2JRHA

Solution sturcture of human mekk3 pb1 domain cis isomer
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
QSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into the Binding Properties of MEKK3 PB1 to MEK5 PB1 from Its Solution Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase kinase kinase 3
total genus 12
structure length 93
sequence length 93
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2jrhA00
2NPTB 4HCNB 4W9KA 4BKSA 1IYFA 4ZRKA 5AZGA 3A1QA 1G6JA 2JY6A 1GNUA 1L7YA 3N3KB 2KJRA 3RYTA 2DYBA 2IO1B 2DHZA 3PVLA 4X57B 3VTWA 4CYEA 4NJ7A 2KDFB 2J7QB 1FXTB 1YIWA 2C7HA 2KX3A 5CHVC 3V61A 4MSMB 2IO0B 2KZRA 4NAWB 3PRPB 4JGHB 3SHQA 3NZUA 2ZVNA 4M8NA 5G2NA 5CTRC 2CU1A 2ZCBA 4LJPB 3ZUNA 2L76A 2FCSA 1T0YA 4I6PA 4TUUA 3PSEB 3W1YA 2KFKA 4LDTD 1QZEA 2YVCA 4ANUA 4DXAB 4E74A 5DPWA 4W9LA 4BKSD 4FADA 3RCZA 2NS5A 4AOFA 1K8RB 2KJHB 4HPLB 1E7UA 2MWSB 5LXHA 4W9IA 2JUOA 1OEYA 2MP2A 1WX9A 4EFOA 4EOYA 3DDCB 1TZ1A 2R2QA 1UH6A 2K25A 2LASA 1WZ0A 3HIZA 3NOBA 2IBIB 2PPHA 1WXSA 1TTNA 2N7DA 2NBUA 4URKA 2PE9A 3QQ8B 3N30A 3TBLD 2LGYA 2BKRB 3WA0A 3M63B 4KIKA 4NY0A 3QX1A 2JF5A 3DCGA 3GOEA 2CHXA 3X23A 4NJ6A 5CHWA 3HHMA 4XC2A 5AEKB 2D10A 3PS6A 4XZ4A 2KFJA 5D2MB 4ANWA 2N9XA 3VTVA 3QARA 3PLVA 2KC1A 2KVRA 3AULA 4ZRIA 4FHKA 1KM7A 4FLHA 1TBEA 2LXCA 4WAAA 3NZSA 1MG8A 4W9DA 4DHJD 1D3ZA 3ENEA 4FA6A 5DCNA 3QAQA 3KW5B 2UWQA 4EZKA 1WE6A 2G4DB 3ML8A 2ZNVC 2WWZA 2KX0A 3PGEA 3W1SA 1UBQA 3A9JB 3BY4B 1UELA 2FCMA 1P1AA 2OJRA 1SIFA 2D2QA 4DHZB 5E6OA 2NR2A 2NBWB 4E3CA 1LM8B 3PLUA 2BWES 1V9JA 2K6QA 2ZPNA 4HJKA 4HK2A 1ZKHA 1ZW7A 4EUTA 2LRWA 2DENB 2N1VA 3UGBB 1XQQA 3ZTDA 2KWCA 5IA7A 2BKFA 3LJ3A 3Q3JA 1WXAA 3PV1A 2RPQA 5C1ZA 4IM2A 2JWZA 2W9NA 2LVOA 3APDA 3S2AA 1P98A 1L2NA 2RD0A 3UF8A 5CX3A 4FULA 4AJWA 3ZO5B 3A9KA 3WAMA 3SD5A 3D32A 3JW0X 2K39A 2A5UA 3H1UA 3H7SA 5L95C 1E8XA 5TR5A 2K8HA 3B08A 3QWZB 4NPNA 3DBSA 3QC8B 2ZEQA 1WIAA 3UQBA 3L10B 2ZZPB 4MGIE 3UIPB 4I6LB 2KTRA 1J0GA 2IZVB 2GBNA 2KO3A 2XK5B 4KVGB 2JVCA 3U8ZA 4GDLB 2LJ5A 3RULA 2O2VB 1WR1A 3I3TB 2KQ7A 2AYOB 3KUCB 4ZRJA 3R3MA 2KD0A 1WGHA 2WYQA 4TQ1A 3NS8A 1AARA 4JL9A 4HDQA 4G50A 2M0XA 3APCA 4TKNA 1E8ZA 3MJWA 3ALBA 3BINA 3PREA 3KVFB 3UQAA 3AU4A 4GDLA 4MEMA 3ZTCA 1U4AA 2G3QB 3VUYA 4EEWA 2MLBA 3HM6X 2L05A 2MBQA 3IBEA 4FHJA 5FR6A 4K7SA 1J19A 3TIXA 1RAXA 2QHOA 2DAJA 4HPMB 4IG7B 4MJSA 1VD2A 3H7PA 1WJ4A 3JSVA 1WH3A 4IW0A 2KLGA 3PHXB 2IY1B 3ZNHB 4MGZE 4CO7A 3VDZA 3RZFA 4TQ0A 3ZVVA 1P9DU 2XBBC 1JRUA 4PS8A 4PS3A 1P3QU 2LUEA 3RZWC 2IYDB 3AU5A 2GBRA 2JZ3B 4A3PA 2KMCA 4BFRA 3VUWA 4GIVA 3ONSA 3OAWA 1NDDA 1V86A 2KDEB 3V6EB 2DAFA 3ZNZB 2WDTB 3H9DA 2FUHB 2ZJDA 5AZFA 3EC8A 3QK0A 4ZYNA 3LDZE 1V6EA 1WGDA 3ZLZA 2J0MA 2Z59B 3NHEB 2EMSA 4WJNA 2N4FA 4WWNA 2KNBA 1Q1OA 2WX0A 1WE7A 3NY5A 2L00B 5BO4B 3QJZA 3L08A 1S3SG 2N9PC 1SGHA 2B3AA 2BYFA 2PEAA 4GDKB 2KQSA 2UYZB 1J8CA 1YD8U 4ANXA 2ZPYA 2HJ8A 2ZNVB 2IO3B 2OOBB 3ECIA 4I6NB 3A33B 4WQOB 3ZRCA 3VH4B 3WALA 2MBBB 4KDIC 5DPRA 1WGYA 3V6CB 3QHTA 4BVUC 3ZDTA 1V81A 1V5TA 5HKHA 1PQSA 2YLMA 2KLCA 1E90A 3T9LA 3WAPA 3X0WA 3ZDMC 3GZNI 2NCNA 2PJHA 3TCAA 4P7IA 2KDIA 2KWUB 3DVGY 2CHZA 4GXBA 1Q5WB 5KHOA 1WYWB 2BGFA 2PE6B 2KKCA 2D3GA 1E8YA 2KOXA 4FJZA 2KTRB 2DX5B 4JQWC 1XT9B 2BF8B 3PHWB 4BBNC 4IM0A 1GJZA 2CR5A 2LGXA 2M8SA 4MM3A 2K8BA 1WGGA 2RGFA 2GBJA 1UZXB 3H7PB 3JSVB 1S1QB 1WM3A 3QIJA 4FJVB 4IWOA 2J0JA 2FNJB 3DBHI 2ASQA 3DVGX 4KSKC 3DBLI 3ZKJC 2AL3A 2O6VB 4DHZE 1NI2A 1X1MA 1GC7A 1V5OA 3HM3A 3UINB 1ISNA 4KSLC 1KJTA 2HE7A 4KV2A 4KDLB 2BPSA 4E71A 4HVBA 2EMTA 2A4ZA 2N7EA 2BYEA 2K8CA 4WJPA 1WJUA 3W1SC 2RSUA 2I1KA 4K81A 2KHWB 1WGRA 1WZ3A 3P2BA 2MBHA 4ANVA 2O2VA 2GMIC 3QCAA 2N9EB 3JYUA 3M62B 1IP9A 1E5WA 4B6WA 2AEHA 2JXXA 3ML9A 3PRMB 3ZRFA 2KN5A 4DBGA 4J6IA 1R4NI 5LXIB 5KHQA 1Z5SB 4ASWC 1LQBA 3APFA 3IVFA 4K7UA 1TGZB 2L0TA 3TJPA 2NPTA 1EF5A 4ZDVA 2KC2A 3MTNB 3A4SC 4GN1A 4ICUA 5D6JB 2DZKA 4DDID 4HXDA 3B0AA 3H6NA 3L16A 3VFKA 4B9KA 3RD2A 2K1FA 4M8MA 2C7MB 2L8JA 2KJ6A 2XK5A 4PYZA 4GB9A 4OVUA 3ZW3A 4DWFA 2KXJA 3PRZA 3KUZA 3L54A 1WMHA 2XEWA 4W9EA 1YJ1A 1LXDA 3L13A 4AP4C 2FIFA 5D7GA 4EKUA 1H4RA 1V49A 2LI5A 1SE9A 4G11A 3OJ4B 4WWPA 2KDBA 4W9HA 3K9PB 5E6PA 2MCNB 4DDGD 4F8CB 2ZCCA 1CMXB 4F1SA 3L0WB 4K1RB 4LDTB 2M1MA 3TMPB 4RM9A 3PZDA 2L0FA 1WMHB 4PS7A 3B1LX 2C5LC 3MHSD 1UGMA 2N1WA 3O65B 3OJ3A 4NNJB 3VUXA 4GMVA 5DPTA 2I1JA 3UIOB 4LCDE 3DVNV 2BWFA 2JRHA 2LZ6A 4IUMB 4YL8A 5E6NA 5L83A 3VXWA 1RRBA 1C3TA 3IHPC 4IWPA 5CHFA 1Q0WB 1KLVA 2MBEA 2L3ZA 1LFDA 3Q3FA 5DPSA 4IC7B 4FN2A 2AWTA 5LLIA 1WJNA 1GUAB 3AI5A 2NVUI 1GG3A 2V3SA 5AZHA 1I42A 5J2RA 3SDLC 1V80A 1M94A 1WF9A 1Z2MA 3DPDA 4KIKB 4MJSB 3EECA 1I35A 1WXVA 1C1YB 2CHWA 4M0WB 2O6VD 2LD9A 3ZIMA 2JPHA 2G45B 3DBRI 1UD7A 3A1QB 4TV3A 3L17A 3V62A 2FCNA 5D94A 4FBJB 2M4NA 3M95A 2DYMA 3A9KB 4II3B 2GOWA 3VTUA 4MDKE 3VAWA 1YX5B 3KYDD 2HTHA 1GC6A 1ZGUB 2KK8A 4BOZB 3JVZX 1H8CA 1EF1A 2LVQA 3C0RB 3SU8X 3KH0A 4RMAA 2BYVE 2LGDA 4MGKE 3QA8A 5G55A 2MQJA 1OQYA 2VRRB 4WJOA 3RT3B 4DHJB 2LWPA 1RFAA 2KANA 4A3OA 2IY0B 1HE8A 1EUVB 3HK0A 3OLMD 2FCQA 2V1YA 4NQKE 4W9FA 1RLFA 4EZLA 4JIOU 1YX6B 2GBKA 2G4SA 3ZNID 4GGQA 4G0NB 2M17A 3DQVA 3ZNGC 2ZVOA 1WRDB 1WI0A 2NBVB 1OEYJ 1WM2A 4IWQA 4NAWA 1WXMA 4IM3A 4JLCA 1WY8A 3EFUA 5JZEB 2K6DB 2Y5BB 3KUDB 3PT2B 4WWOA 3U30A 3WANA 3CMMB 1WJ6A 2KFKB 2L7RA 3R7QA 2DZJA 4K7WA 1XD3B 2IO2B 4GU2A 1YQBA 3VQIA 1E7VA 4BKGA 5GMVA 3DVNU 1IPGA 2D11A 1EO6A 3KYCD 4LJOB 1WR6E 2REXA 2J0KA 2LRUA 4DK5A 3AXCA 2GBMA 3EHVA 4GDKA 2MA9B 4WJQA 2DZMA 4EZJA 5J17A 5J18A 2O6VA 3DOWA 3R7RA 4BBNF 4MSQB 3V60A 1WFYA 4KZCA 1Y8RC 4A20A 1R4MI 2AL6A 3VHTC 2CKHB 2FAZA 4HCPB 4HLEA 2MX2A 3U7DA 2CS4A 2C7NB 1E8WA 2RR9A 3K9OB 4MGYE 2MRPA 5JH5C 2LXAA 4RM8A 3N32A 4W9GA 4HDOA 4NQLB 3CSTA 2KMAA 2HD5B 4HWIB 2JZZA 1P0RA 2DYOA 4AUQC 2C9WB 4MELA 1OTRB 4FJYA 3IFWB 4BOSC 4GSWA 2Z0EB 3PPAA 4GOCA 1NBFC 2MP2B 4II2B 4KZ0A 4MH0E 3M3JA 2MSED 4PYUA 1KOTA 2MW5A 4AJYB 2D07B 2MBOA 3TL5A 4AWJA 2V4LA 2C60A 1BT0A 2LVPA 4BKTA 2R2OA 3IG3A 3T8MA 2FIDA 3A9JA 2WX1A 1OGWA 5EDSA 2KTFA 4XX5A 3A4RA 4OVVA 1V2YA 3WIMA 3CF6E 5JHBA 2KWVB 5JHAA 3WAOA 4CHKA 2JRIB 1A5RA 2JT4B 2Z0DB 5C23A 4B95A 1WX8A 1F9JA 3CSFA 1WX7A 3R66C 3VH3B 1UBIA 3RUIB 2DZIA 4N9F4 4W9JA 4ICVA 3VVWB 1VCBA 4W9CA 5IAAC 4F7ZA 2EKEC 3PTFC 4G3XB
chains in the Genus database with same CATH superfamily
