The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
17
|
sequence length |
131
|
structure length |
131
|
Chain Sequence |
GPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPKWNQHYDLYIGKSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKLGPNDNDTVRGQIVVSLQSRD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Autoinhibition of the HECT-Type Ubiquitin Ligase Smurf2 through Its C2 Domain
pubmed doi rcsb |
| molecule keywords |
E3 ubiquitin-protein ligase SMURF2
|
| molecule tags |
Ligase
|
| source organism |
Homo sapiens
|
| total genus |
17
|
| structure length |
131
|
| sequence length |
131
|
| ec nomenclature |
ec
2.3.2.26: HECT-type E3 ubiquitin transferase. |
| pdb deposition date | 2007-06-15 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00168 | C2 | C2 domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Immunoglobulin-like | C2 domain |
