2JRHA

Solution sturcture of human mekk3 pb1 domain cis isomer
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
QSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into the Binding Properties of MEKK3 PB1 to MEK5 PB1 from Its Solution Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase kinase kinase 3
total genus 12
structure length 93
sequence length 93
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2jrhA00
2FIFA 4ZYNA 3ONSA 2JF5A 4E74A 3QIJA 4HDOA 3ZTCA 5L95C 1QZEA 3R7QA 4DHJD 4NQLB 1LXDA 4KZ0A 4PS7A 5AZHA 3X23A 5J2RA 4BFRA 4FULA 3DVNU 4K1RB 3NZSA 5J18A 1WXSA 1TZ1A 2L8JA 4G11A 3PPAA 2M8SA 3IHPC 3NY5A 2HD5B 3VTVA 2K1FA 3UQBA 3BINA 4F1SA 2RGFA 3H7PB 5DPRA 3SD5A 2K8BA 2ZCCA 2O2VA 2AL3A 1FXTB 1IYFA 4JGHB 3NOBA 2J0JA 2K6QA 3WIMA 5DPSA 2DZJA 2XEWA 4DDGD 4PYZA 2M1MA 2BF8B 3PREA 2Y5BB 1KLVA 3ZNZB 4ZRIA 3AU5A 3VXWA 3QK0A 1K8RB 2LRUA 4NQKE 2PEAA 3I3TB 2JWZA 2IO2B 1WX7A 2GBMA 3PLVA 3ZNID 3EC8A 4MGIE 3MHSD 2RR9A 2DAJA 2O6VA 2G3QB 4AWJA 3O65B 4TKNA 1GUAB 1WRDB 2IBIB 2D3GA 4GDKA 1SE9A 3H6NA 3S2AA 3WAMA 3T8MA 3V6CB 1KJTA 2N7DA 2RD0A 3PHXB 3APFA 3QHTA 3CF6E 2KWCA 3U8ZA 3HM6X 1Z2MA 2GMIC 3DBHI 1E90A 4G0NB 2MRPA 2M0XA 2FCSA 4WJPA 3N32A 2DZKA 5AZGA 1J8CA 2C5LC 3QCAA 2L7RA 2KNBA 3QQ8B 4OVUA 2KANA 3KW5B 3W1SA 4M8NA 4JQWC 2IYDB 2ZNVC 2LXAA 4GMVA 3APCA 3UQAA 1TTNA 2CHZA 2XK5B 3K9OB 3NS8A 3OAWA 3KH0A 3IFWB 1EF1A 4GDLA 4B9KA 2NPTB 4CYEA 2G4DB 3LDZE 2V4LA 1EUVB 2WDTB 2WYQA 4II3B 4X57B 5CHFA 3VTWA 1TGZB 1UZXB 3A9JB 2HJ8A 1V86A 2KDIA 2JXXA 4MM3A 2GBJA 3DQVA 4W9DA 4XC2A 3A4SC 3ML8A 2BYVE 3QX1A 4I6LB 1GC7A 3VAWA 5AZFA 1V80A 4E71A 1M94A 2BPSA 2FIDA 2KQ7A 2DZIA 2OOBB 3H9DA 3OJ3A 3PZDA 4JL9A 4ZRKA 2BYEA 2KFJA 2KLGA 4AOFA 1ZGUB 2C9WB 2K39A 2O6VD 1I42A 4E3CA 1YD8U 2KDBA 2KJRA 1WX9A 1WIAA 4KDIC 3A4RA 3QC8B 1LM8B 4A3PA 3ZNGC 3PS6A 1Y8RC 2MCNB 2R2OA 4IG7B 1J0GA 2A5UA 2DYOA 3X0WA 3W1YA 1UELA 3PT2B 2KX3A 5J17A 3CSFA 4AP4C 2IZVB 2KKCA 3TIXA 1GG3A 4IM2A 1NI2A 3ML9A 3VHTC 2HE7A 3CMMB 5JZEB 2R2QA 3VUXA 3EFUA 2FCQA 4KSKC 1WZ0A 3VDZA 2NBUA 2KJHB 2NVUI 2IO3B 3T9LA 3IBEA 5LXHA 2CHXA 2GOWA 2KMAA 3U30A 5D6JB 1RLFA 4KV2A 4DK5A 3OLMD 4FA6A 2XK5A 1E7VA 3WA0A 3GOEA 4MELA 4CO7A 5HKHA 1UBQA 3A9KA 2CS4A 3QJZA 5AEKB 2ZZPB 2FUHB 3GZNI 4MSMB 1VCBA 1WGRA 1SGHA 5TR5A 4B95A 3TMPB 1R4NI 5D7GA 2J0KA 4P7IA 2KJ6A 3SU8X 1WM2A 1WJ6A 3NHEB 5D2MB 1WI0A 3KUZA 2L05A 4BOSC 2FAZA 2VRRB 5IAAC 3N30A 2LGYA 4ASWC 4BKTA 5CHWA 2IY0B 4HK2A 2LGDA 2LUEA 1E7UA 2K25A 3A9JA 3C0RB 4BKSA 3WALA 1XQQA 2GBKA 3M95A 3RZFA 2KZRA 4IW0A 5FR6A 2N7EA 2KDEB 1JRUA 2FNJB 3DVGY 3ENEA 3L54A 4W9IA 2AL6A 2DHZA 3A1QB 2ASQA 4HCPB 2KWVB 2DENB 4IM3A 3VFKA 2XBBC 4EZJA 3CSTA 4GB9A 3HK0A 2WWZA 1WR6E 2L76A 3ZDMC 1KM7A 1WJ4A 3JVZX 2M17A 3MJWA 4K81A 4NY0A 3QWZB 2LZ6A 2AYOB 3RD2A 3MTNB 2MWSB 3PTFC 4W9FA 1P0RA 3KUCB 4K7WA 4FJYA 2KMCA 4K7SA 4WWPA 3RCZA 1ZW7A 4M0WB 1Q1OA 2BWFA 3JSVA 2JT4B 1RRBA 4XX5A 2MSED 2NBWB 2CKHB 3TL5A 4DXAB 4MJSA 2C7HA 3B08A 3M62B 2K6DB 3UIPB 3B1LX 3QA8A 2EKEC 3SHQA 3PRZA 2KTRA 1UD7A 4LCDE 1WJUA 4WJNA 2Z0DB 2I1JA 4KZCA 3V61A 5CX3A 4ANWA 1WMHB 3ZDTA 4II2B 4F8CB 3B0AA 5IA7A 2NBVB 1MG8A 3VVWB 2KFKA 2UYZB 3DCGA 3WAPA 1PQSA 3EHVA 4LJPB 4MDKE 3DOWA 2JPHA 4JIOU 1S3SG 3DVGX 4TQ0A 2PE6B 1VD2A 1P3QU 3UF8A 3H7PA 3IG3A 3Q3FA 3BY4B 4KIKA 2KTFA 1AARA 1WY8A 2N4FA 4W9CA 3DBLI 4IWOA 2LVPA 3L08A 3V62A 3AI5A 2Z0EB 3N3KB 3L10B 3UIOB 4EZKA 2D10A 2DZMA 1WXMA 4HPMB 3A9KB 1OEYJ 2AEHA 2C60A 2LD9A 4EZLA 2KN5A 2QHOA 4URKA 2JRIB 2ZNVB 5EDSA 2D2QA 4GN1A 4KIKB 4F7ZA 2O2VB 1V9JA 3L13A 2KQSA 2MLBA 4HJKA 4A20A 2LASA 1UH6A 4FADA 3JYUA 3QARA 3ZUNA 4CHKA 3A1QA 2GBRA 2AWTA 4FJZA 4GGQA 4ANVA 4FN2A 2B3AA 2KWUB 2N1WA 3PRPB 3PRMB 2PJHA 2LWPA 4N9F4 4GSWA 4AUQC 1U4AA 1WGDA 1WXAA 3HIZA 3M3JA 3PSEB 1V5TA 4HWIB 3DBSA 1XD3B 3P2BA 3ZKJC 4IUMB 5LLIA 2UWQA 2NPTA 4XZ4A 4BKSD 5G2NA 3IVFA 1WGHA 1GJZA 4MGKE 2NS5A 3RYTA 1E8XA 4DBGA 2L3ZA 3VUYA 3PLUA 4FHKA 3Q3JA 4TQ1A 3VH3B 3DDCB 2ZPNA 1WE7A 2IO1B 2JVCA 1WFYA 2MBOA 5E6NA 4ANUA 2KXJA 2KD0A 4MEMA 2Z59B 4KSLC 3V60A 2D11A 5KHQA 1WH3A 1WF9A 2ZJDA 3V6EB 1YQBA 1WM3A 3VH4B 4BBNF 5JHAA 4EOYA 4EUTA 3RT3B 1C3TA 2C7MB 2NR2A 4W9EA 2RSUA 2JUOA 4IC7B 4MGZE 1IPGA 2JZZA 4DHZB 2MP2A 1P98A 2L0FA 1LQBA 4EEWA 2CHWA 5L83A 4FJVB 4BVUC 1V81A 3AXCA 1E8WA 2I1KA 4NJ6A 4BOZB 2ZPYA 4LJOB 1WR1A 3ZO5B 4AJYB 4HLEA 3PVLA 4GIVA 3ALBA 1TBEA 3AU4A 3LJ3A 4OVVA 2ZEQA 2M4NA 3ZNHB 4MSQB 4TUUA 4ICUA 4WJOA 2BYFA 1Q5WB 2A4ZA 1X1MA 4LDTD 1V2YA 3ZLZA 3ZW3A 3KYCD 4W9JA 2L00B 5KHOA 4EKUA 1HE8A 1Q0WB 3ECIA 5CHVC 4EFOA 2PE9A 3H7SA 3QAQA 5D94A 1Z5SB 3RUIB 1IP9A 2FCMA 4TV3A 2JZ3B 4M8MA 3A33B 2JY6A 2MBQA 2MQJA 4J6IA 2CR5A 2KVRA 3TCAA 1OEYA 2DYBA 2LXCA 5LXIB 4NPNA 3ZRCA 2NCNA 1YJ1A 5C1ZA 2MP2B 2O6VB 2IO0B 4I6NB 1RFAA 4G3XB 2LJ5A 4DWFA 4FLHA 5E6OA 1V49A 2DYMA 2PPHA 1OTRB 4KDLB 4KVGB 4W9KA 4IWPA 4ZRJA 2RPQA 2MA9B 2W9NA 4LDTB 1E8ZA 2KC2A 3WANA 2MBHA 4MH0E 2DAFA 4RM8A 2YLMA 2C7NB 2MBEA 3KUDB 2DX5B 4MJSB 2JRHA 3D32A 3HM3A 2BKRB 1E8YA 1WMHA 1XT9B 3APDA 3ZTDA 1UGMA 3DPDA 3RZWC 3VQIA 1YX5B 2G4SA 3M63B 4IWQA 4NNJB 1WX8A 2LGXA 4BBNC 2N1VA 3AULA 2IY1B 1T0YA 2KOXA 4GOCA 5JHBA 2MBBB 4GU2A 2BKFA 4WQOB 4WWNA 4HDQA 2CU1A 1ISNA 2N9EB 2LRWA 1V5OA 4HCNB 2LVOA 4IM0A 4WJQA 4DHZE 4DDID 2ZVOA 1D3ZA 4FHJA 1L2NA 1SIFA 4MGYE 4RM9A 4FBJB 1UBIA 3SDLC 1CMXB 3WAOA 4PYUA 2LI5A 4WAAA 2KC1A 4NJ7A 3L16A 3R3MA 3U7DA 1WXVA 1YIWA 4K7UA 1KOTA 3UGBB 4ICVA 2REXA 4PS3A 4GXBA 1I35A 3H1UA 3VTUA 3OJ4B 3W1SC 1V6EA 2V3SA 4GDLB 2OJRA 4HXDA 3TJPA 5CTRC 1WGGA 3K9PB 3PGEA 4ZDVA 2WX1A 1F9JA 1R4MI 2KK8A 3HHMA 4A3OA 3R66C 4AJWA 2KX0A 4ANXA 5G55A 2K8CA 4W9LA 2KTRB 5DPTA 2L0TA 5DCNA 1EO6A 4HVBA 5BO4B 3ZRFA 5DPWA 1WGYA 5E6PA 2J0MA 2J7QB 2KDFB 2KO3A 4WWOA 2ZCBA 1J19A 4W9GA 4BKGA 1EF5A 4W9HA 1LFDA 1YX6B 2K8HA 2FCNA 1H4RA 1OQYA 1WJNA 3DVNV 1WZ3A 4I6PA 3PHWB 1L7YA 3TBLD 2EMSA 1P1AA 4G50A 1NDDA 1GNUA 2BGFA 3KYDD 2KFKB 4B6WA 1GC6A 2MX2A 1ZKHA 2N9PC 2YVCA 3L17A 4NAWA 4YL8A 3ZVVA 3EECA 2D07B 2LVQA 4GDKB 4PS8A 3DBRI 1H8CA 1E5WA 2N9XA 3R7RA 4RMAA 2EMTA 1A5RA 4JLCA 1G6JA 5JH5C 3ZIMA 4NAWB 2V1YA 1C1YB 2G45B 2HTHA 2KHWB 1RAXA 3VUWA 2BWES 3UINB 4DHJB 1OGWA 1NBFC 1WYWB 2WX0A 5GMVA 1S1QB 3JSVB 3RULA 1P9DU 2KLCA 3PV1A 4HPLB 5C23A 1BT0A 2MW5A 2GBNA 3JW0X 3KVFB 2ZVNA 3NZUA 3L0WB 1WE6A
chains in the Genus database with same CATH superfamily