2NPTB 1JQ4A 4W9KA 4ZRKA 3N3KB 2FBWB 4NZLB 3RYTA 3PVLA 1N60A 1YIWA 1FCLA 5I4DA 4HPPA 3SHQA 3PZ7A 1E0ZA 2WHIA 4LJPB 1DGJA 4I6PA 4TUUA 1WXQA 2WXOA 4DXGA 5DPWA 5H8YE 2LEKA 3RCZA 1V1PB 4J3OD 4HPLB 3U7ZA 2MWSB 4KGSA 1OEYA 5IOIA 3TSSA 4EFOA 1MHHE 3GB1A 2LASA 3NOBA 4URKA 1QOAA 1TS4A 5CHWA 1E10A 2WXIA 2D10A 4XZ4A 4YSYB 1TS2A 1STEA 3HRDD 3QARA 3PLVA 2KC1A 1KM7A 2JSVX 1D3ZA 4FA6A 5DCNA 1C9FA 4EZKA 1IUEA 2WWZA 4JWUC 3A9JB 3AH7A 3BY4B 4DQOC 2FCMA 2OJRA 1C4AA 2KVZA 2K6QA 4HK2A 1ZW7A 3ZTDA 2BKFA 3LJ3A 2RPQA 3RPFC 3DHHC 4IM2A 3R2IA 1P98A 4FULA 1GPXA 3JW0X 5L95C 1MJDA 5TR5A 3QWZB 3FILA 2GB1A 3DBSA 2ZEQA 1WIAA 5T8IA 1N63A 3L10B 1BUIC 2ZZPB 3UIPB 4I6LB 2RPVA 3DBRB 2IZVB 1J0GA 2KO3A 2XK5B 4KVGB 4USAA 3U8ZA 2LJ5A 2O2VB 3KUCB 2KD0A 1WGHA 4TQ1A 1ZDVA 4HDQA 4G50A 3APCA 2DWQA 2VH2A 4TKNA 2R61A 3BINA 3PREA 3KVFB 2RMMA 2L05A 5HG2A 1J19A 2QCZA 3TIXA 3E9SA 3Q8AA 3JSVA 4M00A 1WH3A 4IW0A 1JALA 3PHXB 3N1XC 2UU7A 3SFDB 3ZVVA 4PS3A 4PS8A 4C00A 3AU5A 2GBRA 5BYRA 1XEEA 3VUWA 1MVKA 1I4PA 2LMCA 1XXGA 3ZNZB 2WDTB 4XYCA 1SXTA 1SF0A 5AZFA 3QK0A 4MT5A 2L32A 4H2AA 2KNBA 1Q1OA 4AS1A 1C78A 3Q8EA 1V1OA 2N9PC 2BYFA 3C8YA 1J8CA 1YD8U 1IBXB 1B1ZA 2ZNVB 2OOBB 3VH4B 1Y56A 3WALA 3V6CB 3NVWA 1F0ZA 1PQSA 2KLCA 3GZNI 2PJHA 3TCAA 1OQQA 1R4MB 2IGGA 1Q5WB 5KHOA 2KTRB 4JQWC 2WDVB 4IM0A 3R2TA 2CR5A 1ZOYB 1VZ8A 3FKYA 3H7PB 2M8SA 5D7GA 1TY2A 5HHDG 1WM3A 2FNJB 2ASQA 4DHZE 1UWXA 1ZUD2 3EA6A 1V5OA 1FIQA 1KJTA 4KV2A 2BPSA 4E71A 4HVBA 2N7EA 4WJPA 4KX6B 3W1SC 4JX1C 2RSUA 2AX5A 4K81A 4YT0B 3B2FA 3P2BA 2N9EB 3W5UB 3JYUA 3M62B 1IP9A 2JXXA 1R4NI 1YN5A 1Z5SB 3APFA 3Q8FA 4N58A 1EF5A 3A4SC 2DZKA 4M8MA 2KJ6A 4PYZA 3PRZA 3Q3OC 1WMHA 1TKYA 2MH7A 1YJ1A 3L13A 2FIFA 2JX5A 2WDQB 1H4RA 2N9KA 4G11A 2EKIA 2KDBA 5E6PA 4DDGD 4F1SA 1CMXB 2M1MA 3TMPB 4RM9A 2I1JA 2OHFA 1V97A 2JRHA 2OEDA 1RRBA 3N1ZC 5CHFA 3Q3FA 5DPSA 5LLIA 3MHZA 3AI5A 2NVUI 1HXYD 4LK0M 5AUKA 4KIKB 3EECA 4A90A 1F52A 1UD7A 3A1QB 3L17A 2FCNA 2M4NA 2GOWA 1GC6A 1HQRD 1N5XA 3JVZX 1HZ5A 3SU8X 2BYVE 4MGKE 3AE4B 2VRRB 4HKQA 1B9RA 4REZA 1RFAA 2KANA 1KRHA 4NQKE 4W9FA 2FCQA 2V1YA 2QMTA 1RLFA 4ZHOA 2G4SA 3VR8B 1UF0A 1JMLA 2PTLA 3ZJUA 1WI0A 2NBVB 3BK1A 4NAWA 1WXMA 4IM3A 4L1BA 2K6DB 2Y5BB 4ITKA 2BB5A 3AE8B 3CMMB 3VQIA 1E7VA 1T3QA 1PGAA 4DK5A 3AXCA 2GBMA 2MA9B 1JWBD 3SR6A 4WJQA 3MP9A 3E56A 1NVID 1R4MI 3H8HA 1YN4A 4HCPB 2K0PA 2MX2A 1QQRA 1ZXHA 2C7NB 3MJ5A 4EE2A 1LGRA 2LXAA 3CSTA 4HWIB 1F2RI 1DYQA 4MELA 1OTRB 2INDC 4FJYA 3IFWB 3PPAA 4GOCA 2JWUA 5GXGB 3A9JA 3Q14C 2KTFA 4XX5A 3A4RA 1MG4A 2IGDA 3NJTA 1EWYC 1IGDA 3CF6E 1N6ZA 2LFIA 5JHBA 1WWTA 5HI1A 3BVMA 1A5RA 2Z0DB 4XE0A 1WX8A 1F9JA 2LGSA 3ZYYX 4A6QA 2DZIA 1VDVA 3VVWB 5G5GA 4BKSA 1IYFA 1ET6A 3RFZB 1JWUD 2JY6A 1L7YA 1ZPSA 2DYBA 2IO1B 2DHZA 4NAMA 4YTNB 4NJ7A 1VRAB 2KX3A 3DHIC 5IN7A 1AN8A 3KWVA 1UUPA 2ZVNA 5CTRC 3W2DA 3PSEB 3AE1B 4ANUA 1QZEA 4DXAB 4W9LA 4FADA 5LNK1 2KJHB 1E7UA 3RNFC 2MP2A 2BS4B 3DDCB 1UH6A 3LYYA 1L4DB 1DOIA 4RGTA 2K25A 1IBXA 1WZ0A 3HIZA 2IBIB 2VH1A 1TTNA 2NBUA 2MHJA 2PE9A 3QQ8B 1MPEA 3AM9A 3WA0A 2CHXA 3P42A 3X23A 3P1MA 2HJ1A 1PGXA 5AEKB 2JYEA 2KFJA 4ANWA 2KACA 3I57A 1PUTA 2KVRA 3AULA 4FLHA 2LXCA 4DHJD 4W9DA 1FRRA 2LUMA 3NS1A 3AECB 2D3BA 3ML8A 3PGEA 1UBQA 2WLBA 1P1AA 2N7JA 2D2QA 4DHZB 2NR2A 3PLUA 4HJKA 1V9JA 2LRWA 2DENB 3UGBB 1YMHE 2G1EA 5IA7A 4OZBA 2G9HD 3KQ4A 3Q3JA 3KLSX 2WU5B 3W9CB 4LNKA 2RDGA 1F2RC 3WAMA 3SD5A 4IOIE 1PFDA 4LNIA 4LNNA 2V4IB 2K8HA 1ZE3D 4M01A 3RN9C 1J7AA 2MJDA 4JE3B 4KKIA 2KTRA 2NTSA 2GBNA 1KLUD 1SJHD 1P7EA 2JVCA 1T0RC 5HFYA 2QIEB 5IKCM 3RULA 1N61A 1WR1A 2KQ7A 2AYOB 3PO0A 2WYQA 5FK9C 1AARA 4JL9A 2M0XA 1TKEA 3CIRB 1D6EC 1TY0A 4MEMA 3ZTCA 2G3QB 3VUYA 2MLBA 3HM6X 2E6XA 4K7SA 1RAXA 4BZAA 5EE3A 1TJEA 4MJSA 3H7PA 1L0YB 1VR9A 2KLGA 3IT6B 3ZNHB 4MGZE 4R3DA 4CO7A 5E6JA 1BXTA 2INPE 4RNAA 2LUEA 2V9HA 2INCC 1WSPA 4KGTA 1NDDA 1V86A 2WXRA 4XDCA 5BYSA 3ZGZA 4ZYNA 1V6EA 1WGDA 3ZLZA 2EMSA 4WJNA 2N4FA 2WQYB 3NY5A 4RFBA 2QDFA 1SGHA 2PEAA 1QKZA 4ANXA 1SBBB 2HJ8A 4ZYSA 4I6NB 2MBBB 2QJLA 4BVUC 1ET9A 3ZDTA 5HKHA 1UGJA 3WAPA 1E90A 3X0WA 2ONQA 2NCNA 3ABVB 2KWUB 1ENFA 2D3GA 4FJZA 1XT9B 2BF8B 4BBNC 1GJZA 4IKGA 2K8BA 2GBJA 4HEA1 2K3UA 4IWOA 2J0JA 4RGMA 3DVGX 3ZKJC 1GC7A 2J52A 3UINB 3VRAB 4KDLB 2EMTA 2K8CA 2HDEA 1WJUA 1JROA 2WXNA 2X8XX 1WGRA 4AQ7A 4N59A 5JXVA 2MBHA 3EFCA 1E5WA 3PRMB 2KYWA 2RDBC 1SE4A 1YJIA 3TJPA 2LHEA 3NVVA 4B0MA 2KC2A 4LNOA 4WAFA 4DDID 3B0AA 3H6NA 1FPYA 2K1FA 1FCCC 4P1CC 4OVUA 4W9EA 2XEWA 5IP4D 3FILB 1SE9A 4F8CB 2QSDA 3DBHB 4K1RB 3Q6BA 1ESFA 1WMHB 4WWMA 1UGMA 4C4VB 4NNJB 1E7PB 1RM6C 4YL8A 3VXWA 3AN1A 2L3ZA 1TYGB 2KN4A 4WIPA 1GG3A 2H88B 1I42A 3FAHA 1M94A 1Z2MA 1FMAD 1VJKA 1JWMD 1YN3A 2JPHA 3DBRI 4FBJB 2BS2B 1WGKA 3M95A 2DYMA 2WNMA 3N1YC 4HJGE 2WXLA 3KYDD 2MEKA 1EF1A 2Y3AA 2LJIA 4YSZB 2LGDA 5TSSA 3QA8A 4XWTA 1OQYA 3RT3B 3L4PA 4ZRQA 2WXJA 1EUVB 1YX6B 3J9CA 1QOBA 2TSSA 1BMLC 4GGQA 3ZJTA 3MC0B 3IXSA 1WY8A 1M4VA 4WWOA 3U30A 1WJ6A 3R7QA 4K7WA 1XD3B 1DOXA 3U52E 1WRIA 4OZAA 4C56C 5GMVA 3DVNU 2D11A 1EO6A 3GS2A 4LLGM 2J0KA 3EHVA 1OFFA 2DZMA 5J18A 2O6VA 2RDHA 1NENB 1VZ7A 1TS5A 1K51A 1WFYA 2V0GA 4KZCA 1L6VA 5EE0A 5BMIA 1HTQA 1TIFA 3VHTC 1QOGA 1N5WA 1FFVA 4MGYE 5JH5C 1L0XB 1GB4A 4RM8A 2HD5B 3MC9A 2Z0EB 3C19A 2MP2B 4II2B 4MH0E 1I7HA 2MSED 4PYUA 2WXHA 4AJYB 3TL5A 2AQ2B 2C60A 2Z8LA 1D5ZC 2PVOD 4US9A 4QAYA 4OVVA 1V2YA 3RNCC 1JCKB 1K50A 1PGBA 3WAOA 4CHKA 2JT4B 5C23A 4TMAB 3RUIB 4W9JA 3BK2A 4LNFA 2EKEC 3N20C 1C77A 4Q2JA 3NUHB 3A1QA 2KJRA 1FNWA 4X57B 2BYTA 4CYEA 2KDFB 2J7QB 1FXTB 2C7HA 1SE2A 3V61A 2KZRA 4IDIA 3PRPB 4JGHB 4M8NA 2CU1A 2ZCBA 1T0YA 3W1YA 4LDTD 3WCQA 4E74A 2EELA 4RF1A 1FRDA 2NS5A 1K8RB 2QC8A 5LXHA 4W9IA 2KWDA 1QILA 3DWGC 2JUOA 1WX9A 3TEZA 3N9YC 1TZ1A 2R2QA 4HROA 4YXDB 3OWEB 2BW2A 3AEAB 2PPHA 1HTOA 2WS3B 4L2YA 2N7DA 1T0QC 4ZHPA 1RFKA 3NRZA 2LGYA 3IT4B 4NY0A 4YTPB 3AMZA 3DCGA 3GOEA 1C79A 2INNE 4XC2A 3PS6A 5D2MB 3AE9B 2ON8A 2BVCA 3BVZA 4FHKA 4L23A 2IPKD 3ENEA 2WU2B 1L4ZB 2UWQA 1WE6A 2G4DB 2KX0A 5EE1A 3BIID 1UELA 1SIFA 2NBWB 1LM8B 2ZPNA 1ZKHA 4EUTA 2N1VA 3HUIA 1XQQA 2KWCA 1WXAA 3PV1A 5C1ZA 1XF5L 1JWAD 4K3BA 2B76B 1L2NA 2YEPB 1T6BX 2OJWA 3Q3NC 3BWUD 3ZO5B 3A9KA 3AEBB 1EWCA 3H1UA 2WXKA 3BZDB 1SE3A 2MJ3A 4NPNA 1T5XD 5BYQA 1YOVB 3HVDA 3UQBA 2JZPA 4MGIE 2KMMA 2X38A 1F77A 3MFGA 2BB6A 4GDLB 3I3TB 4ARIA 4ZRJA 1GOZA 4GLSC 1R7SA 1NI3A 1E8ZA 3MJWA 3P63A 3ALBA 1RYJA 4GDLA 1YQ3B 4ZOHC 1YJJA 2MBQA 3IBEA 2IDYA 2DAJA 3Q8BA 4IG7B 1A70A 1VZ6A 4KKJA 4TQ0A 1P9DU 2XBBC 1JRUA 3RZWC 1I4HA 1XLQA 2DNFA 3LXFA 2JZ3B 1FM0D 4A3PA 2JXTA 4BFRA 4GIVA 3ONSA 3OAWA 2KDEB 2DAFA 4A55A 3EC8A 2YEPF 3LDZE 4P6VF 4KGRA 2J0MA 2Z59B 3NHEB 3P4SB 1UNSA 4WWNA 1JW9D 3Q3MC 2L00B 2M0AA 1SIJA 3AE6B 1ROEA 2DLBA 4GDKB 2UYZB 2AQ3B 3IAS1 4WQOB 3ECIA 3A33B 2K22A 5DPRA 1WGYA 1SSNA 2GI9A 3QHTA 4OHJA 3O13A 1E6EB 2YLMA 4PT5A 3T9LA 1JRPA 4P7IA 2CHZA 2BGFA 3B9JA 2KKCA 2KOXA 1E8YA 3GE8C 3PHWB 2LGXA 2RGFA 3SFEB 1S1QB 4KSKC 2IJ0A 1FNUA 4ZRPA 3HM3A 1ISNA 3NG0A 1RWSA 2HE7A 4RH6A 2A4ZA 5G5HA 2M56B 1QLBB 3VR9B 1WZ3A 1XLPA 1XLNA 1KLGD 2W3RA 4B6WA 4DBGA 1GAQB 4J6IA 3AB5A 4ASWC 3IVFA 4K7UA 2QILA 2NPTA 4ZDVA 3MTNB 1CJEA 5D6JB 5BMHA 4HXDA 5C2TB 3RD2A 2C7MB 4DWFA 4GB9A 2KXJA 3L54A 4AP4C 3VRBB 4EKUA 1V49A 2J42A 4S17A 1CZPA 2LI5A 3OJ4B 4WWPA 1ACCA 2ZCCA 4XDDA 4US8A 2SAKA 2XN9C 3PZDA 2KAJA 2L0FA 1ZP0B 4PS7A 1QT9A 3TEXA 3FC4A 2C5LC 2CJNA 3MHSD 3O65B 2CU3A 3EGRA 3VUXA 4RGNA 5DPTA 1XO3A 3UIOB 4LCDE 1FO4A 3KWLA 2LZ6A 4IUMB 5L83A 2PLPA 3GZNB 4B0EA 1C3TA 4IWPA 1Q0WB 2MBEA 4FN2A 1WJNA 4ARCA 1HEZE 1V80A 4MM3B 1WF9A 2H89B 1D4BA 1I35A 1C1YB 2CHWA 3T3OA 3ZIMA 3RI7C 4TV3A 3V62A 5D94A 3A9KB 4II3B 3GP7A 3VAWA 2HTHA 4BOZB 1ZGUB 1AW7A 3C0RB 2W55A 3KH0A 4RMAA 5AUIA 1MI0A 1R4NB 1E9MA 5G55A 2JU6X 2E3TA 1ZDXA 2V3NA 2I2YA 1HE8A 3HK0A 4EZLA 4JIOU 2D3CA 3ZNID 3DQVA 2ZVOA 2JYTA 1WM2A 4IWQA 