JMRA 1E8WA 4M5ZL 2WWOA 3K6IA 4PEEA 1TZGH 5DF0A 3FDWA 4HUWA 2EH8H 1DFXA 4M7KL 2GC7C 5GRZA 3HZVA 4DN4H 1CQYA 3F83A 1DLFL 5FS5A 1UT1A 5IBTH 3R1GL 5F44A 4EZMA 2LOEA 3TBYB 3T2OA 5C0CE 4HWBH 3QYNA 3R06A 1K5NA 2AEPH 3SE4A 1USZA 5EO9A 5IB2B 4PJGE 3DK0A 5MI0C 4LRIC 4ZX5A 2J73A 3ESMA 4KV5F 2H3KA 3T8XA 4PY7A 2B9AA 1UXSB 25C8H 1T5WB 3CSGA 4TL5A 1MHEB 1PU0A 3D33A 3GM0A 1KCRH 3R0NA 1EAOA 1AO7A 5G55A 3CZLA 2BRRH 2FAUA 4FG4A 4ZFZA 4TLUA 2WUBH 1LP9A 1LD9B 3OG6B 1Y1DA 2JTYA 5I24A 4JFFD 3PS6A 4H1LB 1N7ML 2HRPL 4Z77A 3UBXA 4MJHA 1JZ7A 1EGJA 1T2QH 3S8GB 3TYFA 3R1GH 4G3YH 4Z7QF 4W6XB 1UWGL 2LLGA 4QO1B 4S10A 2BS9A 5F3BA 4E42B 5CZRA 1OAXL 3JVFC 4G1MA 3S36L 4ZW7A 5J6SA 4KI5E 4S0TD 3DVGB 5DZAA 1AHWC 1IX2A 2F53A 3U4BL 3BZFB 5AOIA 2VT0A 4XOAA 2VZOA 4OF7A 1O6SA 1ZSDB 4RZKA 3INOA 2AGJL 1OCZB 2CJSA 3FFDB 3FONA 1UB6B 1P5UC 3MGAA 1RLBA 4LSRL 1KTBA 4K94H 3MJ6A 5TDOB 4BQCA 1I3GL 1SNRA 3OMAB 1JXFA 5I1EH 2MQCA 5DQDL 1H9VA 2EDDA 1QATA 1J12A 5LNDA 1I85C 3BC9A 3QJTB 3KLQA 1N7MH 3G04B 4XO9A 5EEVA 4WWPA 3Q1SL 1QI4A 5I1GH 3RJQB 3SO3C 5EOCH 1UWGH 4UQDA 1AGFA 1A02N 3I9GL 4YIQA 4IRJD 3ZE2F 1BVZA 1E40A 4DO4A 4X6EA 5CU5A 3WIHH 5HHQA 3P4LA 5I8KL 1NEZA 3SKUD 4X4XB 2MHAB 3IMSA 2YAQA 3U4BH 3FH7A 2DJ4A 3CN1A 2HCZX 4K7PH 2HN7B 2ZT9C 4K7PY 4P3WA 4Z7VE 1NGYB 1E9QB 1KIUA 3L3DA 5DJ2B 5A2FA 3MCKA 1CE6B 3K91A 4I7ZC 4CW1A 1TSHA 3L4YA 1I3GH 1KN4L 2WXOA 1OT2A 2X0UA 3TJPA 5DQDH 3WG7B 1UD2A 2WBKA 2P4AB 4OCXL 4XODA 2NCEA 2ICWB 4X5XA 1FZMA 5EU3B 3DV6A 1ADWA 3MROB 4XCCL 4KUZL 5ITFA 3P3UA 2I69A 1MHPH 2J1KA 2EO1A 1JJUA 5ESVB 3SPVA 3I9GH 3LSOA 3QZLA 4OJFL 5DURD 5E08L 3CXHK 3B34A 4JG9A 4U0RC 1T0MA 4W9EC 3Q5OA 4PBXA 5JXED 4H0HB 2ZCLL 3QIBA 3M8OH 4NDMA 4ORZC 3ABZA 4HUVA 2WQVA 3VDCA 5DK0A 1YQVL 3FOLB 1A14L 3CVIL 5IVXE 1I1YB 3NP3A 1F6LL 3T77B 1SVCP 3RDTB 1D2PA 3RNQA 5BS0D 2BXZA 1PD0A 5BZDB 3CN0A 4KTEL 3MUHL 3D87B 4B9FA 5DJCA 3VGAB 