3AEAB 3ONSA 3Q8EA 4HDOA 3X23A 4BFRA 4K1RB 4WH4A 1WXSA 1TZ1A 3PPAA 2DWQA 3NY5A 2HD5B 3VTVA 2K1FA 3BINA 3AE1B 2I38A 2AL3A 1FXTB 3RNFC 3NOBA 2J0JA 4DDGD 2D3AA 1OQQA 4ARCA 3QK0A 1QLBB 1L4ZB 3B2GA 4NQKE 2JWZA 2IO2B 4WURA 1JWAD 2GBMA 3MHSD 2O6VA 3O65B 1DYQA 1WRDB 1V8CA 2D3GA 4GDKA 3H6NA 3PHXB 1AN8A 3DBHI 1PFDA 3AE7B 2V3NA 2DZKA 3KW5B 2ZNVC 2LXAA 4GMVA 2XK5B 1N63A 4GDLA 4X57B 2WDTB 1EUVB 3TEWA 1PGAA 1V86A 4BZAA 2KDIA 4LNIA 1BUIC 3TSSA 3DQVA 4NJCA 2K9XA 3ML8A 4L2YA 2K5PA 1V80A 4H2AA 4E71A 2BPSA 3OJ3A 1YJIA 2IGGA 2K39A 2RDBC 4E3CA 1YD8U 2J53A 1WIAA 3QC8B 3NVVA 2R2OA 1YOVB 3CSFA 1VR9A 2L32A 1ACCA 4RNAA 1GG3A 3N1YC 3CMMB 1DOYA 5JZEB 2R2QA 2WS3B 3VUXA 2FCQA 2KJHB 5LXHA 2GOWA 2KMAA 4KV2A 4DK5A 2XK5A 1F1HA 3GOEA 2CS4A 2B76B 2FUHB 3ZXVA 3MJ5A 4EE2A 3TMPB 3W2DA 4P7IA 1WM2A 1QQRA 5D2MB 4BOSC 3KUZA 4ARIA 5IAAC 3U4EG 1GPXA 4XDDA 2K22A 2QC8A 1L0YB 2LGDA 1T6BX 2LUEA 4P16A 3TUOA 1TS5A 4D2KA 2GBKA 1MPEA 2KZRA 1WSPA 3DVGY 3L54A 1JRUA 2N7EA 2ASQA 2KWVB 2XBBC 3GP7A 5G5HA 3MTNB 4W9FA 3KUCB 4WWPA 1UUPA 3OWEB 1Q1OA 1V1OA 1KH0A 3TL5A 2CKHB 3IAS1 3BZDB 3UI3A 3SHQA 2EKEC 4P1CC 2KTRA 4LCDE 4KZCA 2KAJA 5CX3A 4II2B 4N6EB 5BYQA 1MG8A 3ETRA 2KFKA 3EHVA 1AWDA 3DOWA 4JIOU 5BMIA 3LYYA 3ABVB 4TQ0A 2KTFA 2D5GA 4WQMA 2LMCA 3Q69A 3L10B 3MC9A 4RH6A 2D10A 2DZMA 4HPMB 3A9KB 1OEYJ 2QHOA 4URKA 5EDSA 2ZNVB 4GN1A 4F7ZA 1ZDXA 2O2VB 2KMMA 3BVGA 1XLPA 2JXTA 1FD6A 1JROA 3Q8FA 4S17A 3JYUA 3QARA 1GB4A 1SE2A 2JU6X 3PRPB 5G5GA 3Q6BA 4HWIB 5G2NA 1FRRA 5IP4D 2BB5A 2NS5A 3RYTA 1MHHE 2L3ZA 3Q3JA 2MHJA 2Q5WD 2ZPNA 3Q8CA 4ANUA 3U52E 2KD0A 3CIRB 1WH3A 2JZPA 2IDYA 1YQBA 4XWWA 1C3TA 4HJGE 4W9EA 4ZRQA 2RSUA 1ENFA 2L0FA 4OW0A 3AXCA 4BOZB 1EWYC 1TJEA 1ZPSA 2Y3AA 2ZEQA 4MSQB 4TUUA 4EKUA 1HE8A 3ECIA 3H7SA 5D94A 2FCMA 2JY6A 1I4RA 2CR5A 4NPNA 1KTKA 3MC8A 4G3XB 2LJ5A 4DWFA 3R2IA 3VR8B 1OTRB 4IWPA 2R61A 2KC2A 4LNKA 2MBHA 1I4PA 1DOIA 2H88B 2JRHA 1CZPA 3IT6B 1NI3A 1E8YA 1WMHA 1XT9B 3CWIA 1XLQA 3VQIA 1M4VA 2LHEA 4KGTA 3AULA 2KOXA 1FO4A 1FRDA 3BK2A 2MCNB 2FBWB 2N9EB 4WJQA 1D3ZA 1L2NA 4RM9A 4FBJB 2BTEA 2NTTA 2JX5A 2M56B 4P6VF 1HEZE 4K7UA 3BWUD 3DHGC 4ICVA 1A70A 2REXA 3NVWA 1I35A 1V6EA 2V3SA 1SJED 2DBYA 3PGEA 4AQ7A 2KX0A 4ANXA 5MPOA 5E6JA 3O13A 5E6PA 3AECB 1LFDA 1ROEA 3DVNV 4I6PA 1XCTL 3R8BA 2INCC 4DQOC 3AE4B 2MX2A 1B9RA 2WXOA 3L17A 4NAWA 4PS8A 3DBRI 1L0XB 4JLCA 2MEKA 4NAWB 1C1YB 1RAXA 2BWES 1OGWA 1WYWB 5GMVA 3JSVB 3LXFA 3PV1A 1WWTA 1ZOYB 1HTOA 4OZCA 2JF5A 2XNAC 5L95C 4NZLB 4YSXB 3R7QA 4NQLB 1LXDA 4KZ0A 4PS7A 2GB1A 3DVNU 3NZSA 3NVZA 3EA6A 1LO5D 2V4IB 1T0RC 1RM6C 4US9A 2O2VA 3RN9C 2XEWA 3LB8C 1ET6A 2LRUA 2PEAA 3RI7C 3BIID 3ZNID 1FM0D 1FFVA 2MJEA 2G3QB 3HVDA 1TS2A 3S2AA 3T8MA 1J7BA 3VRAB 1HTQA 3MC0B 1KJTA 3APFA 1JQ4A 1UGJA 1WYGA 5TSSA 1Z2MA 2GMIC 2MRPA 2N9LA 4N58A 4WJPA 4R3DA 5AZGA 2QIEB 1J8CA 2BB6A 3FILB 2L7RA 2INDC 4M8NA 4JQWC 2IYDB 3UQAA 3APCA 1C79A 1RWSA 2BW2A 3NS8A 1C76A 1VRAB 4K3CA 1EF1A 4B9KA 2NPTB 1FXAA 2G4DB 2V4LA 4II3B 3VTWA 2VZKB 1F52A 2I2YA 4FXCA 4MM3A 2AX5A 3VRBB 3HVZA 3AE9B 3A4SC 5AZFA 5GXGB 4ZRKA 2FIDA 2WP9B 3DBLB 3H9DA 4US8A 2WXRA 3L4PA 2KFJA 2WLBA 4AOFA 1ZGUB 2C9WB 3A4RA 1IUEA 5FKAC 3ZNGC 3PS6A 2WXQA 1Y8RC 4IG7B 1J0GA 2DYOA 1UELA 2LJIA 5J17A 2ZW1A 4XDCA 2KKCA 2PW9A 4IKGA 4JX1C 2HE7A 4RCOA 4TMAB 4Q2JA 1JCKB 3P42A 3T9LA 3IBEA 4JWUC 4OZAA 1XLNA 3KWVA 4K3BA 1DGJA 1LGRA 3OLMD 4FA6A 2RPVA 3RNCC 3WA0A 4MELA 3A9KA 5HHDG 3QJZA 5AEKB 3GZNI 4MSMB 1JWMD 1WGRA 5TR5A 4B95A 2V9HA 2J0KA 3AH7A 3C8YA 1WJ6A 2FAZA 2VRRB 3N30A 3Q3NC 2LGYA 4IDIA 4BKTA 2IY0B 4HK2A 2K25A 3A9JA 4BKSA 1K51A 1QILA 3M95A 1HZ6A 1FIQA 5FR6A 1T5XD 2SAKA 4A9AA 2AL6A 1SJHD 3A1QB 1CK1A 1E0ZA 1EU4A 1I4GA 2Y5PA 5IOIA 3CSTA 2V0GA 2L76A 3ZDMC 1N5WA 3JVZX 2M17A 4NY0A 1TY0A 3QWZB 2LZ6A 3PTFC 4K7WA 2KMCA 4M0WB 2E3TA 2JT4B 2NBWB 4DXAB 4MJSA 4N59A 2C7HA 1YNTE 3B1LX 3QA8A 3PRZA 3BVZA 1TZOA 2Z0DB 2I1JA 2LGIA 3V61A 3ZDTA 4F8CB 3B0AA 1R7SA 2WDQB 5AUIA 1SB3C 2UYZB 3B2FA 3WAPA 2VH1A 2JPHA 4KKJA 3EGRA 2N7JA 4M01A 1VD2A 3Q3FA 3IXSA 1E7PB 3BY4B 4KIKA 4C80A 1R4MB 2N4FA 4W9CA 4CQNA 1HQRD 3N3KB 3Q8BA 3UIOB 1WXMA 2IPKD 2QEJC 4ZHOA 4EZLA 2D2QA 2NMQA 3GE8C 3L13A 2KQSA 4HJKA 2SEBD 1SE3A 3U7ZA 3ZUNA 2AWTA 4FN2A 1K50A 2B3AA 3EFCA 2N1WA 3PRMB 2WXKA 5H92C 1U4AA 1C9FA 3HIZA 4M0WA 3DBRB 1V5TA 1J7AA 3BYYB 3P2BA 4IUMB 5LLIA 3GB1A 1NENB 2NPTA 4BKSD 3IVFA 1WGHA 4MGKE 1E8XA 4DBGA 4XWTA 2JVCA 4C00A 1FEHA 5KHQA 3V60A 3V6EB 4A8XC 1WM3A 2WXFA 2WXHA 4EOYA 2VH2A 1L0VB 1JWUD 2JUOA 1MG4A 1P98A 2MP2A 1LQBA 4EEWA 4BVUC 1V81A 4NJ6A 3NG0A 3PVLA 4LK0M 4GIVA 3LJ3A 5HG2A 1D5ZC 4ICUA 4WJOA 2EKIA 1Q5WB 3ZXRA 2A4ZA 1X1MA 4LDTD 1V2YA 4W9JA 2L00B 5KHOA 1P7FA 3RUIB 1L5PA 4TV3A 3A33B 3ZYYX 3TCAA 5LXIB 2Y5CA 1YJ1A 1Y56A 4FLHA 2DYMA 2PPHA 4LDTB 2AQ1B 2C7NB 1XLOA 3HM3A 1I4XA 1UGMA 1MJDA 4A6QA 3M63B 4IWQA 5FR3A 4NNJB 1WX8A 4OHJA 4BBNC 2N1VA 1T0YA 2WXGA 4MT5A 4GOCA 4GU2A 4WQOB 5BYSA 4HDQA 4P1BC 3N1ZC 1ZUD2 3MHZA 4DHZE 1UF0A 2ZVOA 1CQVA 4FHJA 1C4CA 4YSZB 1UBIA 3WAOA 2V3PA 1GOZA 4PYUA 3L16A 1WXVA 1YIWA 1TYGB 4KGRA 4PS3A 2QJLA 1JALA 3VTUA 3OJ4B 4GDLB 1WGGA 2JSVX 3DWGC 2WX1A 1F9JA 4W9LA 2KTRB 4HPPA 1YQ3B 3AMZA 3BYTB 3BK1A 1TKGA 1YN4A 2J7QB 2KDFB 4LNOA 4WWOA 1XXGA 2AQ2B 4W9GA 3KWLA 1HZ5A 4W9HA 1YX6B 3SEBA 1ZP0B 1H4RA 1OQYA 3IT4B 3PHWB 3ZJVA 2LGSA 4G50A 2EMSA 1NDDA 1D5MC 3KYDD 1ZKHA 4LNNA 2YVCA 3EECA 3C19A 1H8CA 4RMAA 1PGBA 1GB1A 1G6JA 2V1YA 2HTHA 1FNUA 4MH8A 4C7YA 2WDVB 1T0SC 3JW0X 2ZVNA 4MGZE 2FIFA 4ZYNA 2ACZB 3QIJA 4OZBA 1QZEA 3PZ7A 4DHJD 4RF0A 1TKYA 5J18A 2WU5B 2M8SA 3I5JC 3IAM1 1OQRA 3IHPC 1QF6A 2Z8LA 3UQBA 3H7PB 4J3OD 5DPRA 3SD5A 2K8BA 2DLBA 3WIMA 5DPSA 3I63C 4PYZA 3PREA 2Y5BB 1FCCC 3ZNZB 1SSNA 3AU5A 1ZXIA 3VXWA 1K8RB 1TT5B 2BT6A 2WGSA 1WX7A 3PLVA 2GLSA 3NVYA 4MM3B 1YMHE 3E56A 3AE3B 3H8HA 4TKNA 1GUAB 1FCLA 2IBIB 3V6CB 2N7DA 3QHTA 2KWCA 3U8ZA 3HM6X 1C4PA 1AYFA 4G0NB 3U2SC 2FCSA 3ZJTA 2C5LC 3QCAA 2KNBA 3QQ8B 3FKYA 1TTNA 2CHZA 3OAWA 3K9OB 1QOAA 1F0ZA 3N1XC 1N62A 4CYEA 5CHFA 1TGZB 3RNAC 1UZXB 3A9JB 3SR6A 2JXXA 1C78A 1V97A 2GBJA 1YN5A 4M02A 4W9DA 4IOIE 2QSDA 1SEBD 1XCQL 4MACA 3T3NA 4YXDB 2GRIA 2OOBB 2KQ7A 2DZIA 4XE0A 2BYEA 1OFFA 1I42A 1XF5L 2FE8A 3TEYA 2KWDA 4A55A 1LM8B 4A3PA 1VLBA 2ONQA 2IGHA 4WAFA 4LLGM 3X0WA 4AP4C 1IBXB 1SXTA 4IM2A 1NI2A 3ML9A 1UNSA 1JMLA 4WIPA 5BYRA 1WZ0A 3VDZA 4JE3B 2NBUA 2NVUI 4JWSC 3Q8AA 2JYTA 3U30A 2PTLA 1RLFA 2PIAA 1L4DB 1R4NB 1E7VA 3J9CA 5HKHA 1UBQA 3DHHC 1F2RC 1VCBA 1R4NI 5D7GA 3SU8X 2W3RA 2PKOA 1WI0A 2L05A 5CHWA 2BBCA 2IGDA 3WALA 1XQQA 3RZFA 4KX6B 2KDEB 2FNJB 3ENEA 2WXLA 1CJEA 3AEEB 4W9IA 1AW7A 4RF1A 3AB5A 2H89B 4HCPB 4IM3A 2DENB 3NJTA 3VFKA 2LEKA 2HTME 3URYA 3HK0A 3P1MA 1KM7A 5EE0A 3MJWA 3AEGB 4K81A 2CJNA 3DBHB 4OVZA 3RD2A 2HDEA 4C7ZA 4AS1A 2MWSB 1P0RA 4DXFA 4FJYA 1SIJA 3DWMA 2RDHA 3NZ3A 4XX5A 2MSED 1TIFA 1K53A 2K6DB 3KQ4A 4RGOS 5LNK1 5EE9A 2WXMA 1UD7A 2IJ0A 1WJUA 1WMHB 1ET9A 5IN7A 2NBVB 3VVWB 1PQSA 1L6VA 2LFIA 1JWSD 5IKCM 4TSSA 3ZGZA 1P3QU 3UF8A 3H7PA 1AARA 5HFYA 1WY8A 2WXNA 2PLPA 3DBLI 3AE2B 3SFEB 2BVCA 4RGTA 4EZKA 1E6EB 1JRPA 2WQYB 2AEHA 2C60A 2LD9A 4KGSA 4RGNA 2JRIB 4KIKB 1KLUD 4NAMA 2W3SA 5IO9A 2MLBA 1WRIA 1ZXHA 2LASA 1QKZA 4FADA 1B1ZA 4HRSA 4CHKA 2GBRA 4GGQA 2LWPA 1IGDA 4GSWA 2OJWA 1WXAA 1MI0A 3M3JA 1XD3B 2UWQA 4XZ4A 2QILA 2N0SB 2BYTA 3VUYA 4DXGA 4FHKA 4TQ1A 3DDCB 2IO1B 1WFYA 1BMLC 1ZDVA 2MBOA 4GLSC 1WGKA 2KXJA 2Z59B 2D11A 1QOFA 2KYWA 4BBNF 2YEPF 5C2TB 1IPGA 2JZZA 2WXPA 4DHZB 2JWUA 5L83A 2CHWA 3GS2A 1V1PA 2I1KA 2ZPYA 4AJYB 1WR1A 3ZO5B 4HLEA 2INPE 3ALBA 1TBEA 4OVVA 2G1EA 2M4NA 3W9CB 1UWXA 2BYFA 3AE6B 1YN3A 1HXYD 1IBXA 1D6EC 4XGAB 3KYCD 1FPYA 1N6ZA 5CHVC 2M0AA 2PE9A 3AV8A 1Z5SB 1I4HA 1NYRA 1J7CA 2JZ3B 3AN1A 4M8MA 5D3IB 2MQJA 2KVRA 2QDFA 2DYBA 2W55A 3P4RB 3ZRCA 2NCNA 2MP2B 2IO0B 4I6NB 1RFAA 1TS4A 4ZRJA 4KDLB 4W9KA 2J42A 4XYCA 2RPQA 1I4QA 3P4QB 2DAFA 2YLMA 2MBEA 3WCQA 2BKRB 1YX5B 2G4SA 5EE1A 4LNFA 2LGXA 1F77A 2EELA 3Q14C 1JW9D 2QCZA 5JHBA 2MBBB 3I9V1 4WWNA 2CU1A 1ISNA 1V5OA 1DOXA 4MGYE 2UU7A 2M19A 1CMXB 2LI5A 4WAAA 4NJ7A 3R3MA 4RFBA 2MH7A 1KOTA 3UGBB 2E6XA 3W5VB 1K52A 4GXBA 2PVGC 3H1UA 3TJPA 5FK9C 1HA5A 1TS3A 1N60A 3K9PB 1R4MI 2KK8A 3HHMA 4A3OA 5D3DA 