1L6UA 4JLCA 1K53A 3WANA 5MPOA 2KFKB 2BQQA 2DZJA 2XNAC 4TSSA 4RCOA 4GU2A 1I4XA 1IPGA 3KYCD 2PKOA 2DBYA 3AV8A 1JWSD 2LRUA 2BTEA 2V3PA 2L83A 5BMGA 3DOWA 3R7RA 3TUOA 2WXFA 4MSQB 1ZXIA 3ETRA 3V60A 4P1BC 4A20A 2AL6A 2CKHB 2FAZA 3U7DA 2CS4A 5H92C 4M0WA 3K9OB 5D3IB 4JWSC 2K5PA 4NQLB 1UWMA 2KMAA 2WXQA 2JZZA 2DYOA 2C9WB 4BOSC 2W82A 4GSWA 1KH0A 1NBFC 2M19A 3RNEC 3M3JA 2MW5A 4AWJA 2V4LA 1HA5A 4BKTA 3IG3A 3T8MA 1TT5B 2VZKB 1OGWA 4OVZA 4HKZE 1HZ6A 5FKAC 1PDXA 4CQNA 4B95A 1WX7A 2QEJC 3VH3B 4ICVA 5IAAC 3EUB2 4G3XB 4HCNB 2LHDA 2NTTA 4UDUC 5AZGA 1G6JA 1GNUA 3VTWA 1SB3C 3OG5A 5CHVC 1EM7A 4MSMB 2IO0B 4NAWB 3Q69A 1J7BA 3I63C 3NZUA 2PVGC 5G2NA 3CWIA 3ZUNA 1CQVA 2L76A 2FCSA 2KFKA 2YVCA 2PIAA 3AEDB 4BKSD 1L0VB 3AEEB 4AOFA 4YTMB 3ZXVA 4EOYA 3ZXRA 1NEKB 2WXPA 3NVZA 4YSXB 1WXSA 2KQ4X 3N30A 3TBLD 2BKRB 3P4RB 3RNGC 3M63B 4KIKA 3QX1A 2JF5A 4NJ6A 1AWDA 3HHMA 4XGAB 2KDMA 2N9XA 3VTVA 3Q2AC 4ZRIA 1FD6A 1CK1A 1TBEA 4WAAA 3NZSA 1MG8A 4WH4A 3QAQA 3KW5B 2ZNVC 1C4PA 1F1HA 3W1SA 5E6OA 1KTKA 4E3CA 1D5MC 2BWES 2SEBD 3UI3A 4K3CA 3W5VB 2JWZA 2W9NA 2LVOA 3APDA 3S2AA 2RD0A 3UF8A 2W54A 5CX3A 1QOFA 4AJWA 3D32A 2K39A 2A5UA 3H7SA 1E8XA 2BT6A 2HTME 3RNBC 1VLBA 1K52A 3AEFB 3B08A 3QC8B 1GB1A 3AE5B 2L1AA 1SJED 1I4GA 1FXIA 3P4QB 1Q10A 2N9LA 3AE3B 1MHXA 3R3MA 4P16A 2BBCA 3NS8A 2WXMA 3MC8A 3UQAA 1PYWD 1YQ4B 3AU4A 1U4AA 4EEWA 4FHJA 3TEYA 3R8BA 4C4VA 5FR6A 1XLOA 2CJOA 2QHOA 4HPMB 4OZCA 5C3JB 1VD2A 1WJ4A 2ZW0A 2IY1B 1TZOA 3VDZA 3RZFA 1P3QU 2IYDB 1C4CA 2KMCA 3V6EB 2VZKD 3P4PB 3H9DA 2FUHB 2ZJDA 2GRIA 1KFYB 5FR3A 2N0SB 2WX0A 1WE7A 5BO4B 3QJZA 3L08A 1S3SG 3DHGC 2B3AA 1NYQA 2AQ1B 2ICIA 3AEGB 1P7FA 2D5GA 2KQSA 3RMKC 2ZPYA 2IO3B 3IAM1 3ZRCA 1T0SC 3I5JC 4KDIC 4WQMA 4MH8A 1V81A 1V5TA 2FUG1 3ZDMC 1N62A 4A9AA 4JPSA 2KDIA 3DVGY 3B2GA 4GXBA 1WYWB 2PE6B 2DX5B 4MM3A 3JSVB 1XCQL 1WGGA 1TS3A 1UZXB 3QIJA 4FJVB 2WXGA 3DBHI 2FE8A 4MACA 3DBLI 2AL3A 2O6VB 2KT7A 1NI2A 1X1MA 4KSLC 4S0RA 2WDRB 3NVYA 2BYEA 2JQRB 1FEHA 1YNTE 2I1KA 2KHWB 4ANVA 2O2VA 2GMIC 3QCAA 2MJEA 2AEHA 3ML9A 3ZRFA 2KN5A 1OQRA 2W3SA 5LXIB 5KHQA 4BAXA 2ZW1A 1LQBA 1TGZB 2ACZB 2L0TA 4WURA 2PMVA 4GN1A 4ICUA 1D5XC 2LGIA 3RNAC 3L16A 3AE2B 3SEBA 3VFKA 4B9KA 3GE3C 2L8JA 2XK5A 3ZW3A 3KUZA 1LXDA 2I38A 4W9HA 3K9PB 1V8CA 2MCNB 5IO9A 3L0WB 4LDTB 1LO5D 2GLSA 2L52A 4XWWA 2PW9A 3B1LX 2J4XA 2N1WA 3OJ3A 4LTUA 4GMVA 2Q5WD 3DVNV 2BWFA 5E6NA 4DXFA 3IHPC 3BVGA 1KLVA 1LFDA 4IC7B 4FXCA 3LB8C 2AWTA 3V3XA 1GUAB 2V3SA 5AZHA 3URYA 5J2RA 3SDLC 2Y5PA 3BYTB 3DPDA 4MJSB 1FXAA 1WXVA 4M02A 4M0WB 2O6VD 2K9XA 2LD9A 2G45B 1MFWA 1FNVA 3VTUA 4MDKE 1YX5B 2KK8A 1H8CA 2LVQA 1TKGA 4D2KA 3Q8CA 2MQJA 4WJOA 4DHJB 2LWPA 4A3OA 1KF6B 2IY0B 4HRSA 3OLMD 1V1PA 2GBKA 4YWGG 1NYRA 3U4EG 4G0NB 2M17A 3ZNGC 1WRDB 1OEYJ 3U2SC 2IGHA 3EFUA 5JZEB 2WP9B 3KUDB 3PT2B 1SEBD 2L7RA 1DOYA 1WYGA 2IO2B 1L5PA 3DBLB 1YQBA 4BKGA 3V05A 4LJOB 1FFUA 4PK1A 1WR6E 2REXA 3AE7B 1EU4A 4GDKA 3ZQ4A 5J17A 4EZJA 1EU3A 4BBNF 1Y8RC 4NJCA 4HLEA 4RF0A 3HVZA 2J53A 1E8WA 2RR9A 2MRPA 4W9GA 3N32A 4HDOA 3TEWA 1P0RA 4AUQC 4C80A 4N6EB 1I4RA 3T3NA 5D3DA 3ZJVA 4C7ZA 2WGSA 3BYYB 1IGCA 1XCTL 4RGOS 4KZ0A 4A8XC 1AYFA 2BS3B 4C7YA 1KOTA 2D07B 3NZ3A 2MBOA 1QF6A 2LVPA 1BT0A 2D3AA 2R2OA 2FIDA 1J7CA 2WX1A 5EDSA 4ACFA 3WIMA 2KWVB 5JHAA 3PZ8A 3DWMA 3I9V1 4OW0A 5EE9A 2JRIB 3CSFA 1I4QA 3R66C 1C76A 1UBIA 4N9F4 4O1NA 2NMQA 1VCBA 4F7ZA 2Y5CA 3PTFC 4W9CA
chains in the Genus database with same CATH topology
2NPTB 4HCNB 4W9KA 4BKSA 1IYFA 4ZRKA 5AZGA 3A1QA 1G6JA 2JY6A 1GNUA 1L7YA 3N3KB 2KJRA 3RYTA 2DYBA 2IO1B 2DHZA 3PVLA 4X57B 3VTWA 4CYEA 4NJ7A 2KDFB 2J7QB 1FXTB 1YIWA 2C7HA 2KX3A 5CHVC 3V61A 4MSMB 2IO0B 2KZRA 4NAWB 3PRPB 4JGHB 3SHQA 3NZUA 2ZVNA 4M8NA 5G2NA 5CTRC 2CU1A 2ZCBA 4LJPB 3ZUNA 2L76A 2FCSA 1T0YA 4I6PA 4TUUA 3PSEB 3W1YA 2KFKA 4LDTD 1QZEA 2YVCA 4ANUA 4DXAB 4E74A 5DPWA 4W9LA 4BKSD 4FADA 3RCZA 2NS5A 4AOFA 1K8RB 2KJHB 4HPLB 1E7UA 2MWSB 5LXHA 4W9IA 2JUOA 1OEYA 2MP2A 1WX9A 4EFOA 4EOYA 3DDCB 1TZ1A 2R2QA 1UH6A 2K25A 2LASA 1WZ0A 3HIZA 3NOBA 2IBIB 2PPHA 1WXSA 1TTNA 2N7DA 2NBUA 4URKA 2PE9A 3QQ8B 3N30A 3TBLD 2LGYA 2BKRB 3WA0A 3M63B 4KIKA 4NY0A 3QX1A 2JF5A 3DCGA 3GOEA 2CHXA 3X23A 4NJ6A 5CHWA 3HHMA 4XC2A 5AEKB 2D10A 3PS6A 4XZ4A 2KFJA 5D2MB 4ANWA 2N9XA 3VTVA 3QARA 3PLVA 2KC1A 2KVRA 3AULA 4ZRIA 4FHKA 1KM7A 4FLHA 1TBEA 2LXCA 4WAAA 3NZSA 1MG8A 4W9DA 4DHJD 1D3ZA 3ENEA 4FA6A 5DCNA 3QAQA 3KW5B 2UWQA 4EZKA 1WE6A 2G4DB 3ML8A 2ZNVC 2WWZA 2KX0A 3PGEA 3W1SA 1UBQA 3A9JB 3BY4B 1UELA 2FCMA 1P1AA 2OJRA 1SIFA 2D2QA 4DHZB 5E6OA 2NR2A 2NBWB 4E3CA 1LM8B 3PLUA 2BWES 1V9JA 2K6QA 2ZPNA 4HJKA 4HK2A 1ZKHA 1ZW7A 4EUTA 2LRWA 2DENB 2N1VA 3UGBB 1XQQA 3ZTDA 2KWCA 5IA7A 2BKFA 3LJ3A 3Q3JA 1WXAA 3PV1A 2RPQA 5C1ZA 4IM2A 2JWZA 2W9NA 2LVOA 3APDA 3S2AA 1P98A 1L2NA 2RD0A 3UF8A 5CX3A 4FULA 4AJWA 3ZO5B 3A9KA 3WAMA 3SD5A 3D32A 3JW0X 2K39A 2A5UA 3H1UA 3H7SA 5L95C 1E8XA 5TR5A 2K8HA 3B08A 3QWZB 4NPNA 3DBSA 3QC8B 2ZEQA 1WIAA 3UQBA 3L10B 2ZZPB 4MGIE 3UIPB 4I6LB 2KTRA 1J0GA 2IZVB 2GBNA 2KO3A 2XK5B 4KVGB 2JVCA 3U8ZA 4GDLB 2LJ5A 3RULA 2O2VB 1WR1A 3I3TB 2KQ7A 2AYOB 3KUCB 4ZRJA 3R3MA 2KD0A 1WGHA 2WYQA 4TQ1A 3NS8A 1AARA 4JL9A 4HDQA 4G50A 2M0XA 3APCA 4TKNA 1E8ZA 3MJWA 3ALBA 3BINA 3PREA 3KVFB 3UQAA 3AU4A 4GDLA 4MEMA 3ZTCA 1U4AA 2G3QB 3VUYA 4EEWA 2MLBA 3HM6X 2L05A 2MBQA 3IBEA 4FHJA 5FR6A 4K7SA 1J19A 3TIXA 1RAXA 2QHOA 2DAJA 4HPMB 4IG7B 4MJSA 1VD2A 3H7PA 1WJ4A 3JSVA 1WH3A 4IW0A 2KLGA 3PHXB 2IY1B 3ZNHB 4MGZE 4CO7A 3VDZA 3RZFA 4TQ0A 3ZVVA 1P9DU 2XBBC 1JRUA 4PS8A 4PS3A 1P3QU 2LUEA 3RZWC 2IYDB 3AU5A 2GBRA 2JZ3B 4A3PA 2KMCA 4BFRA 3VUWA 4GIVA 3ONSA 3OAWA 1NDDA 1V86A 2KDEB 3V6EB 2DAFA 3ZNZB 2WDTB 3H9DA 2FUHB 2ZJDA 5AZFA 3EC8A 3QK0A 4ZYNA 3LDZE 1V6EA 1WGDA 3ZLZA 2J0MA 2Z59B 3NHEB 2EMSA 4WJNA 2N4FA 4WWNA 2KNBA 1Q1OA 2WX0A 1WE7A 3NY5A 2L00B 5BO4B 3QJZA 3L08A 1S3SG 2N9PC 1SGHA 2B3AA 2BYFA 2PEAA 4GDKB 2KQSA 2UYZB 1J8CA 1YD8U 4ANXA 2ZPYA 2HJ8A 2ZNVB 2IO3B 2OOBB 3ECIA 4I6NB 3A33B 4WQOB 3ZRCA 3VH4B 3WALA 2MBBB 4KDIC 5DPRA 1WGYA 3V6CB 3QHTA 4BVUC 3ZDTA 1V81A 1V5TA 5HKHA 1PQSA 2YLMA 2KLCA 1E90A 3T9LA 3WAPA 3X0WA 3ZDMC 3GZNI 2NCNA 2PJHA 3TCAA 4P7IA 2KDIA 2KWUB 3DVGY 2CHZA 4GXBA 1Q5WB 5KHOA 1WYWB 2BGFA 2PE6B 2KKCA 2D3GA 1E8YA 2KOXA 4FJZA 2KTRB 2DX5B 4JQWC 1XT9B 2BF8B 3PHWB 4BBNC 4IM0A 1GJZA 2CR5A 2LGXA 2M8SA 4MM3A 2K8BA 1WGGA 2RGFA 2GBJA 1UZXB 3H7PB 3JSVB 1S1QB 1WM3A 3QIJA 4FJVB 4IWOA 2J0JA 2FNJB 3DBHI 2ASQA 3DVGX 4KSKC 3DBLI 3ZKJC 2AL3A 2O6VB 4DHZE 1NI2A 1X1MA 1GC7A 1V5OA 3HM3A 3UINB 1ISNA 4KSLC 1KJTA 2HE7A 4KV2A 4KDLB 2BPSA 4E71A 4HVBA 2EMTA 2A4ZA 2N7EA 2BYEA 2K8CA 4WJPA 1WJUA 3W1SC 2RSUA 2I1KA 4K81A 2KHWB 1WGRA 1WZ3A 3P2BA 2MBHA 4ANVA 2O2VA 2GMIC 3QCAA 2N9EB 3JYUA 3M62B 1IP9A 1E5WA 4B6WA 2AEHA 2JXXA 3ML9A 3PRMB 3ZRFA 2KN5A 4DBGA 4J6IA 1R4NI 5LXIB 5KHQA 1Z5SB 4ASWC 1LQBA 3APFA 3IVFA 4K7UA 1TGZB 2L0TA 3TJPA 2NPTA 1EF5A 4ZDVA 2KC2A 3MTNB 3A4SC 4GN1A 4ICUA 5D6JB 2DZKA 4DDID 4HXDA 3B0AA 3H6NA 3L16A 3VFKA 4B9KA 3RD2A 2K1FA 4M8MA 2C7MB 2L8JA 2KJ6A 2XK5A 4PYZA 4GB9A 4OVUA 3ZW3A 4DWFA 2KXJA 3PRZA 3KUZA 3L54A 1WMHA 2XEWA 4W9EA 1YJ1A 1LXDA 3L13A 