2NDGA 3TEYA 3UPRA 2AJYL 3QUXB 1CBVL 3ZGIA 4NZDA 3PL6C 4Y1AA 1BD2D 5FECB 5D5MF 3L48A 1FC1A 3T6XA 2GK0B 3SYAA 1QWUA 3IKKA 1C5DB 1GGTA 2CWRA 3FH8A 4ZZFA 1EJOL 3BVNA 3FT2B 4N2CA 43C9B 1NQBA 3X1NA 4RX4A 1AD9A 1QPKA 1M53A 3KPMB 2AQQA 4G7VL 4TSBL 3QXDA 4ZW6A 2L04A 5IFJB 4PLKC 2Y6SC 5AB0A 1IQWH 2CIKA 2BMKB 5E1GA 5A7BA 4JPKL 1YQVH 4ZSOB 1G1KA 1F13A 3BT0A 3CVIH 2A6KB 2CBMA 4BXSV 1NCWL 3AGWA 3EFDL 5E23A 1SDYA 1IAOB 1QPPA 2IADA 2JXMA 3I6LE 3WEOA 4CUCA 4DUVA 4AVIA 1N0XH 3QHTC 5TDPA 1JGIA 5JA9A 3CBRA 2F7PA 4WWKA 1USQA 3V0DA 2V2TA 1A3RL 4D9QE 3RZCD 4PGBA 5FOBB 1CBVH 4N90E 4Y2LA 1M7DB 4P57A 1PIFA 4U6XA 3W81A 2J88H 1IGYB 5E6IC 3CSFA 1J8RA 1P6FA 2BS71 4MD4B 3BQUA 5EA0L 4N68A 4HKXA 1ZLEA 4WNQB 4MQ7A 5H37G 3A22A 4ONGH 5I28A 3L5JA 2E9BA 3VXNA 3I84A 4FTVE 2BOCB 2YWZA 2JQAA 4GO6B 1DVFB 4KJWC 2BSDA 2X3AA 4TSBH 3HNVL 1PG7L 3I02A 4NQED 2O93L 4S11A 2DWXA 3NFSL 3QIUC 4JRYE 4DGIH 5L88H 1U8NA 3GBML 4DCQA 3KPNA 1CLZH 1OGSA 1JPSL 3QDME 2DQTH 2XCMC 5EC1B 3D51A 3V4VH 4YAQA 1RAMA 3N44B 1H6EA 3EFDH 4F9PA 3V0FA 5FYJU 3DTDA 2VDLB 1AZZC 4HJ1A 3X14A 5E6YA 5HHXL 4JCWA 1A3RH 5MENA 2WWKT 4G42A 4WKZB 5GRVL 1W72A 3ZHNA 4FJYA 4GRLA 3NSCA 3ZX1A 3R4RA 3GBNL 2ED9A 5EA0H 4MJ6A 1RZGA 5LG1A 5JDSB 5K9KB 3TBSA 2CJUH 1J9SA 1UFUA 2OTPA 4HK0A 4MX7A 1MN4A 1U3YA 5FM5O 4B60A 5IWLC 3CZNA 3MRGB 1QVOA 2Y7NA 1S7UA 2V3DA 5DUJA 2UVEA 3LS4H 5T1KA 3RGVB 4Y4KC 1TTAA 4HDIA 4G9FA 3GBMH 4X7TA 1XH1A 3VXMB 4JFDA 4TS6A 1NAKL 4YC2C 4LCWA 3EF7A 4AQAA 3H56A 4MNQD 3D39D 5H94A 4YXLH 1VF5C 4UQ2B 4AC2A 4ERSH 3DYMA 5JHBA 1Q9LA 2JKTM 1J0HA 3P1VA 5HHXH 1HH6B 1OPOA 4PJDA 1WCBB 3V6ZA 2ARWA 3VXRD 2GT9A 3IFLL 3OVUB 4NP9A 2GC4C 3LIZA 1CGVA 1IU1A 4JG5A 5F6HJ 3H53A 4PJEB 4AW7A 4EQ2A 5IUCA 1I8LA 3GBNH 3QI9C 1WCQA 1J10A 3O41B 3O2WL 2BHZA 1Q0EA 3EHBC 1TCMA 3EUDA 3MJ7A 3ZW3A 1HCFX 1VFBA 4HG4J 3UCRA 5DGRA 4QXGH 1A4JA 2WLIA 3HCVA 4E9VA 4P2RE 4KHXH 