2K8CA 2L0TA 1PDXA 1EO6A 5DCNA 3SFDB 5BO4B 4HVBA 2NTSA 3DHIC 1WGYA 2X8XX 3AM9A 4BKGA 2K8HA 1EU3A 1FFUA 1WZ3A 1L7YA 3TBLD 5H8YE 2RDGA 2KFKB 1GC6A 2N9PC 2BS4B 2GI9A 3NUHB 1E5WA 1T0QC 3FILA 5EE3A 1A5RA 5I4DA 1VDVA 3ZIMA 2G45B 2KHWB 3KLSX 3VUWA 3UINB 4DHJB 1NBFC 1GAQB 3I57A 2KLCA 4HPLB 1BT0A 2MW5A 2GBNA 1IGCA 2RMMA 3Q3MC 3KVFB 1ZE3D 3NZUA 3L0WB 1WE6A 2D3BA 3AEBB 4E74A 3ZTCA 1WXQA 4YTPB 4O1NA 5AZHA 3HUIA 5J2RA 1NYQA 4FULA 2L8JA 4G11A 2L52A 1PYWD 3ZQ4A 1I7HA 4YSYB 4F1SA 2RGFA 2ZCCA 1IYFA 4JGHB 2K6QA 2DZJA 2M1MA 2BF8B 2ON8A 1KLVA 4ZRIA 2K3UA 4QAYA 1QT9A 3EUB2 2WXIA 3I3TB 3AE8B 3FAHA 3PZ8A 3EC8A 4MGIE 1BXTA 3V05A 2RR9A 2DAJA 4AWJA 1FXIA 1N5XA 3FC4A 3P4PB 1SE9A 3WAMA 4C56C 4HKQA 3B9JA 1SF0A 2RD0A 3CF6E 3NS1A 2INNE 1E90A 2M0XA 3N32A 4OVUA 3W1SA 2KANA 2D3CA 4B0EA 3KH0A 3IFWB 1FNWA 3LDZE 2X38A 2WYQA 1SE4A 4LTUA 5T8IA 2HJ8A 2QMTA 2WXJA 4XC2A 2W54A 2LHDA 2JQRB 3TEXA 2BYVE 3QX1A 4I6LB 1GC7A 3VAWA 1M94A 4JL9A 5C3JB 4L1BA 3PZDA 3T3OA 2KLGA 4YWGG 2O6VD 1EM7A 2KDBA 2KJRA 1WX9A 3RFZB 4KDIC 1P7EA 2A5UA 3W1YA 3PT2B 2KX3A 2AQ3B 2J52A 2IZVB 4L23A 3TIXA 3VHTC 3EFUA 4KSKC 1E9MA 2IO3B 2CHXA 1L6UA 5D6JB 2BQQA 4ZYSA 1VZ8A 5AUKA 4CO7A 2PVOD 2ZZPB 3NRZA 1KRHA 1SGHA 2KJ6A 1F2RI 3NHEB 2KT7A 2WU2B 4S0RA 2FUG1 3W5UB 2TSSA 2KVZA 1SBBB 4ASWC 2KN4A 1T3QA 3HRDD 2OEDA 4M00A 3ZJUA 2CJOA 1E7UA 3C0RB 1C77A 2CU3A 2PMVA 4IW0A 1KF6B 1EWCA 3AE5B 1VZ7A 1FMAD 2DNFA 1NVID 2DHZA 4EZJA 4GB9A 2WWZA 1WR6E 3MFGA 1WJ4A 2AYOB 1C4AA 4K7SA 3RCZA 1ZW7A 2BWFA 3JSVA 1RRBA 3MP9A 3VR9B 1V1PB 1UWMA 3N20C 3B08A 3M62B 1N61A 1JWBD 3UIPB 3GZNB 2WNMA 4WJNA 4ANWA 4HKZE 3RNEC 5IA7A 3DCGA 2N9KA 4LJPB 4MDKE 5JXVA 1S3SG 3DVGX 4BAXA 2PE6B 2MJDA 3IG3A 2BS2B 1TY2A 3R2TA 4IWOA 2LVPA 3L08A 3V62A 3AI5A 2Z0EB 1YQ4B 4PT5A 1ESFA 2KN5A 1V9JA 2W82A 2WHIA 4A20A 4REZA 1UH6A 2OHFA 2L83A 2KACA 3A1QA 4FJZA 4ANVA 2KWUB 5HI1A 1MVKA 4N9F4 2PJHA 4AUQC 1WGDA 3OG5A 3Q3OC 3PSEB 3DBSA 3ZKJC 2HJ1A 4HEA1 2ZW0A 1MFWA 1GJZA 2KQ4X 1RYJA 3PLUA 3VH3B 1WE7A 3V3XA 5E6NA 1NEKB 4MEMA 4KSLC 1E10A 3RNGC 1WF9A 2ZJDA 3AEFB 1RFKA 1KFYB 3VH4B 5JHAA 1TKEA 2MJ3A 4EUTA 3RT3B 2C7MB 2NR2A 4HROA 2YEPB 4KKIA 4UDUC 3BVMA 4IC7B 4FJVB 1E8WA 5BMGA 4LJOB 2L1AA 3AU4A 2BS3B 3ZNHB 4C4VB 4JPSA 3RPFC 3ZLZA 3ZW3A 1D4BA 1VJKA 4EFOA 1Q0WB 3QAQA 1IP9A 2MBQA 4J6IA 1QOGA 1VZ6A 2ICIA 1OEYA 2LXCA 5C1ZA 2O6VB 1YJJA 4ITKA 5E6OA 1QOBA 1V49A 4KVGB 3AEDB 2MA9B 2W9NA 1E8ZA 3P4SB 3WANA 4MH0E 4ZHPA 4RM8A 3KUDB 2DX5B 4ACFA 4MJSB 3D32A 1D5XC 3APDA 4ZOHC 3ZTDA 3DPDA 3RZWC 2KDMA 2IY1B 2VZKD 2BKFA 4YTNB 2LRWA 4HCNB 2LVOA 4IM0A 4USAA 4DDID 4B0MA 1SIFA 3PO0A 3SDLC 3RMKC 2KC1A 3P63A 2G9HD 3U7DA 3N9YC 1KLGD 3TEZA 2WDRB 1STEA 3W1SC 2OJRA 4HXDA 5CTRC 4ZDVA 1PGXA 3R66C 4AJWA 5G55A 2XN9C 4C4VA 5DPTA 1FNVA 3ZRFA 5DPWA 2J0MA 5BMHA 4YTMB 2KO3A 2ZCBA 1J19A 1EF5A 2FCNA 1WJNA 1XO3A 1PUTA 4WWMA 2LUMA 3RNBC 4YT0B 1P1AA 1GNUA 2BGFA 4B6WA 1XEEA 2K0PA 4YL8A 3Q2AC 3ZVVA 4RGMA 2D07B 2LVQA 4GDKB 3E9SA 2N9XA 4PK1A 3R7RA 2EMTA 5JH5C 2J4XA 1Q10A 4A90A 2WX0A 1S1QB 3RULA 1P9DU 4ZRPA 5C23A 3GE3C 2JYEA 1MHXA
chains in the Genus database with same CATH topology
2FIFA 4ZYNA 3ONSA 2JF5A 4E74A 3QIJA 4HDOA 3ZTCA 5L95C 1QZEA 3R7QA 4DHJD 4NQLB 1LXDA 4KZ0A 4PS7A 5AZHA 3X23A 5J2RA 4BFRA 4FULA 3DVNU 4K1RB 3NZSA 5J18A 1WXSA 1TZ1A 2L8JA 4G11A 3PPAA 2M8SA 3IHPC 3NY5A 2HD5B 3VTVA 2K1FA 3UQBA 3BINA 4F1SA 2RGFA 3H7PB 5DPRA 3SD5A 2K8BA 2ZCCA 2O2VA 2AL3A 1FXTB 1IYFA 4JGHB 3NOBA 2J0JA 2K6QA 3WIMA 5DPSA 2DZJA 2XEWA 4DDGD 4PYZA 2M1MA 2BF8B 3PREA 2Y5BB 1KLVA 3ZNZB 4ZRIA 3AU5A 3VXWA 3QK0A 1K8RB 2LRUA 4NQKE 2PEAA 3I3TB 2JWZA 2IO2B 1WX7A 2GBMA 3PLVA 3ZNID 3EC8A 4MGIE 3MHSD 2RR9A 2DAJA 2O6VA 2G3QB 4AWJA 3O65B 4TKNA 1GUAB 1WRDB 2IBIB 2D3GA 4GDKA 1SE9A 3H6NA 3S2AA 3WAMA 3T8MA 3V6CB 1KJTA 2N7DA 2RD0A 3PHXB 3APFA 3QHTA 3CF6E 2KWCA 3U8ZA 3HM6X 1Z2MA 2GMIC 3DBHI 1E90A 4G0NB 2MRPA 2M0XA 2FCSA 4WJPA 3N32A 2DZKA 5AZGA 1J8CA 2C5LC 3QCAA 2L7RA 2KNBA 3QQ8B 4OVUA 2KANA 3KW5B 3W1SA 4M8NA 4JQWC 2IYDB 2ZNVC 2LXAA 4GMVA 3APCA 3UQAA 1TTNA 2CHZA 2XK5B 3K9OB 3NS8A 3OAWA 3KH0A 3IFWB 1EF1A 4GDLA 4B9KA 2NPTB 4CYEA 2G4DB 3LDZE 2V4LA 1EUVB 2WDTB 2WYQA 4II3B 4X57B 5CHFA 3VTWA 1TGZB 1UZXB 3A9JB 2HJ8A 1V86A 2KDIA 2JXXA 4MM3A 2GBJA 3DQVA 4W9DA 4XC2A 3A4SC 3ML8A 2BYVE 3QX1A 4I6LB 1GC7A 3VAWA 5AZFA 1V80A 4E71A 1M94A 2BPSA 2FIDA 2KQ7A 2DZIA 2OOBB 3H9DA 3OJ3A 3PZDA 4JL9A 4ZRKA 2BYEA 2KFJA 2KLGA 4AOFA 1ZGUB 2C9WB 2K39A 2O6VD 1I42A 4E3CA 1YD8U 2KDBA 2KJRA 1WX9A 1WIAA 4KDIC 3A4RA 3QC8B 1LM8B 4A3PA 3ZNGC 3PS6A 1Y8RC 2MCNB 2R2OA 4IG7B 1J0GA 2A5UA 2DYOA 3X0WA 3W1YA 1UELA 3PT2B 2KX3A 5J17A 3CSFA 4AP4C 2IZVB 2KKCA 3TIXA 1GG3A 4IM2A 1NI2A 3ML9A 3VHTC 2HE7A 3CMMB 5JZEB 2R2QA 3VUXA 3EFUA 2FCQA 4KSKC 1WZ0A 3VDZA 2NBUA 2KJHB 2NVUI 2IO3B 3T9LA 3IBEA 5LXHA 2CHXA 2GOWA 2KMAA 3U30A 5D6JB 1RLFA 4KV2A 4DK5A 3OLMD 4FA6A 2XK5A 1E7VA 3WA0A 3GOEA 4MELA 4CO7A 5HKHA 1UBQA 3A9KA 2CS4A 3QJZA 5AEKB 2ZZPB 2FUHB 3GZNI 4MSMB 1VCBA 1WGRA 1SGHA 5TR5A 4B95A 3TMPB 1R4NI 5D7GA 2J0KA 4P7IA 2KJ6A 3SU8X 1WM2A 1WJ6A 3NHEB 5D2MB 1WI0A 3KUZA 2L05A 4BOSC 2FAZA 2VRRB 5IAAC 3N30A 2LGYA 4ASWC 4BKTA 5CHWA 2IY0B 4HK2A 2LGDA 2LUEA 1E7UA 2K25A 3A9JA 3C0RB 4BKSA 3WALA 1XQQA 2GBKA 3M95A 3RZFA 2KZRA 4IW0A 5FR6A 2N7EA 2KDEB 1JRUA 2FNJB 3DVGY 3ENEA 3L54A 4W9IA 2AL6A 2DHZA 3A1QB 2ASQA 4HCPB 2KWVB 2DENB 4IM3A 3VFKA 2XBBC 4EZJA 3CSTA 4GB9A 3HK0A 2WWZA 1WR6E 2L76A 3ZDMC 1KM7A 1WJ4A 3JVZX 2M17A 3MJWA 4K81A 4NY0A 3QWZB 2LZ6A 2AYOB 3RD2A 3MTNB 2MWSB 3PTFC 4W9FA 1P0RA 3KUCB 4K7WA 4FJYA 2KMCA 4K7SA 4WWPA 3RCZA 1ZW7A 4M0WB 1Q1OA 2BWFA 3JSVA 2JT4B 1RRBA 4XX5A 2MSED 2NBWB 2CKHB 3TL5A 4DXAB 4MJSA 2C7HA 3B08A 3M62B 2K6DB 3UIPB 3B1LX 3QA8A 2EKEC 3SHQA 3PRZA 2KTRA 1UD7A 4LCDE 1WJUA 4WJNA 2Z0DB 2I1JA 4KZCA 3V61A 5CX3A 4ANWA 1WMHB 3ZDTA 4II2B 4F8CB 3B0AA 5IA7A 2NBVB 1MG8A 3VVWB 2KFKA 2UYZB 3DCGA 3WAPA 1PQSA 3EHVA 4LJPB 4MDKE 3DOWA 2JPHA 4JIOU 1S3SG 3DVGX 4TQ0A 2PE6B 1VD2A 1P3QU 3UF8A 3H7PA 3IG3A 3Q3FA 3BY4B 4KIKA 2KTFA 1AARA 1WY8A 2N4FA 4W9CA 3DBLI 4IWOA 2LVPA 3L08A 3V62A 3AI5A 2Z0EB 3N3KB 3L10B 3UIOB 4EZKA 2D10A 2DZMA 1WXMA 4HPMB 3A9KB 1OEYJ 2AEHA 2C60A 2LD9A 4EZLA 2KN5A 2QHOA 4URKA 2JRIB 2ZNVB 5EDSA 2D2QA 4GN1A 4KIKB 4F7ZA 2O2VB 1V9JA 3L13A 2KQSA 2MLBA 4HJKA 4A20A 2LASA 1UH6A 4FADA 3JYUA 3QARA 3ZUNA 4CHKA 3A1QA 2GBRA 2AWTA 4FJZA 4GGQA 4ANVA 4FN2A 2B3AA 2KWUB 2N1WA 3PRPB 3PRMB 2PJHA 2LWPA 4N9F4 4GSWA 4AUQC 1U4AA 1WGDA 1WXAA 3HIZA 3M3JA 3PSEB 1V5TA 4HWIB 3DBSA 1XD3B 3P2BA 3ZKJC 4IUMB 5LLIA 2UWQA 2NPTA 4XZ4A 4BKSD 5G2NA 3IVFA 1WGHA 1GJZA 4MGKE 2NS5A 3RYTA 1E8XA 4DBGA 2L3ZA 3VUYA 3PLUA 4FHKA 3Q3JA 4TQ1A 3VH3B 3DDCB 2ZPNA 1WE7A 2IO1B 2JVCA 1WFYA 2MBOA 5E6NA 4ANUA 2KXJA 2KD0A 4MEMA 2Z59B 4KSLC 3V60A 2D11A 5KHQA 1WH3A 1WF9A 2ZJDA 3V6EB 1YQBA 1WM3A 3VH4B 4BBNF 5JHAA 4EOYA 4EUTA 3RT3B 1C3TA 2C7MB 2NR2A 4W9EA 2RSUA 2JUOA 4IC7B 4MGZE 1IPGA 2JZZA 4DHZB 2MP2A 1P98A 2L0FA 1LQBA 4EEWA 2CHWA 5L83A 4FJVB 4BVUC 1V81A 3AXCA 1E8WA 2I1KA 4NJ6A 4BOZB 2ZPYA 4LJOB 1WR1A 3ZO5B 4AJYB 4HLEA 3PVLA 4GIVA 3ALBA 1TBEA 3AU4A 3LJ3A 4OVVA 2ZEQA 2M4NA 3ZNHB 4MSQB 4TUUA 4ICUA 4WJOA 2BYFA 1Q5WB 2A4ZA 1X1MA 4LDTD 1V2YA 3ZLZA 3ZW3A 3KYCD 4W9JA 2L00B 5KHOA 4EKUA 1HE8A 1Q0WB 3ECIA 5CHVC 4EFOA 2PE9A 3H7SA 3QAQA 5D94A 