4AP4C 2FIFA 5D7GA 4EKUA 1H4RA 1V49A 2LI5A 1SE9A 4G11A 3OJ4B 4WWPA 2KDBA 4W9HA 3K9PB 5E6PA 2MCNB 4DDGD 4F8CB 2ZCCA 1CMXB 4F1SA 3L0WB 4K1RB 4LDTB 2M1MA 3TMPB 4RM9A 3PZDA 2L0FA 1WMHB 4PS7A 3B1LX 2C5LC 3MHSD 1UGMA 2N1WA 3O65B 3OJ3A 4NNJB 3VUXA 4GMVA 5DPTA 2I1JA 3UIOB 4LCDE 3DVNV 2BWFA 2JRHA 2LZ6A 4IUMB 4YL8A 5E6NA 5L83A 3VXWA 1RRBA 1C3TA 3IHPC 4IWPA 5CHFA 1Q0WB 1KLVA 2MBEA 2L3ZA 1LFDA 3Q3FA 5DPSA 4IC7B 4FN2A 2AWTA 5LLIA 1WJNA 1GUAB 3AI5A 2NVUI 1GG3A 2V3SA 5AZHA 1I42A 5J2RA 3SDLC 1V80A 1M94A 1WF9A 1Z2MA 3DPDA 4KIKB 4MJSB 3EECA 1I35A 1WXVA 1C1YB 2CHWA 4M0WB 2O6VD 2LD9A 3ZIMA 2JPHA 2G45B 3DBRI 1UD7A 3A1QB 4TV3A 3L17A 3V62A 2FCNA 5D94A 4FBJB 2M4NA 3M95A 2DYMA 3A9KB 4II3B 2GOWA 3VTUA 4MDKE 3VAWA 1YX5B 3KYDD 2HTHA 1GC6A 1ZGUB 2KK8A 4BOZB 3JVZX 1H8CA 1EF1A 2LVQA 3C0RB 3SU8X 3KH0A 4RMAA 2BYVE 2LGDA 4MGKE 3QA8A 5G55A 2MQJA 1OQYA 2VRRB 4WJOA 3RT3B 4DHJB 2LWPA 1RFAA 2KANA 4A3OA 2IY0B 1HE8A 1EUVB 3HK0A 3OLMD 2FCQA 2V1YA 4NQKE 4W9FA 1RLFA 4EZLA 4JIOU 1YX6B 2GBKA 2G4SA 3ZNID 4GGQA 4G0NB 2M17A 3DQVA 3ZNGC 2ZVOA 1WRDB 1WI0A 2NBVB 1OEYJ 1WM2A 4IWQA 4NAWA 1WXMA 4IM3A 4JLCA 1WY8A 3EFUA 5JZEB 2K6DB 2Y5BB 3KUDB 3PT2B 4WWOA 3U30A 3WANA 3CMMB 1WJ6A 2KFKB 2L7RA 3R7QA 2DZJA 4K7WA 1XD3B 2IO2B 4GU2A 1YQBA 3VQIA 1E7VA 4BKGA 5GMVA 3DVNU 1IPGA 2D11A 1EO6A 3KYCD 4LJOB 1WR6E 2REXA 2J0KA 2LRUA 4DK5A 3AXCA 2GBMA 3EHVA 4GDKA 2MA9B 4WJQA 2DZMA 4EZJA 5J17A 5J18A 2O6VA 3DOWA 3R7RA 4BBNF 4MSQB 3V60A 1WFYA 4KZCA 1Y8RC 4A20A 1R4MI 2AL6A 3VHTC 2CKHB 2FAZA 4HCPB 4HLEA 2MX2A 3U7DA 2CS4A 2C7NB 1E8WA 2RR9A 3K9OB 4MGYE 2MRPA 5JH5C 2LXAA 4RM8A 3N32A 4W9GA 4HDOA 4NQLB 3CSTA 2KMAA 2HD5B 4HWIB 2JZZA 1P0RA 2DYOA 4AUQC 2C9WB 4MELA 1OTRB 4FJYA 3IFWB 4BOSC 4GSWA 2Z0EB 3PPAA 4GOCA 1NBFC 2MP2B 4II2B 4KZ0A 4MH0E 3M3JA 2MSED 4PYUA 1KOTA 2MW5A 4AJYB 2D07B 2MBOA 3TL5A 4AWJA 2V4LA 2C60A 1BT0A 2LVPA 4BKTA 2R2OA 3IG3A 3T8MA 2FIDA 3A9JA 2WX1A 1OGWA 5EDSA 2KTFA 4XX5A 3A4RA 4OVVA 1V2YA 3WIMA 3CF6E 5JHBA 2KWVB 5JHAA 3WAOA 4CHKA 2JRIB 1A5RA 2JT4B 2Z0DB 5C23A 4B95A 1WX8A 1F9JA 3CSFA 1WX7A 3R66C 3VH3B 1UBIA 3RUIB 2DZIA 4N9F4 4W9JA 4ICVA 3VVWB 1VCBA 4W9CA 5IAAC 4F7ZA 2EKEC 3PTFC 4G3XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPT B;  4HCN B;  4W9K A;  4BKS A;  1IYF A;  4ZRK A;  5AZG A;  3A1Q A;  1G6J A;  2JY6 A;  1GNU A;  1L7Y A;  3N3K B;  2KJR A;  3RYT A;  2DYB A;  2IO1 B;  2DHZ A;  3PVL A;  4X57 B;  3VTW A;  4CYE A;  4NJ7 A;  2KDF B;  2J7Q B;  1FXT B;  1YIW A;  2C7H A;  2KX3 A;  5CHV C;  3V61 A;  4MSM B;  2IO0 B;  2KZR A;  4NAW B;  3PRP B;  4JGH B;  3SHQ A;  3NZU A;  2ZVN A;  4M8N A;  5G2N A;  5CTR C;  2CU1 A;  2ZCB A;  4LJP B;  3ZUN A;  2L76 A;  2FCS A;  1T0Y A;  4I6P A;  4TUU A;  3PSE B;  3W1Y A;  2KFK A;  4LDT D;  1QZE A;  2YVC A;  4ANU A;  4DXA B;  4E74 A;  5DPW A;  4W9L A;  4BKS D;  4FAD A;  3RCZ A;  2NS5 A;  4AOF A;  1K8R B;  2KJH B;  4HPL B;  1E7U A;  2MWS B;  5LXH A;  4W9I A;  2JUO A;  1OEY A;  2MP2 A;  1WX9 A;  4EFO A;  4EOY A;  3DDC B;  1TZ1 A;  2R2Q A;  1UH6 A;  2K25 A;  2LAS A;  1WZ0 A;  3HIZ A;  3NOB A;  2IBI B;  2PPH A;  1WXS A;  1TTN A;  2N7D A;  2NBU A;  4URK A;  2PE9 A;  3QQ8 B;  3N30 A;  3TBL D;  2LGY A;  2BKR B;  3WA0 A;  3M63 B;  4KIK A;  4NY0 A;  3QX1 A;  2JF5 A;  3DCG A;  3GOE A;  2CHX A;  3X23 A;  4NJ6 A;  5CHW A;  3HHM A;  4XC2 A;  5AEK B;  2D10 A;  3PS6 A;  4XZ4 A;  2KFJ A;  5D2M B;  4ANW A;  2N9X A;  3VTV A;  3QAR A;  3PLV A;  2KC1 A;  2KVR A;  3AUL A;  4ZRI A;  4FHK A;  1KM7 A;  4FLH A;  1TBE A;  2LXC A;  4WAA A;  3NZS A;  1MG8 A;  4W9D A;  4DHJ D;  1D3Z A;  3ENE A;  4FA6 A;  5DCN A;  3QAQ A;  3KW5 B;  2UWQ A;  4EZK A;  1WE6 A;  2G4D B;  3ML8 A;  2ZNV C;  2WWZ A;  2KX0 A;  3PGE A;  3W1S A;  1UBQ A;  3A9J B;  3BY4 B;  1UEL A;  2FCM A;  1P1A A;  2OJR A;  1SIF A;  2D2Q A;  4DHZ B;  5E6O A;  2NR2 A;  2NBW B;  4E3C A;  1LM8 B;  3PLU A;  2BWE S;  1V9J A;  2K6Q A;  2ZPN A;  4HJK A;  4HK2 A;  1ZKH A;  1ZW7 A;  4EUT A;  2LRW A;  2DEN B;  2N1V A;  3UGB B;  1XQQ A;  3ZTD A;  2KWC A;  5IA7 A;  2BKF A;  3LJ3 A;  3Q3J A;  1WXA A;  3PV1 A;  2RPQ A;  5C1Z A;  4IM2 A;  2JWZ A;  2W9N A;  2LVO A;  3APD A;  3S2A A;  1P98 A;  1L2N A;  2RD0 A;  3UF8 A;  5CX3 A;  4FUL A;  4AJW A;  3ZO5 B;  3A9K A;  3WAM A;  3SD5 A;  3D32 A;  3JW0 X;  2K39 A;  2A5U A;  3H1U A;  3H7S A;  5L95 C;  1E8X A;  5TR5 A;  2K8H A;  3B08 A;  3QWZ B;  4NPN A;  3DBS A;  3QC8 B;  2ZEQ A;  1WIA A;  3UQB A;  3L10 B;  2ZZP B;  4MGI E;  3UIP B;  4I6L B;  2KTR A;  1J0G A;  2IZV B;  2GBN A;  2KO3 A;  2XK5 B;  4KVG B;  2JVC A;  3U8Z A;  4GDL B;  2LJ5 A;  3RUL A;  2O2V B;  1WR1 A;  3I3T B;  2KQ7 A;  2AYO B;  3KUC B;  4ZRJ A;  3R3M A;  2KD0 A;  1WGH A;  2WYQ A;  4TQ1 A;  3NS8 A;  1AAR A;  4JL9 A;  4HDQ A;  4G50 A;  2M0X A;  3APC A;  4TKN A;  1E8Z A;  3MJW A;  3ALB A;  3BIN A;  3PRE A;  3KVF B;  3UQA A;  3AU4 A;  4GDL A;  4MEM A;  3ZTC A;  1U4A A;  2G3Q B;  3VUY A;  4EEW A;  2MLB A;  3HM6 X;  2L05 A;  2MBQ A;  3IBE A;  4FHJ A;  5FR6 A;  4K7S A;  1J19 A;  3TIX A;  1RAX A;  2QHO A;  2DAJ A;  4HPM B;  4IG7 B;  4MJS A;  1VD2 A;  3H7P A;  1WJ4 A;  3JSV A;  1WH3 A;  4IW0 A;  2KLG A;  3PHX B;  2IY1 B;  3ZNH B;  4MGZ E;  4CO7 A;  3VDZ A;  3RZF A;  4TQ0 A;  3ZVV A;  1P9D U;  2XBB C;  1JRU A;  4PS8 A;  4PS3 A;  1P3Q U;  2LUE A;  3RZW C;  2IYD B;  3AU5 A;  2GBR A;  2JZ3 B;  4A3P A;  2KMC A;  4BFR A;  3VUW A;  4GIV A;  3ONS A;  3OAW A;  1NDD A;  1V86 A;  2KDE B;  3V6E B;  2DAF A;  3ZNZ B;  2WDT B;  3H9D A;  2FUH B;  2ZJD A;  5AZF A;  3EC8 A;  3QK0 A;  4ZYN A;  3LDZ E;  1V6E A;  1WGD A;  3ZLZ A;  2J0M A;  2Z59 B;  3NHE B;  2EMS A;  4WJN A;  2N4F A;  4WWN A;  2KNB A;  1Q1O A;  2WX0 A;  1WE7 A;  3NY5 A;  2L00 B;  5BO4 B;  3QJZ A;  3L08 A;  1S3S G;  2N9P C;  1SGH A;  2B3A A;  2BYF A;  2PEA A;  4GDK B;  2KQS A;  2UYZ B;  1J8C A;  1YD8 U;  4ANX A;  2ZPY A;  2HJ8 A;  2ZNV B;  2IO3 B;  2OOB B;  3ECI A;  4I6N B;  3A33 B;  4WQO B;  3ZRC A;  3VH4 B;  3WAL A;  2MBB B;  4KDI C;  5DPR A;  1WGY A;  3V6C B;  3QHT A;  4BVU C;  3ZDT A;  1V81 A;  1V5T A;  5HKH A;  1PQS A;  2YLM A;  2KLC A;  1E90 A;  3T9L A;  3WAP A;  3X0W A;  3ZDM C;  3GZN I;  2NCN A;  2PJH A;  3TCA A;  4P7I A;  2KDI A;  2KWU B;  3DVG Y;  2CHZ A;  4GXB A;  1Q5W B;  5KHO A;  1WYW B;  2BGF A;  2PE6 B;  2KKC A;  2D3G A;  1E8Y A;  2KOX A;  4FJZ A;  2KTR B;  2DX5 B;  4JQW C;  1XT9 B;  2BF8 B;  3PHW B;  4BBN C;  4IM0 A;  1GJZ A;  2CR5 A;  2LGX A;  2M8S A;  4MM3 A;  2K8B A;  1WGG A;  2RGF A;  2GBJ A;  1UZX B;  3H7P B;  3JSV B;  1S1Q B;  1WM3 A;  3QIJ A;  4FJV B;  4IWO A;  2J0J A;  2FNJ B;  3DBH I;  2ASQ A;  3DVG X;  4KSK C;  3DBL I;  3ZKJ C;  2AL3 A;  2O6V B;  4DHZ E;  1NI2 A;  1X1M A;  1GC7 A;  1V5O A;  3HM3 A;  3UIN B;  1ISN A;  4KSL C;  1KJT A;  2HE7 A;  4KV2 A;  4KDL B;  2BPS A;  4E71 A;  4HVB A;  2EMT A;  2A4Z A;  2N7E A;  2BYE A;  2K8C A;  4WJP A;  1WJU A;  3W1S C;  2RSU A;  2I1K A;  4K81 A;  2KHW B;  1WGR A;  1WZ3 A;  3P2B A;  2MBH A;  4ANV A;  2O2V A;  2GMI C;  3QCA A;  2N9E B;  3JYU A;  