4FYQA 5JHDE 5KBKA 4N85A 3T3MF 3FQXA 4EDXA 3EADA 4GEIA 1SJVA 4P59H 4GW4B 1NAKH 2FEDD 4L8CA 3B2VL 4PG2C 3MRKA 1ES0B 4KY2A 4L9DA 3ESNA 2PXYA 3OF6D 1MLCB 3WV0A 1FLRH 5IT2L 4JY6B 2WO2B 2HT2D 2NX5A 2EC9T 1TIUA 4ZXBB 3MN8A 1JCVA 3A6CL 4WV1C 4Y2OB 1G1OA 1SJMA 4RGNB 4WEEA 1K8IB 1UB5B 3UFIA 2R2BA 1L0QA 4N24A 4N2LA 5CIPA 2CGYA 1QBML 2BVYA 3NK4A 2RH0A 1INQB 4BKTC 2VLLB 4JN2B 1B90A 1A6VL 3ISRA 4Y4FD 4XNQB 1DDHB 5KAQG 2SEBB 1T66D 3BQVA 3BWUC 2JCWA 3JWDH 4YFEA 2XPZA 2QBWA 2IXQB 3B2VH 1Z0MA 4JCLA 3ZT7A 1J5DA 2VGLM 3TBYA 5DK2A 4PYHA 2E7BA 3MA7B 4ZFFB 3D9AL 3BMWA 2ARJQ 3IJSB 5I5RA 1MRCL 1RJLB 2F18A 1L0XA 5IT2H 1A7OL 2JELH 2QSTA 5HDOA 2HJLB 3NCJH 1UXSA 5MI0B 5E0FA 1MHEA 3F5WB 3PGCB 4P9HH 2AXJA 4YFDB 1B3IA 4U3CA 2DIEA 4OZIB 1N2RA 1HC1A 1LD9A 2K0RA 2YXVA 3ATEA 5ANME 4QAMB 1M56B 4H1LA 2H45A 3N06B 4WWNA 4HV8B 1FPTL 1PZAA 2Y25A 3B7YA 4WUUE 5BQDA 3VGEA 3VVWA 2A6JA 3QHZL 1DBKL 3MRPB 4KKAD 4QO1A 4UOJA 4DZ8A 1IGFL 4E42A 1M1XB 1AKPA 1XB8A 3CMGA 2DMGA 2K7QA 4L0ZA 3WFHB 3P69A 3PDOA 5FUZL 3S8FB 1BZOA 2Q86B 5D7LE 5F1NB 2YEQA 3UO8B 3IGLA 2IBGA 2WXNA 2QLVB 4NKQB 3SPCA 1MRCH 3BZFA 4HS6B 1FVCB 3MBEC 3PWJB 4WLCA 5ADPL 1CGUA 1A7OH 2P80D 3RBSA 4XZUB 1FG9C 2KQNA 1ZSDA 4KITB 4G7SB 1A3LL 1AHWB 2BP0B 2X28A 4U2YA 5CD3B 4R8WH 1GAFH 3FFDA 4OGZA 5DFAA 1UB6A 3GB7A 3R7RA 1WAAE 4KNSA 3B37A 3ZT6A 1PGRB 3QUKB 3TVMD 4XN4A 4KPHL 1V7NL 1P5UB 1PZSA 2QQKL 1AAJA 4F58H 4F1SA 2WLJA 1F5WA 1KYFA 3G04A 4I3RL 4DVRL 2GUOB 4N4YB 1C12B 4J7RA 4QY8A 5K9OB 1KNOB 1EO8L 3RB7A 1IGFH 5EORL 4RGOL 1B4JL 2V4LA 3SO3B 4I0PD 2LW3A 3WY3A 2MHAA 2AW2A 4JFEE 1EJ8A 5EBMA 4FGMA 2OQJA 1MJUL 2V7HA 1FHNA 3N41F 1OE1A 3GNML 3F05A 3FQ1A 5BW7A 2Q3XA 3ALPA 1NGYA 3S5LG 1E9QA 5JQIB 3BN9C 7FABH 5DD1L 3UAJC 1K3ZA 2QGDA 4OUOA 3SDYH 1S7VA 2P45B 4HJSA 4DQOL 5EF0A 4S1RL 3FFOA 1UM6H 3VGDA 1HZHL 1PL3A 4PRBB 3TBTB 1F0LA 1G6VK 3QIWA 4XB3A 2QQKH 2XWCA 5FO7B 3C2SA 