1Z5SB 3RUIB 1IP9A 2FCMA 4TV3A 2JZ3B 4M8MA 3A33B 2JY6A 2MBQA 2MQJA 4J6IA 2CR5A 2KVRA 3TCAA 1OEYA 2DYBA 2LXCA 5LXIB 4NPNA 3ZRCA 2NCNA 1YJ1A 5C1ZA 2MP2B 2O6VB 2IO0B 4I6NB 1RFAA 4G3XB 2LJ5A 4DWFA 4FLHA 5E6OA 1V49A 2DYMA 2PPHA 1OTRB 4KDLB 4KVGB 4W9KA 4IWPA 4ZRJA 2RPQA 2MA9B 2W9NA 4LDTB 1E8ZA 2KC2A 3WANA 2MBHA 4MH0E 2DAFA 4RM8A 2YLMA 2C7NB 2MBEA 3KUDB 2DX5B 4MJSB 2JRHA 3D32A 3HM3A 2BKRB 1E8YA 1WMHA 1XT9B 3APDA 3ZTDA 1UGMA 3DPDA 3RZWC 3VQIA 1YX5B 2G4SA 3M63B 4IWQA 4NNJB 1WX8A 2LGXA 4BBNC 2N1VA 3AULA 2IY1B 1T0YA 2KOXA 4GOCA 5JHBA 2MBBB 4GU2A 2BKFA 4WQOB 4WWNA 4HDQA 2CU1A 1ISNA 2N9EB 2LRWA 1V5OA 4HCNB 2LVOA 4IM0A 4WJQA 4DHZE 4DDID 2ZVOA 1D3ZA 4FHJA 1L2NA 1SIFA 4MGYE 4RM9A 4FBJB 1UBIA 3SDLC 1CMXB 3WAOA 4PYUA 2LI5A 4WAAA 2KC1A 4NJ7A 3L16A 3R3MA 3U7DA 1WXVA 1YIWA 4K7UA 1KOTA 3UGBB 4ICVA 2REXA 4PS3A 4GXBA 1I35A 3H1UA 3VTUA 3OJ4B 3W1SC 1V6EA 2V3SA 4GDLB 2OJRA 4HXDA 3TJPA 5CTRC 1WGGA 3K9PB 3PGEA 4ZDVA 2WX1A 1F9JA 1R4MI 2KK8A 3HHMA 4A3OA 3R66C 4AJWA 2KX0A 4ANXA 5G55A 2K8CA 4W9LA 2KTRB 5DPTA 2L0TA 5DCNA 1EO6A 4HVBA 5BO4B 3ZRFA 5DPWA 1WGYA 5E6PA 2J0MA 2J7QB 2KDFB 2KO3A 4WWOA 2ZCBA 1J19A 4W9GA 4BKGA 1EF5A 4W9HA 1LFDA 1YX6B 2K8HA 2FCNA 1H4RA 1OQYA 1WJNA 3DVNV 1WZ3A 4I6PA 3PHWB 1L7YA 3TBLD 2EMSA 1P1AA 4G50A 1NDDA 1GNUA 2BGFA 3KYDD 2KFKB 4B6WA 1GC6A 2MX2A 1ZKHA 2N9PC 2YVCA 3L17A 4NAWA 4YL8A 3ZVVA 3EECA 2D07B 2LVQA 4GDKB 4PS8A 3DBRI 1H8CA 1E5WA 2N9XA 3R7RA 4RMAA 2EMTA 1A5RA 4JLCA 1G6JA 5JH5C 3ZIMA 4NAWB 2V1YA 1C1YB 2G45B 2HTHA 2KHWB 1RAXA 3VUWA 2BWES 3UINB 4DHJB 1OGWA 1NBFC 1WYWB 2WX0A 5GMVA 1S1QB 3JSVB 3RULA 1P9DU 2KLCA 3PV1A 4HPLB 5C23A 1BT0A 2MW5A 2GBNA 3JW0X 3KVFB 2ZVNA 3NZUA 3L0WB 1WE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FIF A;  4ZYN A;  3ONS A;  2JF5 A;  4E74 A;  3QIJ A;  4HDO A;  3ZTC A;  5L95 C;  1QZE A;  3R7Q A;  4DHJ D;  4NQL B;  1LXD A;  4KZ0 A;  4PS7 A;  5AZH A;  3X23 A;  5J2R A;  4BFR A;  4FUL A;  3DVN U;  4K1R B;  3NZS A;  5J18 A;  1WXS A;  1TZ1 A;  2L8J A;  4G11 A;  3PPA A;  2M8S A;  3IHP C;  3NY5 A;  2HD5 B;  3VTV A;  2K1F A;  3UQB A;  3BIN A;  4F1S A;  2RGF A;  3H7P B;  5DPR A;  3SD5 A;  2K8B A;  2ZCC A;  2O2V A;  2AL3 A;  1FXT B;  1IYF A;  4JGH B;  3NOB A;  2J0J A;  2K6Q A;  3WIM A;  5DPS A;  2DZJ A;  2XEW A;  4DDG D;  4PYZ A;  2M1M A;  2BF8 B;  3PRE A;  2Y5B B;  1KLV A;  3ZNZ B;  4ZRI A;  3AU5 A;  3VXW A;  3QK0 A;  1K8R B;  2LRU A;  4NQK E;  2PEA A;  3I3T B;  2JWZ A;  2IO2 B;  1WX7 A;  2GBM A;  3PLV A;  3ZNI D;  3EC8 A;  4MGI E;  3MHS D;  2RR9 A;  2DAJ A;  2O6V A;  2G3Q B;  4AWJ A;  3O65 B;  4TKN A;  1GUA B;  1WRD B;  2IBI B;  2D3G A;  4GDK A;  1SE9 A;  3H6N A;  3S2A A;  3WAM A;  3T8M A;  3V6C B;  1KJT A;  2N7D A;  2RD0 A;  3PHX B;  3APF A;  3QHT A;  3CF6 E;  2KWC A;  3U8Z A;  3HM6 X;  1Z2M A;  2GMI C;  3DBH I;  1E90 A;  4G0N B;  2MRP A;  2M0X A;  2FCS A;  4WJP A;  3N32 A;  2DZK A;  5AZG A;  1J8C A;  2C5L C;  3QCA A;  2L7R A;  2KNB A;  3QQ8 B;  4OVU A;  2KAN A;  3KW5 B;  3W1S A;  4M8N A;  4JQW C;  2IYD B;  2ZNV C;  2LXA A;  4GMV A;  3APC A;  3UQA A;  1TTN A;  2CHZ A;  2XK5 B;  3K9O B;  3NS8 A;  3OAW A;  3KH0 A;  3IFW B;  1EF1 A;  4GDL A;  4B9K A;  2NPT B;  4CYE A;  2G4D B;  3LDZ E;  2V4L A;  1EUV B;  2WDT B;  2WYQ A;  4II3 B;  4X57 B;  5CHF A;  3VTW A;  1TGZ B;  1UZX B;  3A9J B;  2HJ8 A;  1V86 A;  2KDI A;  2JXX A;  4MM3 A;  2GBJ A;  3DQV A;  4W9D A;  4XC2 A;  3A4S C;  3ML8 A;  2BYV E;  3QX1 A;  4I6L B;  1GC7 A;  3VAW A;  5AZF A;  1V80 A;  4E71 A;  1M94 A;  2BPS A;  2FID A;  2KQ7 A;  2DZI A;  2OOB B;  3H9D A;  3OJ3 A;  3PZD A;  4JL9 A;  4ZRK A;  2BYE A;  2KFJ A;  2KLG A;  4AOF A;  1ZGU B;  2C9W B;  2K39 A;  2O6V D;  1I42 A;  4E3C A;  1YD8 U;  2KDB A;  2KJR A;  1WX9 A;  1WIA A;  4KDI C;  3A4R A;  3QC8 B;  1LM8 B;  4A3P A;  3ZNG C;  3PS6 A;  1Y8R C;  2MCN B;  2R2O A;  4IG7 B;  1J0G A;  2A5U A;  2DYO A;  3X0W A;  3W1Y A;  1UEL A;  3PT2 B;  2KX3 A;  5J17 A;  3CSF A;  4AP4 C;  2IZV B;  2KKC A;  3TIX A;  1GG3 A;  4IM2 A;  1NI2 A;  3ML9 A;  3VHT C;  2HE7 A;  3CMM B;  5JZE B;  2R2Q A;  3VUX A;  3EFU A;  2FCQ A;  4KSK C;  1WZ0 A;  3VDZ A;  2NBU A;  2KJH B;  2NVU I;  2IO3 B;  3T9L A;  3IBE A;  5LXH A;  2CHX A;  2GOW A;  2KMA A;  3U30 A;  5D6J B;  1RLF A;  4KV2 A;  4DK5 A;  3OLM D;  4FA6 A;  2XK5 A;  1E7V A;  3WA0 A;  3GOE A;  4MEL A;  4CO7 A;  5HKH A;  1UBQ A;  3A9K A;  2CS4 A;  3QJZ A;  5AEK B;  2ZZP B;  2FUH B;  3GZN I;  4MSM B;  1VCB A;  1WGR A;  1SGH A;  5TR5 A;  4B95 A;  3TMP B;  1R4N I;  5D7G A;  2J0K A;  4P7I A;  2KJ6 A;  3SU8 X;  1WM2 A;  1WJ6 A;  3NHE B;  5D2M B;  1WI0 A;  3KUZ A;  2L05 A;  4BOS C;  2FAZ A;  2VRR B;  5IAA C;  3N30 A;  2LGY A;  4ASW C;  4BKT A;  5CHW A;  2IY0 B;  4HK2 A;  2LGD A;  2LUE A;  1E7U A;  2K25 A;  3A9J A;  3C0R B;  4BKS A;  3WAL A;  1XQQ A;  2GBK A;  3M95 A;  3RZF A;  2KZR A;  4IW0 A;  5FR6 A;  2N7E A;  2KDE B;  1JRU A;  2FNJ B;  3DVG Y;  3ENE A;  3L54 A;  4W9I A;  2AL6 A;  2DHZ A;  3A1Q B;  2ASQ A;  4HCP B;  2KWV B;  2DEN B;  4IM3 A;  3VFK A;  2XBB C;  4EZJ A;  3CST A;  4GB9 A;  3HK0 A;  2WWZ A;  1WR6 E;  2L76 A;  3ZDM C;  1KM7 A;  1WJ4 A;  3JVZ X;  2M17 A;  3MJW A;  4K81 A;  4NY0 A;  3QWZ B;  2LZ6 A;  2AYO B;  3RD2 A;  3MTN B;  2MWS B;  3PTF C;  4W9F A;  1P0R A;  3KUC B;  4K7W A;  4FJY A;  2KMC A;  4K7S A;  4WWP A;  3RCZ A;  1ZW7 A;  4M0W B;  1Q1O A;  2BWF A;  3JSV A;  2JT4 B;  1RRB A;  4XX5 A;  2MSE D;  2NBW B;  2CKH B;  3TL5 A;  4DXA B;  4MJS A;  2C7H A;  3B08 A;  3M62 B;  2K6D B;  3UIP B;  3B1L X;  3QA8 A;  2EKE C;  3SHQ A;  3PRZ A;  2KTR A;  1UD7 A;  4LCD E;  1WJU A;  4WJN A;  2Z0D B;  2I1J A;  4KZC A;  3V61 A;  5CX3 A;  4ANW A;  1WMH B;  3ZDT A;  4II2 B;  4F8C B;  3B0A A;  5IA7 A;  2NBV B;  1MG8 A;  3VVW B;  2KFK A;  2UYZ B;  3DCG A;  3WAP A;  1PQS A;  3EHV A;  4LJP B;  4MDK E;  3DOW A;  2JPH A;  4JIO U;  1S3S G;  3DVG X;  4TQ0 A;  2PE6 B;  1VD2 A;  1P3Q U;  3UF8 A;  3H7P A;  3IG3 A;  3Q3F A;  3BY4 B;  4KIK A;  2KTF A;  1AAR A;  1WY8 A;  2N4F A;  4W9C A;  3DBL I;  4IWO A;  2LVP A;  3L08 A;  3V62 A;  3AI5 A;  2Z0E B;  3N3K B;  3L10 B;  3UIO B;  4EZK A;  2D10 A;  2DZM A;  1WXM A;  4HPM B;  3A9K B;  1OEY J;  2AEH A;  2C60 A;  2LD9 A;  4EZL A;  2KN5 A;  2QHO A;  4URK A;  2JRI B;  2ZNV B;  5EDS A;  2D2Q A;  4GN1 A;  4KIK B;  4F7Z A;  2O2V B;  1V9J A;  3L13 A;  2KQS A;  2MLB A;  4HJK A;  4A20 A;  2LAS A;  1UH6 A;  4FAD A;  3JYU A;  3QAR A;  3ZUN A;  4CHK A;  3A1Q A;  2GBR A;  2AWT A;  4FJZ A;  4GGQ A;  4ANV A;  4FN2 A;  2B3A A;  2KWU B;  2N1W A;  3PRP B;  3PRM B;  2PJH A;  2LWP A;  4N9F 4;  4GSW A;  4AUQ C;  1U4A A;  1WGD A;  1WXA A;  3HIZ A;  3M3J A;  3PSE B;  1V5T A;  4HWI B;  3DBS A;  1XD3 B;  3P2B A;  3ZKJ C;  4IUM B;  5LLI A;  2UWQ A;  2NPT A;  4XZ4 A;  4BKS D;  5G2N A;  3IVF A;  1WGH A;  1GJZ A;  4MGK E;  2NS5 A;  3RYT A;  1E8X A;  4DBG A;  2L3Z A;  3VUY A;  3PLU A;  4FHK A;  3Q3J A;  4TQ1 A;  3VH3 B;  3DDC B;  2ZPN A;  1WE7 A;  2IO1 B;  2JVC A;  1WFY A;  2MBO A;  5E6N A;  4ANU A;  2KXJ A;  2KD0 A;  4MEM A;  2Z59 B;  4KSL C;  3V60 A;  2D11 A;  5KHQ A;  1WH3 A;  1WF9 A;  2ZJD A;  3V6E B;  1YQB A;  1WM3 A;  3VH4 B;  4BBN F;  