3M62 B;  1IP9 A;  1E5W A;  4B6W A;  2AEH A;  2JXX A;  3ML9 A;  3PRM B;  3ZRF A;  2KN5 A;  4DBG A;  4J6I A;  1R4N I;  5LXI B;  5KHQ A;  1Z5S B;  4ASW C;  1LQB A;  3APF A;  3IVF A;  4K7U A;  1TGZ B;  2L0T A;  3TJP A;  2NPT A;  1EF5 A;  4ZDV A;  2KC2 A;  3MTN B;  3A4S C;  4GN1 A;  4ICU A;  5D6J B;  2DZK A;  4DDI D;  4HXD A;  3B0A A;  3H6N A;  3L16 A;  3VFK A;  4B9K A;  3RD2 A;  2K1F A;  4M8M A;  2C7M B;  2L8J A;  2KJ6 A;  2XK5 A;  4PYZ A;  4GB9 A;  4OVU A;  3ZW3 A;  4DWF A;  2KXJ A;  3PRZ A;  3KUZ A;  3L54 A;  1WMH A;  2XEW A;  4W9E A;  1YJ1 A;  1LXD A;  3L13 A;  4AP4 C;  2FIF A;  5D7G A;  4EKU A;  1H4R A;  1V49 A;  2LI5 A;  1SE9 A;  4G11 A;  3OJ4 B;  4WWP A;  2KDB A;  4W9H A;  3K9P B;  5E6P A;  2MCN B;  4DDG D;  4F8C B;  2ZCC A;  1CMX B;  4F1S A;  3L0W B;  4K1R B;  4LDT B;  2M1M A;  3TMP B;  4RM9 A;  3PZD A;  2L0F A;  1WMH B;  4PS7 A;  3B1L X;  2C5L C;  3MHS D;  1UGM A;  2N1W A;  3O65 B;  3OJ3 A;  4NNJ B;  3VUX A;  4GMV A;  5DPT A;  2I1J A;  3UIO B;  4LCD E;  3DVN V;  2BWF A;  2JRH A;  2LZ6 A;  4IUM B;  4YL8 A;  5E6N A;  5L83 A;  3VXW A;  1RRB A;  1C3T A;  3IHP C;  4IWP A;  5CHF A;  1Q0W B;  1KLV A;  2MBE A;  2L3Z A;  1LFD A;  3Q3F A;  5DPS A;  4IC7 B;  4FN2 A;  2AWT A;  5LLI A;  1WJN A;  1GUA B;  3AI5 A;  2NVU I;  1GG3 A;  2V3S A;  5AZH A;  1I42 A;  5J2R A;  3SDL C;  1V80 A;  1M94 A;  1WF9 A;  1Z2M A;  3DPD A;  4KIK B;  4MJS B;  3EEC A;  1I35 A;  1WXV A;  1C1Y B;  2CHW A;  4M0W B;  2O6V D;  2LD9 A;  3ZIM A;  2JPH A;  2G45 B;  3DBR I;  1UD7 A;  3A1Q B;  4TV3 A;  3L17 A;  3V62 A;  2FCN A;  5D94 A;  4FBJ B;  2M4N A;  3M95 A;  2DYM A;  3A9K B;  4II3 B;  2GOW A;  3VTU A;  4MDK E;  3VAW A;  1YX5 B;  3KYD D;  2HTH A;  1GC6 A;  1ZGU B;  2KK8 A;  4BOZ B;  3JVZ X;  1H8C A;  1EF1 A;  2LVQ A;  3C0R B;  3SU8 X;  3KH0 A;  4RMA A;  2BYV E;  2LGD A;  4MGK E;  3QA8 A;  5G55 A;  2MQJ A;  1OQY A;  2VRR B;  4WJO A;  3RT3 B;  4DHJ B;  2LWP A;  1RFA A;  2KAN A;  4A3O A;  2IY0 B;  1HE8 A;  1EUV B;  3HK0 A;  3OLM D;  2FCQ A;  2V1Y A;  4NQK E;  4W9F A;  1RLF A;  4EZL A;  4JIO U;  1YX6 B;  2GBK A;  2G4S A;  3ZNI D;  4GGQ A;  4G0N B;  2M17 A;  3DQV A;  3ZNG C;  2ZVO A;  1WRD B;  1WI0 A;  2NBV B;  1OEY J;  1WM2 A;  4IWQ A;  4NAW A;  1WXM A;  4IM3 A;  4JLC A;  1WY8 A;  3EFU A;  5JZE B;  2K6D B;  2Y5B B;  3KUD B;  3PT2 B;  4WWO A;  3U30 A;  3WAN A;  3CMM B;  1WJ6 A;  2KFK B;  2L7R A;  3R7Q A;  2DZJ A;  4K7W A;  1XD3 B;  2IO2 B;  4GU2 A;  1YQB A;  3VQI A;  1E7V A;  4BKG A;  5GMV A;  3DVN U;  1IPG A;  2D11 A;  1EO6 A;  3KYC D;  4LJO B;  1WR6 E;  2REX A;  2J0K A;  2LRU A;  4DK5 A;  3AXC A;  2GBM A;  3EHV A;  4GDK A;  2MA9 B;  4WJQ A;  2DZM A;  4EZJ A;  5J17 A;  5J18 A;  2O6V A;  3DOW A;  3R7R A;  4BBN F;  4MSQ B;  3V60 A;  1WFY A;  4KZC A;  1Y8R C;  4A20 A;  1R4M I;  2AL6 A;  3VHT C;  2CKH B;  2FAZ A;  4HCP B;  4HLE A;  2MX2 A;  3U7D A;  2CS4 A;  2C7N B;  1E8W A;  2RR9 A;  3K9O B;  4MGY E;  2MRP A;  5JH5 C;  2LXA A;  4RM8 A;  3N32 A;  4W9G A;  4HDO A;  4NQL B;  3CST A;  2KMA A;  2HD5 B;  4HWI B;  2JZZ A;  1P0R A;  2DYO A;  4AUQ C;  2C9W B;  4MEL A;  1OTR B;  4FJY A;  3IFW B;  4BOS C;  4GSW A;  2Z0E B;  3PPA A;  4GOC A;  1NBF C;  2MP2 B;  4II2 B;  4KZ0 A;  4MH0 E;  3M3J A;  2MSE D;  4PYU A;  1KOT A;  2MW5 A;  4AJY B;  2D07 B;  2MBO A;  3TL5 A;  4AWJ A;  2V4L A;  2C60 A;  1BT0 A;  2LVP A;  4BKT A;  2R2O A;  3IG3 A;  3T8M A;  2FID A;  3A9J A;  2WX1 A;  1OGW A;  5EDS A;  2KTF A;  4XX5 A;  3A4R A;  4OVV A;  1V2Y A;  3WIM A;  3CF6 E;  5JHB A;  2KWV B;  5JHA A;  3WAO A;  4CHK A;  2JRI B;  1A5R A;  2JT4 B;  2Z0D B;  5C23 A;  4B95 A;  1WX8 A;  1F9J A;  3CSF A;  1WX7 A;  3R66 C;  3VH3 B;  1UBI A;  3RUI B;  2DZI A;  4N9F 4;  4W9J A;  4ICV A;  3VVW B;  1VCB A;  4W9C A;  5IAA C;  4F7Z A;  2EKE C;  3PTF C;  4G3X B; 
#chains in the Genus database with same CATH topology
 2NPT B;  1JQ4 A;  4W9K A;  4ZRK A;  3N3K B;  2FBW B;  4NZL B;  3RYT A;  3PVL A;  1N60 A;  1YIW A;  1FCL A;  5I4D A;  4HPP A;  3SHQ A;  3PZ7 A;  1E0Z A;  2WHI A;  4LJP B;  1DGJ A;  4I6P A;  4TUU A;  1WXQ A;  2WXO A;  4DXG A;  5DPW A;  5H8Y E;  2LEK A;  3RCZ A;  1V1P B;  4J3O D;  4HPL B;  3U7Z A;  2MWS B;  4KGS A;  1OEY A;  5IOI A;  3TSS A;  4EFO A;  1MHH E;  3GB1 A;  2LAS A;  3NOB A;  4URK A;  1QOA A;  1TS4 A;  5CHW A;  1E10 A;  2WXI A;  2D10 A;  4XZ4 A;  4YSY B;  1TS2 A;  1STE A;  3HRD D;  3QAR A;  3PLV A;  2KC1 A;  1KM7 A;  2JSV X;  1D3Z A;  4FA6 A;  5DCN A;  1C9F A;  4EZK A;  1IUE A;  2WWZ A;  4JWU C;  3A9J B;  3AH7 A;  3BY4 B;  4DQO C;  2FCM A;  2OJR A;  1C4A A;  2KVZ A;  2K6Q A;  4HK2 A;  1ZW7 A;  3ZTD A;  2BKF A;  3LJ3 A;  2RPQ A;  3RPF C;  3DHH C;  4IM2 A;  3R2I A;  1P98 A;  4FUL A;  1GPX A;  3JW0 X;  5L95 C;  1MJD A;  5TR5 A;  3QWZ B;  3FIL A;  2GB1 A;  3DBS A;  2ZEQ A;  1WIA A;  5T8I A;  1N63 A;  3L10 B;  1BUI C;  2ZZP B;  3UIP B;  4I6L B;  2RPV A;  3DBR B;  2IZV B;  1J0G A;  2KO3 A;  2XK5 B;  4KVG B;  4USA A;  3U8Z A;  2LJ5 A;  2O2V B;  3KUC B;  2KD0 A;  1WGH A;  4TQ1 A;  1ZDV A;  4HDQ A;  4G50 A;  3APC A;  2DWQ A;  2VH2 A;  4TKN A;  2R61 A;  3BIN A;  3PRE A;  3KVF B;  2RMM A;  2L05 A;  5HG2 A;  1J19 A;  2QCZ A;  3TIX A;  3E9S A;  3Q8A A;  3JSV A;  4M00 A;  1WH3 A;  4IW0 A;  1JAL A;  3PHX B;  3N1X C;  2UU7 A;  3SFD B;  3ZVV A;  4PS3 A;  4PS8 A;  4C00 A;  3AU5 A;  2GBR A;  5BYR A;  1XEE A;  3VUW A;  1MVK A;  1I4P A;  2LMC A;  1XXG A;  3ZNZ B;  2WDT B;  4XYC A;  1SXT A;  1SF0 A;  5AZF A;  3QK0 A;  4MT5 A;  2L32 A;  4H2A A;  2KNB A;  1Q1O A;  4AS1 A;  1C78 A;  3Q8E A;  1V1O A;  2N9P C;  2BYF A;  3C8Y A;  1J8C A;  1YD8 U;  1IBX B;  1B1Z A;  2ZNV B;  2OOB B;  3VH4 B;  1Y56 A;  3WAL A;  3V6C B;  3NVW A;  1F0Z A;  1PQS A;  2KLC A;  3GZN I;  2PJH A;  3TCA A;  1OQQ A;  1R4M B;  2IGG A;  1Q5W B;  5KHO A;  2KTR B;  4JQW C;  2WDV B;  4IM0 A;  3R2T A;  2CR5 A;  1ZOY B;  1VZ8 A;  3FKY A;  3H7P B;  2M8S A;  5D7G A;  1TY2 A;  5HHD G;  1WM3 A;  2FNJ B;  2ASQ A;  4DHZ E;  1UWX A;  1ZUD 2;  3EA6 A;  1V5O A;  1FIQ A;  1KJT A;  4KV2 A;  2BPS A;  4E71 A;  4HVB A;  2N7E A;  4WJP A;  4KX6 B;  3W1S C;  4JX1 C;  2RSU A;  2AX5 A;  4K81 A;  4YT0 B;  3B2F A;  3P2B A;  2N9E B;  3W5U B;  3JYU A;  3M62 B;  1IP9 A;  2JXX A;  1R4N I;  1YN5 A;  1Z5S B;  3APF A;  3Q8F A;  4N58 A;  1EF5 A;  3A4S C;  2DZK A;  4M8M A;  2KJ6 A;  4PYZ A;  3PRZ A;  3Q3O C;  1WMH A;  1TKY A;  2MH7 A;  1YJ1 A;  3L13 A;  2FIF A;  2JX5 A;  2WDQ B;  1H4R A;  2N9K A;  4G11 A;  2EKI A;  2KDB A;  5E6P A;  4DDG D;  4F1S A;  1CMX B;  2M1M A;  3TMP B;  4RM9 A;  2I1J A;  2OHF A;  1V97 A;  2JRH A;  2OED A;  1RRB A;  3N1Z C;  5CHF A;  3Q3F A;  5DPS A;  5LLI A;  3MHZ A;  3AI5 A;  2NVU I;  1HXY D;  4LK0 M;  5AUK A;  4KIK B;  3EEC A;  4A90 A;  1F52 A;  1UD7 A;  3A1Q B;  3L17 A;  2FCN A;  2M4N A;  2GOW A;  1GC6 A;  1HQR D;  1N5X A;  3JVZ X;  1HZ5 A;  3SU8 X;  2BYV E;  4MGK E;  3AE4 B;  2VRR B;  4HKQ A;  1B9R A;  4REZ A;  1RFA A;  2KAN A;  1KRH A;  4NQK E;  4W9F A;  2FCQ A;  2V1Y A;  2QMT A;  1RLF A;  4ZHO A;  2G4S A;  3VR8 B;  1UF0 A;  1JML A;  2PTL A;  3ZJU A;  1WI0 A;  2NBV B;  3BK1 A;  4NAW A;  1WXM A;  4IM3 A;  4L1B A;  2K6D B;  2Y5B B;  4ITK A;  2BB5 A;  3AE8 B;  3CMM B;  3VQI A;  1E7V A;  1T3Q A;  1PGA A;  4DK5 A;  3AXC A;  2GBM A;  2MA9 B;  1JWB D;  3SR6 A;  4WJQ A;  3MP9 A;  3E56 A;  1NVI D;  1R4M I;  3H8H A;  1YN4 A;  4HCP B;  2K0P A;  2MX2 A;  1QQR A;  1ZXH A;  2C7N B;  3MJ5 A;  4EE2 A;  1LGR A;  2LXA A;  3CST A;  4HWI B;  1F2R I;  1DYQ A;  4MEL A;  1OTR B;  2IND C;  4FJY A;  3IFW B;  3PPA A;  4GOC A;  2JWU A;  5GXG B;  3A9J A;  3Q14 C;  2KTF A;  4XX5 A;  3A4R A;  1MG4 A;  2IGD A;  3NJT A;  1EWY C;  1IGD A;  3CF6 E;  1N6Z A;  2LFI A;  5JHB A;  1WWT A;  5HI1 A;  3BVM A;  1A5R A;  2Z0D B;  4XE0 A;  1WX8 A;  1F9J A;  2LGS A;  3ZYY X;  4A6Q A;  2DZI A;  1VDV A;  3VVW B;  5G5G A;  4BKS A;  1IYF A;  1ET6 A;  3RFZ B;  1JWU D;  2JY6 A;  1L7Y A;  1ZPS A;  2DYB A;  2IO1 B;  2DHZ A;  4NAM A;  4YTN B;  4NJ7 A;  1VRA B;  2KX3 A;  3DHI C;  5IN7 A;  1AN8 A;  3KWV A;  1UUP A;  2ZVN A;  5CTR C;  3W2D A;  3PSE B;  3AE1 B;  4ANU A;  1QZE A;  4DXA B;  4W9L A;  4FAD A;  5LNK 1;  2KJH B;  1E7U A;  3RNF C;  2MP2 A;  2BS4 B;  3DDC B;  1UH6 A;  3LYY A;  1L4D B;  1DOI A;  4RGT A;  2K25 A;  1IBX A;  1WZ0 A;  3HIZ A;  2IBI B;  2VH1 A;  1TTN A;  2NBU A;  2MHJ A;  2PE9 A;  3QQ8 B;  1MPE A;  3AM9 A;  3WA0 A;  2CHX A;  3P42 A;  3X23 A;  3P1M A;  2HJ1 A;  1PGX A;  5AEK B;  2JYE A;  2KFJ A;  4ANW A;  2KAC A;  3I57 A;  1PUT A;  2KVR A;  3AUL A;  4FLH A;  2LXC A;  4DHJ D;  4W9D A;  1FRR A;  2LUM A;  3NS1 A;  3AEC B;  2D3B A;  3ML8 A;  3PGE A;  1UBQ A;  2WLB A;  1P1A A;  2N7J A;  2D2Q A;  4DHZ B;  2NR2 A;  3PLU A;  4HJK A;  1V9J A;  2LRW A;  2DEN B;  3UGB B;  1YMH E;  2G1E A;  5IA7 A;  4OZB A;  2G9H D;  3KQ4 A;  3Q3J A;  3KLS X;  2WU5 B;  3W9C B;  4LNK A;  2RDG A;  1F2R C;  3WAM A;  3SD5 A;  4IOI E;  1PFD A;  4LNI A;  4LNN A;  2V4I B;  2K8H A;  1ZE3 D;  4M01 A;  3RN9 C;  1J7A A;  2MJD A;  4JE3 B;  4KKI A;  2KTR A;  2NTS A;  2GBN A;  1KLU D;  1SJH D;  1P7E A;  2JVC A;  1T0R C;  5HFY A;  2QIE B;  5IKC M;  3RUL A;  1N61 A;  1WR1 A;  2KQ7 A;  2AYO B;  3PO0 A;  2WYQ A;  5FK9 C;  1AAR A;  4JL9 A;  2M0X A;  1TKE A;  3CIR B;  1D6E C;  1TY0 A;  4MEM A;  3ZTC A;  2G3Q B;  3VUY A;  2MLB A;  3HM6 X;  2E6X A;  4K7S A;  1RAX A;  4BZA A;  5EE3 A;  1TJE A;  4MJS A;  3H7P A;  1L0Y B;  1VR9 A;  2KLG A;  3IT6 B;  3ZNH B;  4MGZ E;  4R3D A;  4CO7 A;  5E6J A;  1BXT A;  2INP E;  4RNA A;  2LUE A;  2V9H A;  2INC C;  1WSP A;  4KGT A;  1NDD A;  1V86 A;  2WXR A;  4XDC A;  5BYS A;  3ZGZ A;  4ZYN A;  1V6E A;  1WGD A;  3ZLZ A;  2EMS A;  4WJN A;  2N4F A;  2WQY B;  3NY5 A;  4RFB A;  2QDF A;  1SGH A;  2PEA A;  1QKZ A;  4ANX A;  1SBB B;  2HJ8 A;  4ZYS A;  4I6N B;  2MBB B;  2QJL A;  4BVU C;  1ET9 A;  3ZDT A;  5HKH A;  1UGJ A;  3WAP A;  1E90 A;  3X0W A;  2ONQ A;  2NCN A;  3ABV B;  2KWU B;  1ENF A;  2D3G A;  4FJZ A;  1XT9 B;  2BF8 B;  4BBN C;  1GJZ A;  4IKG A;  2K8B A;  2GBJ A;  4HEA 1;  2K3U A;  4IWO A;  2J0J A;  4RGM A;  3DVG X;  3ZKJ C;  1GC7 A;  2J52 A;  3UIN B;  3VRA B;  4KDL B;  2EMT A;  2K8C A;  2HDE A;  1WJU A;  1JRO A;  2WXN A;  2X8X X;  1WGR A;  4AQ7 A;  4N59 A;  5JXV A;  2MBH A;  3EFC A;  1E5W A;  3PRM B;  2KYW A;  2RDB C;  1SE4 A;  1YJI A;  3TJP A;  2LHE A;  3NVV A;  4B0M A;  2KC2 A;  4LNO A;  4WAF A;  4DDI D;  3B0A A;  3H6N A;  1FPY A;  2K1F A;  1FCC C;  4P1C C;  4OVU A;  4W9E A;  2XEW A;  5IP4 D;  3FIL B;  1SE9 A;  4F8C B;  2QSD A;  3DBH B;  4K1R B;  3Q6B A;  1ESF A;  1WMH B;  4WWM A;  1UGM A;  4C4V B;  4NNJ B;  1E7P B;  1RM6 C;  4YL8 A;  3VXW A;  3AN1 A;  2L3Z A;  1TYG B;  2KN4 A;  4WIP A;  1GG3 A;  2H88 B;  1I42 A;  3FAH A;  1M94 A;  1Z2M A;  1FMA D;  1VJK A;  1JWM D;  1YN3 A;  2JPH A;  3DBR I;  4FBJ B;  2BS2 B;  1WGK A;  3M95 A;  2DYM A;  2WNM A;  3N1Y C;  4HJG E;  2WXL A;  3KYD D;  2MEK A;  1EF1 A;  2Y3A A;  2LJI A;  4YSZ B;  2LGD A;  5TSS A;  3QA8 A;  4XWT A;  1OQY A;  3RT3 B;  3L4P A;  4ZRQ A;  2WXJ A;  1EUV B;  1YX6 B;  3J9C A;  1QOB A;  2TSS A;  1BML C;  4GGQ A;  3ZJT A;  3MC0 B;  3IXS A;  1WY8 A;  1M4V A;  4WWO A;  3U30 A;  1WJ6 A;  3R7Q A;  4K7W A;  1XD3 B;  1DOX A;  3U52 E;  1WRI A;  4OZA A;  4C56 C;  5GMV A;  3DVN U;  2D11 A;  1EO6 A;  3GS2 A;  4LLG M;  2J0K A;  3EHV A;  1OFF A;  2DZM A;  5J18 A;  2O6V A;  2RDH A;  1NEN B;  1VZ7 A;  1TS5 A;  1K51 A;  1WFY A;  2V0G A;  4KZC A;  1L6V A;  5EE0 A;  5BMI A;  1HTQ A;  1TIF A;  3VHT C;  1QOG A;  1N5W A;  1FFV A;  4MGY E;  5JH5 C;  1L0X B;  1GB4 A;  4RM8 A;  2HD5 B;  3MC9 A;  2Z0E B;  3C19 A;  2MP2 B;  4II2 B;  4MH0 E;  1I7H A;  2MSE D;  4PYU A;  2WXH A;  4AJY B;  3TL5 A;  2AQ2 B;  2C60 A;  2Z8L A;  1D5Z C;  2PVO D;  4US9 A;  4QAY A;  4OVV A;  1V2Y A;  3RNC C;  1JCK B;  1K50 A;  1PGB A;  3WAO A;  4CHK A;  2JT4 B;  5C23 A;  4TMA B;  3RUI B;  4W9J A;  3BK2 A;  4LNF A;  2EKE C;  3N20 C;  1C77 A;  4Q2J A;  3NUH B;  3A1Q A;  2KJR A;  1FNW A;  4X57 B;  2BYT A;  4CYE A;  2KDF B;  2J7Q B;  1FXT B;  2C7H A;  1SE2 A;  3V61 A;  2KZR A;  4IDI A;  3PRP B;  4JGH B;  4M8N A;  2CU1 A;  2ZCB A;  1T0Y A;  3W1Y A;  4LDT D;  3WCQ A;  4E74 A;  2EEL A;  4RF1 A;  1FRD A;  2NS5 A;  1K8R B;  2QC8 A;  5LXH A;  4W9I A;  2KWD A;  1QIL A;  3DWG C;  2JUO A;  1WX9 A;  3TEZ A;  3N9Y C;  1TZ1 A;  2R2Q A;  4HRO A;  4YXD B;  3OWE B;  2BW2 A;  3AEA B;  2PPH A;  1HTO A;  2WS3 B;  4L2Y A;  2N7D A;  1T0Q C;  4ZHP A;  1RFK A;  3NRZ A;  2LGY A;  3IT4 B;  4NY0 A;  4YTP B;  3AMZ A;  3DCG A;  3GOE A;  1C79 A;  2INN E;  4XC2 A;  3PS6 A;  5D2M B;  3AE9 B;  2ON8 A;  2BVC A;  3BVZ A;  4FHK A;  4L23 A;  2IPK D;  3ENE A;  2WU2 B;  1L4Z B;  2UWQ A;  1WE6 A;  2G4D B;  2KX0 A;  5EE1 A;  3BII D;  1UEL A;  1SIF A;  2NBW B;  1LM8 B;  2ZPN A;  1ZKH A;  4EUT A;  2N1V A;  3HUI A;  1XQQ A;  2KWC A;  1WXA A;  3PV1 A;  5C1Z A;  1XF5 L;  1JWA D;  4K3B A;  2B76 B;  1L2N A;  2YEP B;  1T6B X;  2OJW A;  3Q3N C;  3BWU D;  3ZO5 B;  3A9K A;  3AEB B;  1EWC A;  3H1U A;  2WXK A;  3BZD B;  1SE3 A;  2MJ3 A;  4NPN A;  1T5X D;  5BYQ A;  1YOV B;  3HVD A;  3UQB A;  2JZP A;  4MGI E;  2KMM A;  2X38 A;  1F77 A;  3MFG A;  2BB6 A;  4GDL B;  3I3T B;  4ARI A;  4ZRJ A;  1GOZ A;  4GLS C;  1R7S A;  1NI3 A;  1E8Z A;  3MJW A;  3P63 A;  3ALB A;  1RYJ A;  4GDL A;  1YQ3 B;  4ZOH C;  1YJJ A;  2MBQ A;  3IBE A;  2IDY A;  2DAJ A;  3Q8B A;  4IG7 B;  1A70 A;  1VZ6 A;  4KKJ A;  4TQ0 A;  1P9D U;  2XBB C;  1JRU A;  3RZW C;  1I4H A;  1XLQ A;  2DNF A;  3LXF A;  2JZ3 B;  1FM0 D;  4A3P A;  2JXT A;  4BFR A;  4GIV A;  3ONS A;  3OAW A;  2KDE B;  2DAF A;  4A55 A;  3EC8 A;  2YEP F;  3LDZ E;  4P6V F;  4KGR A;  2J0M A;  2Z59 B;  3NHE B;  3P4S B;  1UNS A;  4WWN A;  1JW9 D;  3Q3M C;  2L00 B;  2M0A A;  1SIJ A;  3AE6 B;  1ROE A;  2DLB A;  4GDK B;  2UYZ B;  2AQ3 B;  3IAS 1;  4WQO B;  3ECI A;  3A33 B;  2K22 A;  5DPR A;  1WGY A;  1SSN A;  2GI9 A;  3QHT A;  4OHJ A;  3O13 A;  1E6E B;  2YLM A;  4PT5 A;  