4I3RH 2ICWA 3OPZH 3ABKB 4DVRH 5EU3A 4LHUG 5DYOB 1BQLL 8CGTA 1FL3B 1TZHA 2CGRL 4ODVH 4X6CA 4F2MB 1EO8H 4EN3D 2ZE0A 5ESVA 5FFGA 2C1OB 2VXUL 5AOJA 4FFVD 1B4JH 4R7XA 5CP3A 1BREA 4HSAC 1P2CB 2B16A 3X1FA 2DWEB 1ONQB 2APVA 1WQVT 4MCNA 5L4IA 3GO1H 4PY8I 2JFCA 2VSCA 4PJIB 4X9HA 1UCBL 1MJUH 3WAKA 2JK5B 3ZO9A 4U0RB 5AWNL 4YPJA 1K2DA 3FOLA 5E8EB 1NPUA 2DMHA 4OLYH 2ZPKL 5DD1H 2WO3B 1I1YA 3T77A 3CK0L 5A3IC 2ATAA 5IV2B 1NCCH 3RDTA 4RAUA 4S1RH 1HZHH 2JCCB 4JQIA 4IKLA 1A7RL 1ZS8B 4QYOB 4WJ5A 3CDYA 5K9JH 3TF7C 5T3XL 4DVBB 1DBAH 5ALBL 1C7SA 1YCSA 3QUXA 3RLSA 2WD0A 2DYRB 1V54B 3QZPA 2GK0A 3F7QA 5GGTA 3T6QC 2F9BT 3CCHB 1C5DA 4TSAH 3G5WA 4N2NA 3FT2A 3TYGH 3NIFE 3PL6B 2PWGA 3T1WA 1M6UA 2VXUH 4XBEL 1FZJA 5I6XC 4N2HA 1QR1B 2FJUB 3DSFH 3KPMA 3QZWG 4UBDD 2C9SA 4HK3N 1ZPUA 4U1HB 5IFJA 2BSTB 1T6BX 5TH2A 1BQKA 2ZIDA 1UCBH 4LNVA 4XP1H 1DJHA 3TF4A 3L9YA 5AWNH 3ARGD 4ZSOA 3RI5F 4NZUH 2W92A 4G7YL 1J9RA 1IVTA 2A6KA 2WP3T 2HX7A 1QFOA 3FMGL 2L7UA 4TL4A 1IAOA 5G5DB 3SBWC 4C4KO 3GJFK 3ILQD 4TUKH 3E3QC 3QO0A 5KSUA 3UOAB 5JNYB 1AGDB 4TNFA 3WSQH 2DM7A 2DJMA 2HZHA 2EKSB 2BM3A 2VXQH 5HSFA 5FOBA 3IU3A 3K72B 1QLFB 1M7DA 5C7ZA 1CCZA 2VLKB 5G2NA 1ORSA 1UZ8A 4MD4A 5E4EB 1ANUA 4PJ8D 3T5WA 5C6WH 4NAMA 5JIMA 1OLZA 4UOZA 3V2AR 2BJMH 4GKZA 1OM3H 5B38B 5E6IB 4JZOB 5C07D 2RR3A 1WJ3A 3ZXAC 3RUGE 3ZTEA 5I0YA 3HI6L 3TH2T 3LEXB 1G6RA 1U6AL 3U1QA 4CC1A 4WU7B 4ODXB 3WLBB 2XJKA 3P3YA 4FKEA 3QIUB 4Z8FL 1B9KA 2DLFH 3D3VE 1MWAB 3WFCH 4AZ8B 4BZYA 5T1LB 5ESAA 2Z31A 4FQIL 4ZOEA 2XHNA 1AIFB 4PJDF 4DK5A 2HUHA 3F6JA 1FIEA 3HHMA 5JQHC 3JWOH 2EVIA 1OCWH 4X6DA 4NQXB 3V6BR 3P0YL 5JDSA 2VLJE 3VFTA 4Z76B 4LL4A 2KUTA 4X7SL 3CN4A 2D7MA 4YUEH 3MR9B 3Q2CA 1OGTA 2HX9A 1KIPB 2WYIA 1KENL 1KGYE 3MRGA 5DFWH 4HAFA 3NAAH 2PW1A 4ZNEA 3BKYH 2YARA 1BVLA 1LYQA 4G70B 1BXVA 5I5IA 5GRJL 4XMZA 3RGVA 3DHMA 3P11L 4QJ5B 2VR7A 3KPPA 4N6QA 3VXMA 3VXTB 4W68A