5JHA A;  4EOY A;  4EUT A;  3RT3 B;  1C3T A;  2C7M B;  2NR2 A;  4W9E A;  2RSU A;  2JUO A;  4IC7 B;  4MGZ E;  1IPG A;  2JZZ A;  4DHZ B;  2MP2 A;  1P98 A;  2L0F A;  1LQB A;  4EEW A;  2CHW A;  5L83 A;  4FJV B;  4BVU C;  1V81 A;  3AXC A;  1E8W A;  2I1K A;  4NJ6 A;  4BOZ B;  2ZPY A;  4LJO B;  1WR1 A;  3ZO5 B;  4AJY B;  4HLE A;  3PVL A;  4GIV A;  3ALB A;  1TBE A;  3AU4 A;  3LJ3 A;  4OVV A;  2ZEQ A;  2M4N A;  3ZNH B;  4MSQ B;  4TUU A;  4ICU A;  4WJO A;  2BYF A;  1Q5W B;  2A4Z A;  1X1M A;  4LDT D;  1V2Y A;  3ZLZ A;  3ZW3 A;  3KYC D;  4W9J A;  2L00 B;  5KHO A;  4EKU A;  1HE8 A;  1Q0W B;  3ECI A;  5CHV C;  4EFO A;  2PE9 A;  3H7S A;  3QAQ A;  5D94 A;  1Z5S B;  3RUI B;  1IP9 A;  2FCM A;  4TV3 A;  2JZ3 B;  4M8M A;  3A33 B;  2JY6 A;  2MBQ A;  2MQJ A;  4J6I A;  2CR5 A;  2KVR A;  3TCA A;  1OEY A;  2DYB A;  2LXC A;  5LXI B;  4NPN A;  3ZRC A;  2NCN A;  1YJ1 A;  5C1Z A;  2MP2 B;  2O6V B;  2IO0 B;  4I6N B;  1RFA A;  4G3X B;  2LJ5 A;  4DWF A;  4FLH A;  5E6O A;  1V49 A;  2DYM A;  2PPH A;  1OTR B;  4KDL B;  4KVG B;  4W9K A;  4IWP A;  4ZRJ A;  2RPQ A;  2MA9 B;  2W9N A;  4LDT B;  1E8Z A;  2KC2 A;  3WAN A;  2MBH A;  4MH0 E;  2DAF A;  4RM8 A;  2YLM A;  2C7N B;  2MBE A;  3KUD B;  2DX5 B;  4MJS B;  2JRH A;  3D32 A;  3HM3 A;  2BKR B;  1E8Y A;  1WMH A;  1XT9 B;  3APD A;  3ZTD A;  1UGM A;  3DPD A;  3RZW C;  3VQI A;  1YX5 B;  2G4S A;  3M63 B;  4IWQ A;  4NNJ B;  1WX8 A;  2LGX A;  4BBN C;  2N1V A;  3AUL A;  2IY1 B;  1T0Y A;  2KOX A;  4GOC A;  5JHB A;  2MBB B;  4GU2 A;  2BKF A;  4WQO B;  4WWN A;  4HDQ A;  2CU1 A;  1ISN A;  2N9E B;  2LRW A;  1V5O A;  4HCN B;  2LVO A;  4IM0 A;  4WJQ A;  4DHZ E;  4DDI D;  2ZVO A;  1D3Z A;  4FHJ A;  1L2N A;  1SIF A;  4MGY E;  4RM9 A;  4FBJ B;  1UBI A;  3SDL C;  1CMX B;  3WAO A;  4PYU A;  2LI5 A;  4WAA A;  2KC1 A;  4NJ7 A;  3L16 A;  3R3M A;  3U7D A;  1WXV A;  1YIW A;  4K7U A;  1KOT A;  3UGB B;  4ICV A;  2REX A;  4PS3 A;  4GXB A;  1I35 A;  3H1U A;  3VTU A;  3OJ4 B;  3W1S C;  1V6E A;  2V3S A;  4GDL B;  2OJR A;  4HXD A;  3TJP A;  5CTR C;  1WGG A;  3K9P B;  3PGE A;  4ZDV A;  2WX1 A;  1F9J A;  1R4M I;  2KK8 A;  3HHM A;  4A3O A;  3R66 C;  4AJW A;  2KX0 A;  4ANX A;  5G55 A;  2K8C A;  4W9L A;  2KTR B;  5DPT A;  2L0T A;  5DCN A;  1EO6 A;  4HVB A;  5BO4 B;  3ZRF A;  5DPW A;  1WGY A;  5E6P A;  2J0M A;  2J7Q B;  2KDF B;  2KO3 A;  4WWO A;  2ZCB A;  1J19 A;  4W9G A;  4BKG A;  1EF5 A;  4W9H A;  1LFD A;  1YX6 B;  2K8H A;  2FCN A;  1H4R A;  1OQY A;  1WJN A;  3DVN V;  1WZ3 A;  4I6P A;  3PHW B;  1L7Y A;  3TBL D;  2EMS A;  1P1A A;  4G50 A;  1NDD A;  1GNU A;  2BGF A;  3KYD D;  2KFK B;  4B6W A;  1GC6 A;  2MX2 A;  1ZKH A;  2N9P C;  2YVC A;  3L17 A;  4NAW A;  4YL8 A;  3ZVV A;  3EEC A;  2D07 B;  2LVQ A;  4GDK B;  4PS8 A;  3DBR I;  1H8C A;  1E5W A;  2N9X A;  3R7R A;  4RMA A;  2EMT A;  1A5R A;  4JLC A;  1G6J A;  5JH5 C;  3ZIM A;  4NAW B;  2V1Y A;  1C1Y B;  2G45 B;  2HTH A;  2KHW B;  1RAX A;  3VUW A;  2BWE S;  3UIN B;  4DHJ B;  1OGW A;  1NBF C;  1WYW B;  2WX0 A;  5GMV A;  1S1Q B;  3JSV B;  3RUL A;  1P9D U;  2KLC A;  3PV1 A;  4HPL B;  5C23 A;  1BT0 A;  2MW5 A;  2GBN A;  3JW0 X;  3KVF B;  2ZVN A;  3NZU A;  3L0W B;  1WE6 A; 
#chains in the Genus database with same CATH topology
 3AEA B;  3ONS A;  3Q8E A;  4HDO A;  3X23 A;  4BFR A;  4K1R B;  4WH4 A;  1WXS A;  1TZ1 A;  3PPA A;  2DWQ A;  3NY5 A;  2HD5 B;  3VTV A;  2K1F A;  3BIN A;  3AE1 B;  2I38 A;  2AL3 A;  1FXT B;  3RNF C;  3NOB A;  2J0J A;  4DDG D;  2D3A A;  1OQQ A;  4ARC A;  3QK0 A;  1QLB B;  1L4Z B;  3B2G A;  4NQK E;  2JWZ A;  2IO2 B;  4WUR A;  1JWA D;  2GBM A;  3MHS D;  2O6V A;  3O65 B;  1DYQ A;  1WRD B;  1V8C A;  2D3G A;  4GDK A;  3H6N A;  3PHX B;  1AN8 A;  3DBH I;  1PFD A;  3AE7 B;  2V3N A;  2DZK A;  3KW5 B;  2ZNV C;  2LXA A;  4GMV A;  2XK5 B;  1N63 A;  4GDL A;  4X57 B;  2WDT B;  1EUV B;  3TEW A;  1PGA A;  1V86 A;  4BZA A;  2KDI A;  4LNI A;  1BUI C;  3TSS A;  3DQV A;  4NJC A;  2K9X A;  3ML8 A;  4L2Y A;  2K5P A;  1V80 A;  4H2A A;  4E71 A;  2BPS A;  3OJ3 A;  1YJI A;  2IGG A;  2K39 A;  2RDB C;  4E3C A;  1YD8 U;  2J53 A;  1WIA A;  3QC8 B;  3NVV A;  2R2O A;  1YOV B;  3CSF A;  1VR9 A;  2L32 A;  1ACC A;  4RNA A;  1GG3 A;  3N1Y C;  3CMM B;  1DOY A;  5JZE B;  2R2Q A;  2WS3 B;  3VUX A;  2FCQ A;  2KJH B;  5LXH A;  2GOW A;  2KMA A;  4KV2 A;  4DK5 A;  2XK5 A;  1F1H A;  3GOE A;  2CS4 A;  2B76 B;  2FUH B;  3ZXV A;  3MJ5 A;  4EE2 A;  3TMP B;  3W2D A;  4P7I A;  1WM2 A;  1QQR A;  5D2M B;  4BOS C;  3KUZ A;  4ARI A;  5IAA C;  3U4E G;  1GPX A;  4XDD A;  2K22 A;  2QC8 A;  1L0Y B;  2LGD A;  1T6B X;  2LUE A;  4P16 A;  3TUO A;  1TS5 A;  4D2K A;  2GBK A;  1MPE A;  2KZR A;  1WSP A;  3DVG Y;  3L54 A;  1JRU A;  2N7E A;  2ASQ A;  2KWV B;  2XBB C;  3GP7 A;  5G5H A;  3MTN B;  4W9F A;  3KUC B;  4WWP A;  1UUP A;  3OWE B;  1Q1O A;  1V1O A;  1KH0 A;  3TL5 A;  2CKH B;  3IAS 1;  3BZD B;  3UI3 A;  3SHQ A;  2EKE C;  4P1C C;  2KTR A;  4LCD E;  4KZC A;  2KAJ A;  5CX3 A;  4II2 B;  4N6E B;  5BYQ A;  1MG8 A;  3ETR A;  2KFK A;  3EHV A;  1AWD A;  3DOW A;  4JIO U;  5BMI A;  3LYY A;  3ABV B;  4TQ0 A;  2KTF A;  2D5G A;  4WQM A;  2LMC A;  3Q69 A;  3L10 B;  3MC9 A;  4RH6 A;  2D10 A;  2DZM A;  4HPM B;  3A9K B;  1OEY J;  2QHO A;  4URK A;  5EDS A;  2ZNV B;  4GN1 A;  4F7Z A;  1ZDX A;  2O2V B;  2KMM A;  3BVG A;  1XLP A;  2JXT A;  1FD6 A;  1JRO A;  3Q8F A;  4S17 A;  3JYU A;  3QAR A;  1GB4 A;  1SE2 A;  2JU6 X;  3PRP B;  5G5G A;  3Q6B A;  4HWI B;  5G2N A;  1FRR A;  5IP4 D;  2BB5 A;  2NS5 A;  3RYT A;  1MHH E;  2L3Z A;  3Q3J A;  2MHJ A;  2Q5W D;  2ZPN A;  3Q8C A;  4ANU A;  3U52 E;  2KD0 A;  3CIR B;  1WH3 A;  2JZP A;  2IDY A;  1YQB A;  4XWW A;  1C3T A;  4HJG E;  4W9E A;  4ZRQ A;  2RSU A;  1ENF A;  2L0F A;  4OW0 A;  3AXC A;  4BOZ B;  1EWY C;  1TJE A;  1ZPS A;  2Y3A A;  2ZEQ A;  4MSQ B;  4TUU A;  4EKU A;  1HE8 A;  3ECI A;  3H7S A;  5D94 A;  2FCM A;  2JY6 A;  1I4R A;  2CR5 A;  4NPN A;  1KTK A;  3MC8 A;  4G3X B;  2LJ5 A;  4DWF A;  3R2I A;  3VR8 B;  1OTR B;  4IWP A;  2R61 A;  2KC2 A;  4LNK A;  2MBH A;  1I4P A;  1DOI A;  2H88 B;  2JRH A;  1CZP A;  3IT6 B;  1NI3 A;  1E8Y A;  1WMH A;  1XT9 B;  3CWI A;  1XLQ A;  3VQI A;  1M4V A;  2LHE A;  4KGT A;  3AUL A;  2KOX A;  1FO4 A;  1FRD A;  3BK2 A;  2MCN B;  2FBW B;  2N9E B;  4WJQ A;  1D3Z A;  1L2N A;  4RM9 A;  4FBJ B;  2BTE A;  2NTT A;  2JX5 A;  2M56 B;  4P6V F;  1HEZ E;  4K7U A;  3BWU D;  3DHG C;  4ICV A;  1A70 A;  2REX A;  3NVW A;  1I35 A;  1V6E A;  2V3S A;  1SJE D;  2DBY A;  3PGE A;  4AQ7 A;  2KX0 A;  4ANX A;  5MPO A;  5E6J A;  3O13 A;  5E6P A;  3AEC B;  1LFD A;  1ROE A;  3DVN V;  4I6P A;  1XCT L;  3R8B A;  2INC C;  4DQO C;  3AE4 B;  2MX2 A;  1B9R A;  2WXO A;  3L17 A;  4NAW A;  4PS8 A;  3DBR I;  1L0X B;  4JLC A;  2MEK A;  4NAW B;  1C1Y B;  1RAX A;  2BWE S;  1OGW A;  1WYW B;  5GMV A;  3JSV B;  3LXF A;  3PV1 A;  1WWT A;  1ZOY B;  1HTO A;  4OZC A;  2JF5 A;  2XNA C;  5L95 C;  4NZL B;  4YSX B;  3R7Q A;  4NQL B;  1LXD A;  4KZ0 A;  4PS7 A;  2GB1 A;  3DVN U;  3NZS A;  3NVZ A;  3EA6 A;  1LO5 D;  2V4I B;  1T0R C;  1RM6 C;  4US9 A;  2O2V A;  3RN9 C;  2XEW A;  3LB8 C;  1ET6 A;  2LRU