3T9L A;  1JRP A;  4P7I A;  2CHZ A;  2BGF A;  3B9J A;  2KKC A;  2KOX A;  1E8Y A;  3GE8 C;  3PHW B;  2LGX A;  2RGF A;  3SFE B;  1S1Q B;  4KSK C;  2IJ0 A;  1FNU A;  4ZRP A;  3HM3 A;  1ISN A;  3NG0 A;  1RWS A;  2HE7 A;  4RH6 A;  2A4Z A;  5G5H A;  2M56 B;  1QLB B;  3VR9 B;  1WZ3 A;  1XLP A;  1XLN A;  1KLG D;  2W3R A;  4B6W A;  4DBG A;  1GAQ B;  4J6I A;  3AB5 A;  4ASW C;  3IVF A;  4K7U A;  2QIL A;  2NPT A;  4ZDV A;  3MTN B;  1CJE A;  5D6J B;  5BMH A;  4HXD A;  5C2T B;  3RD2 A;  2C7M B;  4DWF A;  4GB9 A;  2KXJ A;  3L54 A;  4AP4 C;  3VRB B;  4EKU A;  1V49 A;  2J42 A;  4S17 A;  1CZP A;  2LI5 A;  3OJ4 B;  4WWP A;  1ACC A;  2ZCC A;  4XDD A;  4US8 A;  2SAK A;  2XN9 C;  3PZD A;  2KAJ A;  2L0F A;  1ZP0 B;  4PS7 A;  1QT9 A;  3TEX A;  3FC4 A;  2C5L C;  2CJN A;  3MHS D;  3O65 B;  2CU3 A;  3EGR A;  3VUX A;  4RGN A;  5DPT A;  1XO3 A;  3UIO B;  4LCD E;  1FO4 A;  3KWL A;  2LZ6 A;  4IUM B;  5L83 A;  2PLP A;  3GZN B;  4B0E A;  1C3T A;  4IWP A;  1Q0W B;  2MBE A;  4FN2 A;  1WJN A;  4ARC A;  1HEZ E;  1V80 A;  4MM3 B;  1WF9 A;  2H89 B;  1D4B A;  1I35 A;  1C1Y B;  2CHW A;  3T3O A;  3ZIM A;  3RI7 C;  4TV3 A;  3V62 A;  5D94 A;  3A9K B;  4II3 B;  3GP7 A;  3VAW A;  2HTH A;  4BOZ B;  1ZGU B;  1AW7 A;  3C0R B;  2W55 A;  3KH0 A;  4RMA A;  5AUI A;  1MI0 A;  1R4N B;  1E9M A;  5G55 A;  2JU6 X;  2E3T A;  1ZDX A;  2V3N A;  2I2Y A;  1HE8 A;  3HK0 A;  4EZL A;  4JIO U;  2D3C A;  3ZNI D;  3DQV A;  2ZVO A;  2JYT A;  1WM2 A;  4IWQ A;  1L6U A;  4JLC A;  1K53 A;  3WAN A;  5MPO A;  2KFK B;  2BQQ A;  2DZJ A;  2XNA C;  4TSS A;  4RCO A;  4GU2 A;  1I4X A;  1IPG A;  3KYC D;  2PKO A;  2DBY A;  3AV8 A;  1JWS D;  2LRU A;  2BTE A;  2V3P A;  2L83 A;  5BMG A;  3DOW A;  3R7R A;  3TUO A;  2WXF A;  4MSQ B;  1ZXI A;  3ETR A;  3V60 A;  4P1B C;  4A20 A;  2AL6 A;  2CKH B;  2FAZ A;  3U7D A;  2CS4 A;  5H92 C;  4M0W A;  3K9O B;  5D3I B;  4JWS C;  2K5P A;  4NQL B;  1UWM A;  2KMA A;  2WXQ A;  2JZZ A;  2DYO A;  2C9W B;  4BOS C;  2W82 A;  4GSW A;  1KH0 A;  1NBF C;  2M19 A;  3RNE C;  3M3J A;  2MW5 A;  4AWJ A;  2V4L A;  1HA5 A;  4BKT A;  3IG3 A;  3T8M A;  1TT5 B;  2VZK B;  1OGW A;  4OVZ A;  4HKZ E;  1HZ6 A;  5FKA C;  1PDX A;  4CQN A;  4B95 A;  1WX7 A;  2QEJ C;  3VH3 B;  4ICV A;  5IAA C;  3EUB 2;  4G3X B;  4HCN B;  2LHD A;  2NTT A;  4UDU C;  5AZG A;  1G6J A;  1GNU A;  3VTW A;  1SB3 C;  3OG5 A;  5CHV C;  1EM7 A;  4MSM B;  2IO0 B;  4NAW B;  3Q69 A;  1J7B A;  3I63 C;  3NZU A;  2PVG C;  5G2N A;  3CWI A;  3ZUN A;  1CQV A;  2L76 A;  2FCS A;  2KFK A;  2YVC A;  2PIA A;  3AED B;  4BKS D;  1L0V B;  3AEE B;  4AOF A;  4YTM B;  3ZXV A;  4EOY A;  3ZXR A;  1NEK B;  2WXP A;  3NVZ A;  4YSX B;  1WXS A;  2KQ4 X;  3N30 A;  3TBL D;  2BKR B;  3P4R B;  3RNG C;  3M63 B;  4KIK A;  3QX1 A;  2JF5 A;  4NJ6 A;  1AWD A;  3HHM A;  4XGA B;  2KDM A;  2N9X A;  3VTV A;  3Q2A C;  4ZRI A;  1FD6 A;  1CK1 A;  1TBE A;  4WAA A;  3NZS A;  1MG8 A;  4WH4 A;  3QAQ A;  3KW5 B;  2ZNV C;  1C4P A;  1F1H A;  3W1S A;  5E6O A;  1KTK A;  4E3C A;  1D5M C;  2BWE S;  2SEB D;  3UI3 A;  4K3C A;  3W5V B;  2JWZ A;  2W9N A;  2LVO A;  3APD A;  3S2A A;  2RD0 A;  3UF8 A;  2W54 A;  5CX3 A;  1QOF A;  4AJW A;  3D32 A;  2K39 A;  2A5U A;  3H7S A;  1E8X A;  2BT6 A;  2HTM E;  3RNB C;  1VLB A;  1K52 A;  3AEF B;  3B08 A;  3QC8 B;  1GB1 A;  3AE5 B;  2L1A A;  1SJE D;  1I4G A;  1FXI A;  3P4Q B;  1Q10 A;  2N9L A;  3AE3 B;  1MHX A;  3R3M A;  4P16 A;  2BBC A;  3NS8 A;  2WXM A;  3MC8 A;  3UQA A;  1PYW D;  1YQ4 B;  3AU4 A;  1U4A A;  4EEW A;  4FHJ A;  3TEY A;  3R8B A;  4C4V A;  5FR6 A;  1XLO A;  2CJO A;  2QHO A;  4HPM B;  4OZC A;  5C3J B;  1VD2 A;  1WJ4 A;  2ZW0 A;  2IY1 B;  1TZO A;  3VDZ A;  3RZF A;  1P3Q U;  2IYD B;  1C4C A;  2KMC A;  3V6E B;  2VZK D;  3P4P B;  3H9D A;  2FUH B;  2ZJD A;  2GRI A;  1KFY B;  5FR3 A;  2N0S B;  2WX0 A;  1WE7 A;  5BO4 B;  3QJZ A;  3L08 A;  1S3S G;  3DHG C;  2B3A A;  1NYQ A;  2AQ1 B;  2ICI A;  3AEG B;  1P7F A;  2D5G A;  2KQS A;  3RMK C;  2ZPY A;  2IO3 B;  3IAM 1;  3ZRC A;  1T0S C;  3I5J C;  4KDI C;  4WQM A;  4MH8 A;  1V81 A;  1V5T A;  2FUG 1;  3ZDM C;  1N62 A;  4A9A A;  4JPS A;  2KDI A;  3DVG Y;  3B2G A;  4GXB A;  1WYW B;  2PE6 B;  2DX5 B;  4MM3 A;  3JSV B;  1XCQ L;  1WGG A;  1TS3 A;  1UZX B;  3QIJ A;  4FJV B;  2WXG A;  3DBH I;  2FE8 A;  4MAC A;  3DBL I;  2AL3 A;  2O6V B;  2KT7 A;  1NI2 A;  1X1M A;  4KSL C;  4S0R A;  2WDR B;  3NVY A;  2BYE A;  2JQR B;  1FEH A;  1YNT E;  2I1K A;  2KHW B;  4ANV A;  2O2V A;  2GMI C;  3QCA A;  2MJE A;  2AEH A;  3ML9 A;  3ZRF A;  2KN5 A;  1OQR A;  2W3S A;  5LXI B;  5KHQ A;  4BAX A;  2ZW1 A;  1LQB A;  1TGZ B;  2ACZ B;  2L0T A;  4WUR A;  2PMV A;  4GN1 A;  4ICU A;  1D5X C;  2LGI A;  3RNA C;  3L16 A;  3AE2 B;  3SEB A;  3VFK A;  4B9K A;  3GE3 C;  2L8J A;  2XK5 A;  3ZW3 A;  3KUZ A;  1LXD A;  2I38 A;  4W9H A;  3K9P B;  1V8C A;  2MCN B;  5IO9 A;  3L0W B;  4LDT B;  1LO5 D;  2GLS A;  2L52 A;  4XWW A;  2PW9 A;  3B1L X;  2J4X A;  2N1W A;  3OJ3 A;  4LTU A;  4GMV A;  2Q5W D;  3DVN V;  2BWF A;  5E6N A;  4DXF A;  3IHP C;  3BVG A;  1KLV A;  1LFD A;  4IC7 B;  4FXC A;  3LB8 C;  2AWT A;  3V3X A;  1GUA B;  2V3S A;  5AZH A;  3URY A;  5J2R A;  3SDL C;  2Y5P A;  3BYT B;  3DPD A;  4MJS B;  1FXA A;  1WXV A;  4M02 A;  4M0W B;  2O6V D;  2K9X A;  2LD9 A;  2G45 B;  1MFW A;  1FNV A;  3VTU A;  4MDK E;  1YX5 B;  2KK8 A;  1H8C A;  2LVQ A;  1TKG A;  4D2K A;  3Q8C A;  2MQJ A;  4WJO A;  4DHJ B;  2LWP A;  4A3O A;  1KF6 B;  2IY0 B;  4HRS A;  3OLM D;  1V1P A;  2GBK A;  4YWG G;  1NYR A;  3U4E G;  4G0N B;  2M17 A;  3ZNG C;  1WRD B;  1OEY J;  3U2S C;  2IGH A;  3EFU A;  5JZE B;  2WP9 B;  3KUD B;  3PT2 B;  1SEB D;  2L7R A;  1DOY A;  1WYG A;  2IO2 B;  1L5P A;  3DBL B;  1YQB A;  4BKG A;  3V05 A;  4LJO B;  1FFU A;  4PK1 A;  1WR6 E;  2REX A;  3AE7 B;  1EU4 A;  4GDK A;  3ZQ4 A;  5J17 A;  4EZJ A;  1EU3 A;  4BBN F;  1Y8R C;  4NJC A;  4HLE A;  4RF0 A;  3HVZ A;  2J53 A;  1E8W A;  2RR9 A;  2MRP A;  4W9G A;  3N32 A;  4HDO A;  3TEW A;  1P0R A;  4AUQ C;  4C80 A;  4N6E B;  1I4R A;  3T3N A;  5D3D A;  3ZJV A;  4C7Z A;  2WGS A;  3BYY B;  1IGC A;  1XCT L;  4RGO S;  4KZ0 A;  4A8X C;  1AYF A;  2BS3 B;  4C7Y A;  1KOT A;  2D07 B;  3NZ3 A;  2MBO A;  1QF6 A;  2LVP A;  1BT0 A;  2D3A A;  2R2O A;  2FID A;  1J7C A;  2WX1 A;  5EDS A;  4ACF A;  3WIM A;  2KWV B;  5JHA A;  3PZ8 A;  3DWM A;  3I9V 1;  4OW0 A;  5EE9 A;  2JRI B;  3CSF A;  1I4Q A;  3R66 C;  1C76 A;  1UBI A;  4N9F 4;  4O1N A;  2NMQ A;  1VCB A;  4F7Z A;  2Y5C A;  3PTF C;  4W9C A; 
#chains in the Genus database with same CATH homology