A;  2PEA A;  3RI7 C;  3BII D;  3ZNI D;  1FM0 D;  1FFV A;  2MJE A;  2G3Q B;  3HVD A;  1TS2 A;  3S2A A;  3T8M A;  1J7B A;  3VRA B;  1HTQ A;  3MC0 B;  1KJT A;  3APF A;  1JQ4 A;  1UGJ A;  1WYG A;  5TSS A;  1Z2M A;  2GMI C;  2MRP A;  2N9L A;  4N58 A;  4WJP A;  4R3D A;  5AZG A;  2QIE B;  1J8C A;  2BB6 A;  3FIL B;  2L7R A;  2IND C;  4M8N A;  4JQW C;  2IYD B;  3UQA A;  3APC A;  1C79 A;  1RWS A;  2BW2 A;  3NS8 A;  1C76 A;  1VRA B;  4K3C A;  1EF1 A;  4B9K A;  2NPT B;  1FXA A;  2G4D B;  2V4L A;  4II3 B;  3VTW A;  2VZK B;  1F52 A;  2I2Y A;  4FXC A;  4MM3 A;  2AX5 A;  3VRB B;  3HVZ A;  3AE9 B;  3A4S C;  5AZF A;  5GXG B;  4ZRK A;  2FID A;  2WP9 B;  3DBL B;  3H9D A;  4US8 A;  2WXR A;  3L4P A;  2KFJ A;  2WLB A;  4AOF A;  1ZGU B;  2C9W B;  3A4R A;  1IUE A;  5FKA C;  3ZNG C;  3PS6 A;  2WXQ A;  1Y8R C;  4IG7 B;  1J0G A;  2DYO A;  1UEL A;  2LJI A;  5J17 A;  2ZW1 A;  4XDC A;  2KKC A;  2PW9 A;  4IKG A;  4JX1 C;  2HE7 A;  4RCO A;  4TMA B;  4Q2J A;  1JCK B;  3P42 A;  3T9L A;  3IBE A;  4JWU C;  4OZA A;  1XLN A;  3KWV A;  4K3B A;  1DGJ A;  1LGR A;  3OLM D;  4FA6 A;  2RPV A;  3RNC C;  3WA0 A;  4MEL A;  3A9K A;  5HHD G;  3QJZ A;  5AEK B;  3GZN I;  4MSM B;  1JWM D;  1WGR A;  5TR5 A;  4B95 A;  2V9H A;  2J0K A;  3AH7 A;  3C8Y A;  1WJ6 A;  2FAZ A;  2VRR B;  3N30 A;  3Q3N C;  2LGY A;  4IDI A;  4BKT A;  2IY0 B;  4HK2 A;  2K25 A;  3A9J A;  4BKS A;  1K51 A;  1QIL A;  3M95 A;  1HZ6 A;  1FIQ A;  5FR6 A;  1T5X D;  2SAK A;  4A9A A;  2AL6 A;  1SJH D;  3A1Q B;  1CK1 A;  1E0Z A;  1EU4 A;  1I4G A;  2Y5P A;  5IOI A;  3CST A;  2V0G A;  2L76 A;  3ZDM C;  1N5W A;  3JVZ X;  2M17 A;  4NY0 A;  1TY0 A;  3QWZ B;  2LZ6 A;  3PTF C;  4K7W A;  2KMC A;  4M0W B;  2E3T A;  2JT4 B;  2NBW B;  4DXA B;  4MJS A;  4N59 A;  2C7H A;  1YNT E;  3B1L X;  3QA8 A;  3PRZ A;  3BVZ A;  1TZO A;  2Z0D B;  2I1J A;  2LGI A;  3V61 A;  3ZDT A;  4F8C B;  3B0A A;  1R7S A;  2WDQ B;  5AUI A;  1SB3 C;  2UYZ B;  3B2F A;  3WAP A;  2VH1 A;  2JPH A;  4KKJ A;  3EGR A;  2N7J A;  4M01 A;  1VD2 A;  3Q3F A;  3IXS A;  1E7P B;  3BY4 B;  4KIK A;  4C80 A;  1R4M B;  2N4F A;  4W9C A;  4CQN A;  1HQR D;  3N3K B;  3Q8B A;  3UIO B;  1WXM A;  2IPK D;  2QEJ C;  4ZHO A;  4EZL A;  2D2Q A;  2NMQ A;  3GE8 C;  3L13 A;  2KQS A;  4HJK A;  2SEB D;  1SE3 A;  3U7Z A;  3ZUN A;  2AWT A;  4FN2 A;  1K50 A;  2B3A A;  3EFC A;  2N1W A;  3PRM B;  2WXK A;  5H92 C;  1U4A A;  1C9F A;  3HIZ A;  4M0W A;  3DBR B;  1V5T A;  1J7A A;  3BYY B;  3P2B A;  4IUM B;  5LLI A;  3GB1 A;  1NEN B;  2NPT A;  4BKS D;  3IVF A;  1WGH A;  4MGK E;  1E8X A;  4DBG A;  4XWT A;  2JVC A;  4C00 A;  1FEH A;  5KHQ A;  3V60 A;  3V6E B;  4A8X C;  1WM3 A;  2WXF A;  2WXH A;  4EOY A;  2VH2 A;  1L0V B;  1JWU D;  2JUO A;  1MG4 A;  1P98 A;  2MP2 A;  1LQB A;  4EEW A;  4BVU C;  1V81 A;  4NJ6 A;  3NG0 A;  3PVL A;  4LK0 M;  4GIV A;  3LJ3 A;  5HG2 A;  1D5Z C;  4ICU A;  4WJO A;  2EKI A;  1Q5W B;  3ZXR A;  2A4Z A;  1X1M A;  4LDT D;  1V2Y A;  4W9J A;  2L00 B;  5KHO A;  1P7F A;  3RUI B;  1L5P A;  4TV3 A;  3A33 B;  3ZYY X;  3TCA A;  5LXI B;  2Y5C A;  1YJ1 A;  1Y56 A;  4FLH A;  2DYM A;  2PPH A;  4LDT B;  2AQ1 B;  2C7N B;  1XLO A;  3HM3 A;  1I4X A;  1UGM A;  1MJD A;  4A6Q A;  3M63 B;  4IWQ A;  5FR3 A;  4NNJ B;  1WX8 A;  4OHJ A;  4BBN C;  2N1V A;  1T0Y A;  2WXG A;  4MT5 A;  4GOC A;  4GU2 A;  4WQO B;  5BYS A;  4HDQ A;  4P1B C;  3N1Z C;  1ZUD 2;  3MHZ A;  4DHZ E;  1UF0 A;  2ZVO A;  1CQV A;  4FHJ A;  1C4C A;  4YSZ B;  1UBI A;  3WAO A;  2V3P A;  1GOZ A;  4PYU A;  3L16 A;  1WXV A;  1YIW A;  1TYG B;  4KGR A;  4PS3 A;  2QJL A;  1JAL A;  3VTU A;  3OJ4 B;  4GDL B;  1WGG A;  2JSV X;  3DWG C;  2WX1 A;  1F9J A;  4W9L A;  2KTR B;  4HPP A;  1YQ3 B;  3AMZ A;  3BYT B;  3BK1 A;  1TKG A;  1YN4 A;  2J7Q B;  2KDF B;  4LNO A;  4WWO A;  1XXG A;  2AQ2 B;  4W9G A;  3KWL A;  1HZ5 A;  4W9H A;  1YX6 B;  3SEB A;  1ZP0 B;  1H4R A;  1OQY A;  3IT4 B;  3PHW B;  3ZJV A;  2LGS A;  4G50 A;  2EMS A;  1NDD A;  1D5M C;  3KYD D;  1ZKH A;  4LNN A;  2YVC A;  3EEC A;  3C19 A;  1H8C A;  4RMA A;  1PGB A;  1GB1 A;  1G6J A;  2V1Y A;  2HTH A;  1FNU A;  4MH8 A;  4C7Y A;  2WDV B;  1T0S C;  3JW0 X;  2ZVN A;  4MGZ E;  2FIF A;  4ZYN A;  2ACZ B;  3QIJ A;  4OZB A;  1QZE A;  3PZ7 A;  4DHJ D;  4RF0 A;  1TKY A;  5J18 A;  2WU5 B;  2M8S A;  3I5J C;  3IAM 1;  1OQR A;  3IHP C;  1QF6 A;  2Z8L A;  3UQB A;  3H7P B;  4J3O D;  5DPR A;  3SD5 A;  2K8B A;  2DLB A;  3WIM A;  5DPS A;  3I63 C;  4PYZ A;  3PRE A;  2Y5B B;  1FCC C;  3ZNZ B;  1SSN A;  3AU5 A;  1ZXI A;  3VXW A;  1K8R B;  1TT5 B;  2BT6 A;  2WGS A;  1WX7 A;  3PLV A;  2GLS A;  3NVY A;  4MM3 B;  1YMH E;  3E56 A;  3AE3 B;  3H8H A;  4TKN A;  1GUA B;  1FCL A;  2IBI B;  3V6C B;  2N7D A;  3QHT A;  2KWC A;  3U8Z A;  3HM6 X;  1C4P A;  1AYF A;  4G0N B;  3U2S C;  2FCS A;  3ZJT A;  2C5L C;  3QCA A;  2KNB A;  3QQ8 B;  3FKY A;  1TTN A;  2CHZ A;  3OAW A;  3K9O B;  1QOA A;  1F0Z A;  3N1X C;  1N62 A;  4CYE A;  5CHF A;  1TGZ B;  3RNA C;  1UZX B;  3A9J B;  3SR6 A;  2JXX A;  1C78 A;  1V97 A;  2GBJ A;  1YN5 A;  4M02 A;  4W9D A;  4IOI E;  2QSD A;  1SEB D;  1XCQ L;  4MAC A;  3T3N A;  4YXD B;  2GRI A;  2OOB B;  2KQ7 A;  2DZI A;  4XE0 A;  2BYE A;  1OFF A;  1I42 A;  1XF5 L;  2FE8 A;  3TEY A;  2KWD A;  4A55 A;  1LM8 B;  4A3P A;  1VLB A;  2ONQ A;  2IGH A;  4WAF A;  4LLG M;  3X0W A;  4AP4 C;  1IBX B;  1SXT A;  4IM2 A;  1NI2 A;  3ML9 A;  1UNS A;  1JML A;  4WIP A;  5BYR A;  1WZ0 A;  3VDZ A;  4JE3 B;  2NBU A;  2NVU I;  4JWS C;  3Q8A A;  2JYT A;  3U30 A;  2PTL A;  1RLF A;  2PIA A;  1L4D B;  1R4N B;  1E7V A;  3J9C A;  5HKH A;  1UBQ A;  3DHH C;  1F2R C;  1VCB A;  1R4N I;  5D7G A;  3SU8 X;  2W3R A;  2PKO A;  1WI0 A;  2L05 A;  5CHW A;  2BBC A;  2IGD A;  3WAL A;  1XQQ A;  3RZF A;  4KX6 B;  2KDE B;  2FNJ B;  3ENE A;  2WXL A;  1CJE A;  3AEE B;  4W9I A;  1AW7 A;  4RF1 A;  3AB5 A;  2H89 B;  4HCP B;  4IM3 A;  2DEN B;  3NJT A;  3VFK A;  2LEK A;  2HTM E;  3URY A;  3HK0 A;  3P1M A;  1KM7 A;  5EE0 A;  3MJW A;  3AEG B;  4K81 A;  2CJN A;  3DBH B;  4OVZ A;  3RD2 A;  2HDE A;  4C7Z A;  4AS1 A;  2MWS B;  1P0R A;  4DXF A;  4FJY A;  1SIJ A;  3DWM A;  2RDH A;  3NZ3 A;  4XX5 A;  2MSE D;  1TIF A;  1K53 A;  2K6D B;  3KQ4 A;  4RGO S;  5LNK 1;  5EE9 A;  2WXM A;  1UD7 A;  2IJ0 A;  1WJU A;  1WMH B;  1ET9 A;  5IN7 A;  2NBV B;  3VVW B;  1PQS A;  1L6V A;  2LFI A;  1JWS D;  5IKC M;  4TSS A;  3ZGZ A;  1P3Q U;  3UF8 A;  3H7P A;  1AAR A;  5HFY A;  1WY8 A;  2WXN A;  2PLP A;  3DBL I;  3AE2 B;  3SFE B;  2BVC A;  4RGT A;  4EZK A;  1E6E B;  1JRP A;  2WQY B;  2AEH A;  2C60 A;  2LD9 A;  4KGS A;  4RGN A;  2JRI B;  4KIK B;  1KLU D;  4NAM A;  2W3S A;  5IO9 A;  2MLB A;  1WRI A;  1ZXH A;  2LAS A;  1QKZ A;  4FAD A;  1B1Z A;  4HRS A;  4CHK A;  2GBR A;  4GGQ A;  2LWP A;  1IGD A;  4GSW A;  2OJW A;  1WXA A;  1MI0 A;  3M3J A;  1XD3 B;  2UWQ A;  4XZ4 A;  2QIL A;  2N0S B;  2BYT A;  3VUY A;  4DXG A;  4FHK A;  4TQ1 A;  3DDC B;  2IO1 B;  1WFY A;  1BML C;  1ZDV A;  2MBO A;  4GLS C;  1WGK A;  2KXJ A;  2Z59 B;  2D11 A;  1QOF A;  2KYW A;  4BBN F;  2YEP F;  5C2T B;  1IPG A;  2JZZ A;  2WXP A;  4DHZ B;  2JWU A;  5L83 A;  2CHW A;  3GS2 A;  1V1P A;  2I1K A;  2ZPY A;  4AJY B;  1WR1 A;  3ZO5 B;  4HLE A;  2INP E;  3ALB A;  1TBE A;  4OVV A;  2G1E A;  2M4N A;  3W9C B;  1UWX A;  2BYF A;  3AE6 B;  1YN3 A;  1HXY D;  1IBX A;  1D6E C;  4XGA B;  3KYC D;  1FPY A;  1N6Z A;  5CHV C;  2M0A A;  2PE9 A;  3AV8 A;  1Z5S B;  1I4H A;  1NYR A;  1J7C A;  2JZ3 B;  3AN1 A;  4M8M A;  5D3I B;  2MQJ A;  2KVR A;  2QDF A;  2DYB A;  2W55 A;  3P4R B;  3ZRC A;  2NCN A;  2MP2 B;  2IO0 B;  4I6N B;  1RFA A;  1TS4 A;  4ZRJ A;  4KDL B;  4W9K A;  2J42 A;  4XYC A;  2RPQ A;  1I4Q A;  3P4Q B;  2DAF A;  2YLM A;  2MBE A;  3WCQ A;  2BKR B;  1YX5 B;  2G4S A;  5EE1 A;  4LNF A;  2LGX A;  1F77 A;  2EEL A;  3Q14 C;  1JW9 D;  2QCZ A;  5JHB A;  2MBB B;  3I9V 1;  4WWN A;  2CU1 A;  1ISN A;  1V5O A;  1DOX A;  4MGY E;  2UU7 A;  2M19 A;  1CMX B;  2LI5 A;  4WAA A;  4NJ7 A;  3R3M A;  4RFB A;  2MH7 A;  1KOT A;  3UGB B;  2E6X A;  3W5V B;  1K52 A;  4GXB A;  2PVG C;  3H1U A;  3TJP A;  5FK9 C;  1HA5 A;  1TS3 A;  1N60 A;  3K9P B;  1R4M I;  2KK8 A;  3HHM A;  4A3O A;  5D3D A;  2K8C A;  2L0T A;  1PDX A;  1EO6 A;  5DCN A;  3SFD B;  5BO4 B;  4HVB A;  2NTS A;  3DHI C;  1WGY A;  2X8X X;  3AM9 A;  4BKG A;  2K8H A;  1EU3 A;  1FFU A;  1WZ3 A;  1L7Y A;  3TBL D;  5H8Y E;  2RDG A;  2KFK B;  1GC6 A;  2N9P C;  2BS4 B;  2GI9 A;  3NUH B;  1E5W A;  1T0Q C;  3FIL A;  5EE3 A;  1A5R A;  5I4D A;  1VDV A;  3ZIM A;  2G45 B;  2KHW B;  3KLS X;  3VUW A;  3UIN B;  4DHJ B;  1NBF C;  1GAQ B;  3I57 A;  2KLC A;  4HPL B;  1BT0 A;  2MW5 A;  2GBN A;  1IGC A;  2RMM A;  3Q3M C;  3KVF B;  1ZE3 D;  3NZU A;  3L0W B;  1WE6 A;  2D3B A;  3AEB B;  4E74 A;  3ZTC A;  1WXQ A;  4YTP B;  4O1N A;  5AZH A;  3HUI A;  5J2R A;  1NYQ A;  4FUL A;  2L8J A;  4G11 A;  2L52 A;  1PYW D;  3ZQ4 A;  1I7H A;  4YSY B;  4F1S A;  2RGF A;  2ZCC A;  1IYF A;  4JGH B;  2K6Q A;  2DZJ A;  2M1M A;  2BF8 B;  2ON8 A;  1KLV A;  4ZRI A;  2K3U A;  4QAY A;  1QT9 A;  3EUB 2;  2WXI A;  3I3T B;  3AE8 B;  3FAH A;  3PZ8 A;  3EC8 A;  4MGI E;  1BXT A;  3V05 A;  2RR9 A;  2DAJ A;  4AWJ A;  1FXI A;  1N5X A;  3FC4 A;  3P4P B;  1SE9 A;  3WAM A;  4C56 C;  4HKQ A;  3B9J A;  1SF0 A;  2RD0 A;  3CF6 E;  3NS1 A;  2INN E;  1E90 A;  2M0X A;  3N32 A;  4OVU A;  3W1S A;  2KAN A;  2D3C A;  4B0E A;  3KH0 A;  3IFW B;  1FNW A;  3LDZ E;  2X38 A;  2WYQ A;  1SE4 A;  4LTU A;  5T8I A;  2HJ8 A;  2QMT A;  2WXJ A;  4XC2 A;  2W54 A;  2LHD A;  2JQR B;  3TEX A;  2BYV E;  3QX1 A;  4I6L B;  1GC7 A;  3VAW A;  1M94 A;  4JL9 A;  5C3J B;  4L1B A;  3PZD A;  3T3O A;  2KLG A;  4YWG G;  2O6V D;  1EM7 A;  2KDB A;  2KJR A;  1WX9 A;  3RFZ B;  4KDI C;  1P7E A;  2A5U A;  3W1Y A;  3PT2 B;  2KX3 A;  2AQ3 B;  2J52 A;  2IZV B;  4L23 A;  3TIX A;  3VHT C;  3EFU A;  4KSK C;  1E9M A;  2IO3 B;  2CHX A;  1L6U A;  5D6J B;  2BQQ A;  4ZYS A;  1VZ8 A;  5AUK A;  4CO7 A;  2PVO D;  2ZZP B;  3NRZ A;  1KRH A;  1SGH A;  2KJ6 A;  1F2R I;  3NHE B;  2KT7 A;  2WU2 B;  4S0R A;  2FUG 1;  3W5U B;  2TSS A;  2KVZ A;  1SBB B;  4ASW C;  2KN4 A;  1T3Q A;  3HRD D;  2OED A;  4M00 A;  3ZJU A;  2CJO A;  1E7U A;  3C0R B;  1C77 A;  2CU3 A;  2PMV A;  4IW0 A;  1KF6 B;  1EWC A;  3AE5 B;  1VZ7 A;  1FMA D;  2DNF A;  1NVI D;  2DHZ A;  4EZJ A;  4GB9 A;  2WWZ A;  1WR6 E;  3MFG A;  1WJ4 A;  2AYO B;  1C4A A;  4K7S A;  3RCZ A;  1ZW7 A;  2BWF A;  3JSV A;  1RRB A;  3MP9 A;  3VR9 B;  1V1P B;  1UWM A;  3N20 C;  3B08 A;  3M62 B;  1N61 A;  1JWB D;  3UIP B;  3GZN B;  2WNM A;  4WJN A;  4ANW A;  4HKZ E;  3RNE C;  5IA7 A;  3DCG A;  2N9K A;  4LJP B;  4MDK E;  5JXV A;  1S3S G;  3DVG X;  4BAX A;  2PE6 B;  2MJD A;  3IG3 A;  2BS2 B;  1TY2 A;  3R2T A;  4IWO A;  2LVP A;  3L08 A;  3V62 A;  3AI5 A;  2Z0E B;  1YQ4 B;  4PT5 A;  1ESF A;  2KN5 A;  1V9J A;  2W82 A;  2WHI A;  4A20 A;  4REZ A;  1UH6 A;  2OHF A;  2L83 A;  2KAC A;  3A1Q A;  4FJZ A;  4ANV A;  2KWU B;  5HI1 A;  1MVK A;  4N9F 4;  2PJH A;  4AUQ C;  1WGD A;  3OG5 A;  3Q3O C;  3PSE B;  3DBS A;  3ZKJ C;  2HJ1 A;  4HEA 1;  2ZW0 A;  1MFW A;  1GJZ A;  2KQ4 X;  1RYJ A;  3PLU A;  3VH3 B;  1WE7 A;  3V3X A;  5E6N A;  1NEK B;  4MEM A;  4KSL C;  1E10 A;  3RNG C;  1WF9 A;  2ZJD A;  3AEF B;  1RFK A;  1KFY B;  3VH4 B;  5JHA A;  1TKE A;  2MJ3 A;  4EUT A;  3RT3 B;  2C7M B;  2NR2 A;  4HRO A;  2YEP B;  4KKI A;  4UDU C;  3BVM A;  4IC7 B;  4FJV B;  1E8W A;  5BMG A;  4LJO B;  2L1A A;  3AU4 A;  2BS3 B;  3ZNH B;  4C4V B;  4JPS A;  3RPF C;  3ZLZ A;  3ZW3 A;  1D4B A;  1VJK A;  4EFO A;  1Q0W B;  3QAQ A;  1IP9 A;  2MBQ A;  4J6I A;  1QOG A;  1VZ6 A;  2ICI A;  1OEY A;  2LXC A;  5C1Z A;  2O6V B;  1YJJ A;  4ITK A;  5E6O A;  1QOB A;  1V49 A;  4KVG B;  3AED B;  2MA9 B;  2W9N A;  1E8Z A;  3P4S B;  3WAN A;  4MH0 E;  4ZHP A;  4RM8 A;  3KUD B;  2DX5 B;  4ACF A;  4MJS B;  3D32 A;  1D5X C;  3APD A;  4ZOH C;  3ZTD A;  3DPD A;  3RZW C;  2KDM A;  2IY1 B;  2VZK D;  2BKF A;  4YTN B;  2LRW A;  4HCN B;  2LVO A;  4IM0 A;  4USA A;  4DDI D;  4B0M A;  1SIF A;  3PO0 A;  3SDL C;  3RMK C;  2KC1 A;  3P63 A;  2G9H D;  3U7D A;  3N9Y C;  1KLG D;  3TEZ A;  2WDR B;  1STE A;  3W1S C;  2OJR A;  4HXD A;  5CTR C;  4ZDV A;  1PGX A;  3R66 C;  4AJW A;  5G55 A;  2XN9 C;  4C4V A;  5DPT A;  1FNV A;  3ZRF A;  5DPW A;  2J0M A;  5BMH A;  4YTM B;  2KO3 A;  2ZCB A;  1J19 A;  1EF5 A;  2FCN A;  1WJN A;  1XO3 A;  1PUT A;  4WWM A;  2LUM A;  3RNB C;  4YT0 B;  1P1A A;  1GNU A;  2BGF A;  4B6W A;  1XEE A;  2K0P A;  4YL8 A;  3Q2A C;  3ZVV A;  4RGM A;  2D07 B;  2LVQ A;  4GDK B;  3E9S A;  2N9X A;  4PK1 A;  3R7R A;  2EMT A;  5JH5 C;  2J4X A;  1Q10 A;  4A90 A;  2WX0 A;  1S1Q B;  3RUL A;  1P9D U;  4ZRP A;  5C23 A;  3GE3 C;  2JYE A;  1MHX A; 
#chains in the Genus database with same CATH homology
 2FIF A;  4ZYN A;  3ONS A;  2JF5 A;  4E74 A;  3QIJ A;  4HDO A;  3ZTC A;  5L95 C;  1QZE A;  3R7Q A;  4DHJ D;  4NQL B;  1LXD A;  4KZ0 A;  4PS7 A;  5AZH A;  3X23 A;  5J2R A;  4BFR A;  4FUL A;  3DVN U;  4K1R B;  3NZS A;  5J18 A;  1WXS A;  1TZ1 A;  2L8J A;  4G11 A;  3PPA A;  2M8S A;  3IHP C;  3NY5 A;  2HD5 B;  3VTV A;  2K1F A;  3UQB A;  3BIN A;  4F1S A;  2RGF A;  3H7P B;  5DPR A;  3SD5 A;  2K8B A;  2ZCC A;  2O2V A;  2AL3 A;  1FXT B;  1IYF A;  4JGH B;  3NOB A;  2J0J A;  2K6Q A;  3WIM A;  5DPS A;  2DZJ A;  2XEW A;  4DDG D;  4PYZ A;  2M1M A;  2BF8 B;  3PRE A;  2Y5B B;  1KLV A;  3ZNZ B;  4ZRI A;  3AU5 A;  3VXW A;  3QK0 A;  1K8R B;  2LRU A;  4NQK E;  2PEA A;  3I3T B;  2JWZ A;  2IO2 B;  1WX7 A;  2GBM A;  3PLV A;  3ZNI D;  3EC8 A;  4MGI E;  3MHS D;  2RR9 A;  2DAJ A;  2O6V A;  2G3Q B;  4AWJ A;  3O65 B;  4TKN A;  1GUA B;  1WRD B;  2IBI B;  2D3G A;  4GDK A;  1SE9 A;  3H6N A;  3S2A A;  3WAM A;  3T8M A;  3V6C B;  1KJT A;  2N7D A;  2RD0 A;  3PHX B;  3APF A;  3QHT A;  3CF6 E;  2KWC A;  3U8Z A;  3HM6 X;  1Z2M A;  2GMI C;  3DBH I;  1E90 A;  4G0N B;  2MRP A;  2M0X A;  2FCS A;  4WJP A;  3N32 A;  2DZK A;  5AZG A;  1J8C A;  2C5L C;  3QCA A;  2L7R A;  2KNB A;  3QQ8 B;  4OVU A;  2KAN A;  3KW5 B;  3W1S A;  4M8N A;  4JQW C;  2IYD B;  2ZNV C;  2LXA A;  4GMV A;  3APC A;  3UQA A;  1TTN A;  2CHZ A;  2XK5 B;  3K9O B;  3NS8 A;  3OAW A;  3KH0 A;  3IFW B;  1EF1 A;  4GDL A;  4B9K A;  2NPT B;  4CYE A;  2G4D B;  3LDZ E;  2V4L A;  1EUV B;  2WDT B;  2WYQ A;  4II3 B;  4X57 B;  5CHF A;  3VTW A;  1TGZ B;  1UZX B;  3A9J B;  2HJ8 A;  1V86 A;  2KDI A;  2JXX A;  4MM3 A;  2GBJ A;  3DQV A;  4W9D A;  4XC2 A;  3A4S C;  3ML8 A;  2BYV E;  3QX1 A;  4I6L B;  1GC7 A;  3VAW A;  5AZF A;  1V80 A;  4E71 A;  1M94 A;  2BPS A;  2FID A;  2KQ7 A;  2DZI A;  2OOB B;  3H9D A;  3OJ3 A;  3PZD A;  4JL9 A;  4ZRK A;  2BYE A;  2KFJ A;  2KLG A;  4AOF A;  1ZGU B;  2C9W B;  2K39 A;  2O6V D;  1I42 A;  4E3C A;  1YD8 U;  2KDB A;  2KJR A;  1WX9 A;  1WIA A;  4KDI C;  3A4R A;  3QC8 B;  1LM8 B;  4A3P A;  3ZNG C;  3PS6 A;  1Y8R C;  2MCN B;  2R2O A;  4IG7 B;  1J0G A;  2A5U A;  2DYO A;  3X0W A;  3W1Y A;  1UEL A;  3PT2 B;  2KX3 A;  5J17 A;  3CSF A;  4AP4 C;  2IZV B;  2KKC A;  3TIX A;  1GG3 A;  4IM2 A;  1NI2 A;  3ML9 A;  3VHT C;  2HE7 A;  3CMM B;  5JZE B;  2R2Q A;  3VUX A;  3EFU A;  2FCQ A;  4KSK C;  1WZ0 A;  3VDZ A;  2NBU A;  2KJH B;  2NVU I;  2IO3 B;  3T9L A;  3IBE A;  5LXH A;  2CHX A;  2GOW A;  2KMA A;  3U30 A;  5D6J B;  1RLF A;  4KV2 A;  4DK5 A;  3OLM D;  4FA6 A;  2XK5 A;  1E7V A;  3WA0 A;  3GOE A;  4MEL A;  4CO7 A;  5HKH A;  1UBQ A;  3A9K A;  2CS4 A;  3QJZ A;  5AEK B;  2ZZP B;  2FUH B;  3GZN I;  4MSM B;  1VCB A;  1WGR A;  1SGH A;  5TR5 A;  4B95 A;  3TMP B;  1R4N I;  5D7G A;  2J0K A;  4P7I A;  2KJ6 A;  3SU8 X;  1WM2 A;  1WJ6 A;  3NHE B;  5D2M B;  1WI0 A;  3KUZ A;  2L05 A;  4BOS C;  2FAZ A;  2VRR B;  5IAA C;  3N30 A;  2LGY A;  4ASW C;  4BKT A;  5CHW A;  2IY0 B;  4HK2 A;  2LGD A;  2LUE A;  1E7U A;  2K25 A;  3A9J A;  3C0R B;  4BKS A;  3WAL A;  1XQQ A;  2GBK A;  3M95 A;  3RZF A;  2KZR A;  4IW0 A;  5FR6 A;  2N7E A;  2KDE B;  1JRU A;  2FNJ B;  3DVG Y;  3ENE A;  3L54 A;  4W9I A;  2AL6 A;  2DHZ A;  3A1Q B;  2ASQ A;  4HCP B;  2KWV B;  2DEN B;  4IM3 A;  3VFK A;  2XBB C;  4EZJ A;  3CST A;  4GB9 A;  3HK0 A;  2WWZ A;  1WR6 E;  2L76 A;  3ZDM C;  1KM7 A;  1WJ4 A;  3JVZ X;  2M17 A;  3MJW A;  4K81 A;  4NY0 A;  3QWZ B;  2LZ6 A;  2AYO B;  3RD2 A;  3MTN B;  2MWS B;  3PTF C;  4W9F A;  1P0R A;  3KUC B;  4K7W A;  4FJY A;  2KMC A;  4K7S A;  4WWP A;  3RCZ A;  1ZW7 A;  4M0W B;  1Q1O A;  2BWF A;  3JSV A;  2JT4 B;  1RRB A;  4XX5 A;  2MSE D;  2NBW B;  2CKH B;  3TL5 A;  4DXA B;  4MJS A;  2C7H A;  3B08 A;  3M62 B;  2K6D B;  3UIP B;  3B1L X;  3QA8 A;  2EKE C;  3SHQ A;  3PRZ A;  2KTR A;  1UD7 A;  4LCD E;  1WJU A;  4WJN A;  2Z0D B;  2I1J A;  4KZC A;  3V61 A;  5CX3 A;  4ANW A;  1WMH B;  3ZDT A;  4II2 B;  4F8C B;  3B0A A;  5IA7 A;  2NBV B;  1MG8 A;  3VVW B;  2KFK A;  2UYZ B;  3DCG A;  3WAP A;  1PQS A;  3EHV A;  4LJP B;  4MDK E;  3DOW A;  2JPH A;  4JIO U;  1S3S G;  3DVG X;  4TQ0 A;  2PE6 B;  1VD2 A;  1P3Q U;  3UF8 A;  3H7P A;  3IG3 A;  3Q3F A;  3BY4 B;  4KIK A;  2KTF A;  1AAR A;  1WY8 A;  2N4F A;  4W9C A;  3DBL I;  4IWO A;  2LVP A;  3L08 A;  3V62 A;  3AI5 A;  2Z0E B;  3N3K B;  3L10 B;  3UIO B;  4EZK A;  2D10 A;  2DZM A;  1WXM A;  4HPM B;  3A9K B;  1OEY J;  2AEH A;  2C60 A;  2LD9 A;  4EZL A;  2KN5 A;  2QHO A;  4URK A;  2JRI B;  2ZNV B;  5EDS A;  2D2Q A;  4GN1 A;  4KIK B;  4F7Z A;  2O2V B;  1V9J A;  3L13 A;  2KQS A;  2MLB A;  4HJK A;  4A20 A;  2LAS A;  1UH6 A;  4FAD A;  3JYU A;  3QAR A;  3ZUN A;  4CHK A;  3A1Q A;  2GBR A;  2AWT A;  4FJZ A;  4GGQ A;  4ANV A;  4FN2 A;  2B3A A;  2KWU B;  2N1W A;  3PRP B;  3PRM B;  2PJH A;  2LWP A;  4N9F 4;  4GSW A;  4AUQ C;  1U4A A;  1WGD A;  1WXA A;  3HIZ A;  3M3J A;  3PSE B;  1V5T A;  4HWI B;  3DBS A;  1XD3 B;  3P2B A;  3ZKJ C;  4IUM B;  5LLI A;  2UWQ A;  2NPT A;  4XZ4 A;  4BKS D;  5G2N A;  3IVF A;  1WGH A;  1GJZ A;  4MGK E;  2NS5 A;  3RYT A;  1E8X A;  4DBG A;  2L3Z A;  3VUY A;  3PLU A;  4FHK A;  3Q3J A;  4TQ1 A;  3VH3 B;  3DDC B;  2ZPN A;  1WE7 A;  2IO1 B;  2JVC A;  1WFY A;  2MBO A;  5E6N A;  4ANU A;  2KXJ A;  2KD0 A;  4MEM A;  2Z59 B;  4KSL C;  3V60 A;  2D11 A;  5KHQ A;  1WH3 A;  1WF9 A;  2ZJD A;  3V6E B;  1YQB A;  1WM3 A;  3VH4 B;  4BBN F;  5JHA A;  4EOY A;  4EUT A;  3RT3 B;  1C3T A;  2C7M B;  2NR2 A;  4W9E A;  2RSU A;  2JUO A;  4IC7 B;  4MGZ E;  1IPG A;  2JZZ A;  4DHZ B;  2MP2 A;  1P98 A;  2L0F A;  1LQB A;  4EEW A;  2CHW A;  5L83 A;  4FJV B;  4BVU C;  1V81 A;  3AXC A;  1E8W A;  2I1K A;  4NJ6 A;  4BOZ B;  2ZPY A;  4LJO B;  1WR1 A;  3ZO5 B;  4AJY B;  4HLE A;  3PVL A;  4GIV A;  3ALB A;  1TBE A;  3AU4 A;  3LJ3 A;  4OVV A;  2ZEQ A;  2M4N A;  3ZNH B;  4MSQ B;  4TUU A;  4ICU A;  4WJO A;  2BYF A;  1Q5W B;  2A4Z A;  1X1M A;  4LDT D;  1V2Y A;  3ZLZ A;  3ZW3 A;  3KYC D;  4W9J A;  2L00 B;  5KHO A;  4EKU A;  1HE8 A;  1Q0W B;  3ECI A;  5CHV C;  4EFO A;  2PE9 A;  3H7S A;  3QAQ A;  5D94 A;  1Z5S B;  3RUI B;  1IP9 A;  2FCM A;  4TV3 A;  2JZ3 B;  4M8M A;  3A33 B;  2JY6 A;  2MBQ A;  2MQJ A;  4J6I A;  2CR5 A;  2KVR A;  3TCA A;  1OEY A;  2DYB A;  2LXC A;  5LXI B;  4NPN A;  3ZRC A;  2NCN A;  1YJ1 A;  5C1Z A;  2MP2 B;  2O6V B;  2IO0 B;  4I6N B;  1RFA A;  4G3X B;  2LJ5 A;  4DWF A;  4FLH A;  5E6O A;  1V49 A;  2DYM A;  2PPH A;  1OTR B;  4KDL B;  4KVG B;  4W9K A;  4IWP A;  4ZRJ A;  2RPQ A;  2MA9 B;  2W9N A;  4LDT B;  1E8Z A;  2KC2 A;  3WAN A;  2MBH A;  4MH0 E;  2DAF A;  4RM8 A;  2YLM A;  2C7N B;  2MBE A;  3KUD B;  2DX5 B;  4MJS B;  2JRH A;  3D32 A;  3HM3 A;  2BKR B;  1E8Y A;  1WMH A;  1XT9 B;  3APD A;  3ZTD A;  1UGM A;  3DPD A;  3RZW C;  3VQI A;  1YX5 B;  2G4S A;  3M63 B;  4IWQ A;  4NNJ B;  1WX8 A;  2LGX A;  4BBN C;  2N1V A;  3AUL A;  2IY1 B;  1T0Y A;  2KOX A;  4GOC A;  5JHB A;  2MBB B;  4GU2 A;  2BKF A;  4WQO B;  4WWN A;  4HDQ A;  2CU1 A;  1ISN A;  2N9E B;  2LRW A;  1V5O A;  4HCN B;  2LVO A;  4IM0 A;  4WJQ A;  4DHZ E;  4DDI D;  2ZVO A;  1D3Z A;  4FHJ A;  1L2N A;  1SIF A;  4MGY E;  4RM9 A;  4FBJ B;  1UBI A;  3SDL C;  1CMX B;  3WAO A;  4PYU A;  2LI5 A;  4WAA A;  2KC1 A;  4NJ7 A;  3L16 A;  3R3M A;  3U7D A;  1WXV A;  1YIW A;  4K7U A;  1KOT A;  3UGB B;  4ICV A;  2REX A;  4PS3 A;  4GXB A;  1I35 A;  3H1U A;  3VTU A;  3OJ4 B;  3W1S C;  1V6E A;  2V3S A;  4GDL B;  2OJR A;  4HXD A;  3TJP A;  5CTR C;  1WGG A;  3K9P B;  3PGE A;  4ZDV A;  2WX1 A;  1F9J A;  1R4M I;  2KK8 A;  3HHM A;  4A3O A;  3R66 C;  4AJW A;  2KX0 A;  4ANX A;  5G55 A;  2K8C A;  4W9L A;  2KTR B;  5DPT A;  2L0T A;  5DCN A;  1EO6 A;  4HVB A;  5BO4 B;  3ZRF A;  5DPW A;  1WGY A;  5E6P A;  2J0M A;  2J7Q B;  2KDF B;  2KO3 A;  4WWO A;  2ZCB A;  1J19 A;  4W9G A;  4BKG A;  1EF5 A;  4W9H A;  1LFD A;  1YX6 B;  2K8H A;  2FCN A;  1H4R A;  1OQY A;  1WJN A;  3DVN V;  1WZ3 A;  4I6P A;  3PHW B;  1L7Y A;  3TBL D;  2EMS A;  1P1A A;  4G50 A;  1NDD A;  1GNU A;  2BGF A;  3KYD D;  2KFK B;  4B6W A;  1GC6 A;  2MX2 A;  1ZKH A;  2N9P C;  2YVC A;  3L17 A;  4NAW A;  4YL8 A;  3ZVV A;  3EEC A;  2D07 B;  2LVQ A;  4GDK B;  4PS8 A;  3DBR I;  1H8C A;  1E5W A;  2N9X A;  3R7R A;  4RMA A;  2EMT A;  1A5R A;  4JLC A;  1G6J A;  5JH5 C;  3ZIM A;  4NAW B;  2V1Y A;  1C1Y B;  2G45 B;  2HTH A;  2KHW B;  1RAX A;  3VUW A;  2BWE S;  3UIN B;  4DHJ B;  1OGW A;  1NBF C;  1WYW B;  2WX0 A;  5GMV A;  1S1Q B;  3JSV B;  3RUL A;  1P9D U;  2KLC A;  3PV1 A;  4HPL B;  5C23 A;  1BT0 A;  2MW5 A;  2GBN A;  3JW0 X;  3KVF B;  2ZVN A;  3NZU A;  3L0W B;  1WE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...