 2NPT B;  4HCN B;  4W9K A;  4BKS A;  1IYF A;  4ZRK A;  5AZG A;  3A1Q A;  1G6J A;  2JY6 A;  1GNU A;  1L7Y A;  3N3K B;  2KJR A;  3RYT A;  2DYB A;  2IO1 B;  2DHZ A;  3PVL A;  4X57 B;  3VTW A;  4CYE A;  4NJ7 A;  2KDF B;  2J7Q B;  1FXT B;  1YIW A;  2C7H A;  2KX3 A;  5CHV C;  3V61 A;  4MSM B;  2IO0 B;  2KZR A;  4NAW B;  3PRP B;  4JGH B;  3SHQ A;  3NZU A;  2ZVN A;  4M8N A;  5G2N A;  5CTR C;  2CU1 A;  2ZCB A;  4LJP B;  3ZUN A;  2L76 A;  2FCS A;  1T0Y A;  4I6P A;  4TUU A;  3PSE B;  3W1Y A;  2KFK A;  4LDT D;  1QZE A;  2YVC A;  4ANU A;  4DXA B;  4E74 A;  5DPW A;  4W9L A;  4BKS D;  4FAD A;  3RCZ A;  2NS5 A;  4AOF A;  1K8R B;  2KJH B;  4HPL B;  1E7U A;  2MWS B;  5LXH A;  4W9I A;  2JUO A;  1OEY A;  2MP2 A;  1WX9 A;  4EFO A;  4EOY A;  3DDC B;  1TZ1 A;  2R2Q A;  1UH6 A;  2K25 A;  2LAS A;  1WZ0 A;  3HIZ A;  3NOB A;  2IBI B;  2PPH A;  1WXS A;  1TTN A;  2N7D A;  2NBU A;  4URK A;  2PE9 A;  3QQ8 B;  3N30 A;  3TBL D;  2LGY A;  2BKR B;  3WA0 A;  3M63 B;  4KIK A;  4NY0 A;  3QX1 A;  2JF5 A;  3DCG A;  3GOE A;  2CHX A;  3X23 A;  4NJ6 A;  5CHW A;  3HHM A;  4XC2 A;  5AEK B;  2D10 A;  3PS6 A;  4XZ4 A;  2KFJ A;  5D2M B;  4ANW A;  2N9X A;  3VTV A;  3QAR A;  3PLV A;  2KC1 A;  2KVR A;  3AUL A;  4ZRI A;  4FHK A;  1KM7 A;  4FLH A;  1TBE A;  2LXC A;  4WAA A;  3NZS A;  1MG8 A;  4W9D A;  4DHJ D;  1D3Z A;  3ENE A;  4FA6 A;  5DCN A;  3QAQ A;  3KW5 B;  2UWQ A;  4EZK A;  1WE6 A;  2G4D B;  3ML8 A;  2ZNV C;  2WWZ A;  2KX0 A;  3PGE A;  3W1S A;  1UBQ A;  3A9J B;  3BY4 B;  1UEL A;  2FCM A;  1P1A A;  2OJR A;  1SIF A;  2D2Q A;  4DHZ B;  5E6O A;  2NR2 A;  2NBW B;  4E3C A;  1LM8 B;  3PLU A;  2BWE S;  1V9J A;  2K6Q A;  2ZPN A;  4HJK A;  4HK2 A;  1ZKH A;  1ZW7 A;  4EUT A;  2LRW A;  2DEN B;  2N1V A;  3UGB B;  1XQQ A;  3ZTD A;  2KWC A;  5IA7 A;  2BKF A;  3LJ3 A;  3Q3J A;  1WXA A;  3PV1 A;  2RPQ A;  5C1Z A;  4IM2 A;  2JWZ A;  2W9N A;  2LVO A;  3APD A;  3S2A A;  1P98 A;  1L2N A;  2RD0 A;  3UF8 A;  5CX3 A;  4FUL A;  4AJW A;  3ZO5 B;  3A9K A;  3WAM A;  3SD5 A;  3D32 A;  3JW0 X;  2K39 A;  2A5U A;  3H1U A;  3H7S A;  5L95 C;  1E8X A;  5TR5 A;  2K8H A;  3B08 A;  3QWZ B;  4NPN A;  3DBS A;  3QC8 B;  2ZEQ A;  1WIA A;  3UQB A;  3L10 B;  2ZZP B;  4MGI E;  3UIP B;  4I6L B;  2KTR A;  1J0G A;  2IZV B;  2GBN A;  2KO3 A;  2XK5 B;  4KVG B;  2JVC A;  3U8Z A;  4GDL B;  2LJ5 A;  3RUL A;  2O2V B;  1WR1 A;  3I3T B;  2KQ7 A;  2AYO B;  3KUC B;  4ZRJ A;  3R3M A;  2KD0 A;  1WGH A;  2WYQ A;  4TQ1 A;  3NS8 A;  1AAR A;  4JL9 A;  4HDQ A;  4G50 A;  2M0X A;  3APC A;  4TKN A;  1E8Z A;  3MJW A;  3ALB A;  3BIN A;  3PRE A;  3KVF B;  3UQA A;  3AU4 A;  4GDL A;  4MEM A;  3ZTC A;  1U4A A;  2G3Q B;  3VUY A;  4EEW A;  2MLB A;  3HM6 X;  2L05 A;  2MBQ A;  3IBE A;  4FHJ A;  5FR6 A;  4K7S A;  1J19 A;  3TIX A;  1RAX A;  2QHO A;  2DAJ A;  4HPM B;  4IG7 B;  4MJS A;  1VD2 A;  3H7P A;  1WJ4 A;  3JSV A;  1WH3 A;  4IW0 A;  2KLG A;  3PHX B;  2IY1 B;  3ZNH B;  4MGZ E;  4CO7 A;  3VDZ A;  3RZF A;  4TQ0 A;  3ZVV A;  1P9D U;  2XBB C;  1JRU A;  4PS8 A;  4PS3 A;  1P3Q U;  2LUE A;  3RZW C;  2IYD B;  3AU5 A;  2GBR A;  2JZ3 B;  4A3P A;  2KMC A;  4BFR A;  3VUW A;  4GIV A;  3ONS A;  3OAW A;  1NDD A;  1V86 A;  2KDE B;  3V6E B;  2DAF A;  3ZNZ B;  2WDT B;  3H9D A;  2FUH B;  2ZJD A;  5AZF A;  3EC8 A;  3QK0 A;  4ZYN A;  3LDZ E;  1V6E A;  1WGD A;  3ZLZ A;  2J0M A;  2Z59 B;  3NHE B;  2EMS A;  4WJN A;  2N4F A;  4WWN A;  2KNB A;  1Q1O A;  2WX0 A;  1WE7 A;  3NY5 A;  2L00 B;  5BO4 B;  3QJZ A;  3L08 A;  1S3S G;  2N9P C;  1SGH A;  2B3A A;  2BYF A;  2PEA A;  4GDK B;  2KQS A;  2UYZ B;  1J8C A;  1YD8 U;  4ANX A;  2ZPY A;  2HJ8 A;  2ZNV B;  2IO3 B;  2OOB B;  3ECI A;  4I6N B;  3A33 B;  4WQO B;  3ZRC A;  3VH4 B;  3WAL A;  2MBB B;  4KDI C;  5DPR A;  1WGY A;  3V6C B;  3QHT A;  4BVU C;  3ZDT A;  1V81 A;  1V5T A;  5HKH A;  1PQS A;  2YLM A;  2KLC A;  1E90 A;  3T9L A;  3WAP A;  3X0W A;  3ZDM C;  3GZN I;  2NCN A;  2PJH A;  3TCA A;  4P7I A;  2KDI A;  2KWU B;  3DVG Y;  2CHZ A;  4GXB A;  1Q5W B;  5KHO A;  1WYW B;  2BGF A;  2PE6 B;  2KKC A;  2D3G A;  1E8Y A;  2KOX A;  4FJZ A;  2KTR B;  2DX5 B;  4JQW C;  1XT9 B;  2BF8 B;  3PHW B;  4BBN C;  4IM0 A;  1GJZ A;  2CR5 A;  2LGX A;  2M8S A;  4MM3 A;  2K8B A;  1WGG A;  2RGF A;  2GBJ A;  1UZX B;  3H7P B;  3JSV B;  1S1Q B;  1WM3 A;  3QIJ A;  4FJV B;  4IWO A;  2J0J A;  2FNJ B;  3DBH I;  2ASQ A;  3DVG X;  4KSK C;  3DBL I;  3ZKJ C;  2AL3 A;  2O6V B;  4DHZ E;  1NI2 A;  1X1M A;  1GC7 A;  1V5O A;  3HM3 A;  3UIN B;  1ISN A;  4KSL C;  1KJT A;  2HE7 A;  4KV2 A;  4KDL B;  2BPS A;  4E71 A;  4HVB A;  2EMT A;  2A4Z A;  2N7E A;  2BYE A;  2K8C A;  4WJP A;  1WJU A;  3W1S C;  2RSU A;  2I1K A;  4K81 A;  2KHW B;  1WGR A;  1WZ3 A;  3P2B A;  2MBH A;  4ANV A;  2O2V A;  2GMI C;  3QCA A;  2N9E B;  3JYU A;  3M62 B;  1IP9 A;  1E5W A;  4B6W A;  2AEH A;  2JXX A;  3ML9 A;  3PRM B;  3ZRF A;  2KN5 A;  4DBG A;  4J6I A;  1R4N I;  5LXI B;  5KHQ A;  1Z5S B;  4ASW C;  1LQB A;  3APF A;  3IVF A;  4K7U A;  1TGZ B;  2L0T A;  3TJP A;  2NPT A;  1EF5 A;  4ZDV A;  2KC2 A;  3MTN B;  3A4S C;  4GN1 A;  4ICU A;  5D6J B;  2DZK A;  4DDI D;  4HXD A;  3B0A A;  3H6N A;  3L16 A;  3VFK A;  4B9K A;  3RD2 A;  2K1F A;  4M8M A;  2C7M B;  2L8J A;  2KJ6 A;  2XK5 A;  4PYZ A;  4GB9 A;  4OVU A;  3ZW3 A;  4DWF A;  2KXJ A;  3PRZ A;  3KUZ A;  3L54 A;  1WMH A;  2XEW A;  4W9E A;  1YJ1 A;  1LXD A;  3L13 A;  4AP4 C;  2FIF A;  5D7G A;  4EKU A;  1H4R A;  1V49 A;  2LI5 A;  1SE9 A;  4G11 A;  3OJ4 B;  4WWP A;  2KDB A;  4W9H A;  3K9P B;  5E6P A;  2MCN B;  4DDG D;  4F8C B;  2ZCC A;  1CMX B;  4F1S A;  3L0W B;  4K1R B;  4LDT B;  2M1M A;  3TMP B;  4RM9 A;  3PZD A;  2L0F A;  1WMH B;  4PS7 A;  3B1L X;  2C5L C;  3MHS D;  1UGM A;  2N1W A;  3O65 B;  3OJ3 A;  4NNJ B;  3VUX A;  4GMV A;  5DPT A;  2I1J A;  3UIO B;  4LCD E;  3DVN V;  2BWF A;  2JRH A;  2LZ6 A;  4IUM B;  4YL8 A;  5E6N A;  5L83 A;  3VXW A;  1RRB A;  1C3T A;  3IHP C;  4IWP A;  5CHF A;  1Q0W B;  1KLV A;  2MBE A;  2L3Z A;  1LFD A;  3Q3F A;  5DPS A;  4IC7 B;  4FN2 A;  2AWT A;  5LLI A;  1WJN A;  1GUA B;  3AI5 A;  2NVU I;  1GG3 A;  2V3S A;  5AZH A;  1I42 A;  5J2R A;  3SDL C;  1V80 A;  1M94 A;  1WF9 A;  1Z2M A;  3DPD A;  4KIK B;  4MJS B;  3EEC A;  1I35 A;  1WXV A;  1C1Y B;  2CHW A;  4M0W B;  2O6V D;  2LD9 A;  3ZIM A;  2JPH A;  2G45 B;  3DBR I;  1UD7 A;  3A1Q B;  4TV3 A;  3L17 A;  3V62 A;  2FCN A;  5D94 A;  4FBJ B;  2M4N A;  3M95 A;  2DYM A;  3A9K B;  4II3 B;  2GOW A;  3VTU A;  4MDK E;  3VAW A;  1YX5 B;  3KYD D;  2HTH A;  1GC6 A;  1ZGU B;  2KK8 A;  4BOZ B;  3JVZ X;  1H8C A;  1EF1 A;  2LVQ A;  3C0R B;  3SU8 X;  3KH0 A;  4RMA A;  2BYV E;  2LGD A;  4MGK E;  3QA8 A;  5G55 A;  2MQJ A;  1OQY A;  2VRR B;  4WJO A;  3RT3 B;  4DHJ B;  2LWP A;  1RFA A;  2KAN A;  4A3O A;  2IY0 B;  1HE8 A;  1EUV B;  3HK0 A;  3OLM D;  2FCQ A;  2V1Y A;  4NQK E;  4W9F A;  1RLF A;  4EZL A;  4JIO U;  1YX6 B;  2GBK A;  2G4S A;  3ZNI D;  4GGQ A;  4G0N B;  2M17 A;  3DQV A;  3ZNG C;  2ZVO A;  1WRD B;  1WI0 A;  2NBV B;  1OEY J;  1WM2 A;  4IWQ A;  4NAW A;  1WXM A;  4IM3 A;  4JLC A;  1WY8 A;  3EFU A;  5JZE B;  2K6D B;  2Y5B B;  3KUD B;  3PT2 B;  4WWO A;  3U30 A;  3WAN A;  3CMM B;  1WJ6 A;  2KFK B;  2L7R A;  3R7Q A;  2DZJ A;  4K7W A;  1XD3 B;  2IO2 B;  4GU2 A;  1YQB A;  3VQI A;  1E7V A;  4BKG A;  5GMV A;  3DVN U;  1IPG A;  2D11 A;  1EO6 A;  3KYC D;  4LJO B;  1WR6 E;  2REX A;  2J0K A;  2LRU A;  4DK5 A;  3AXC A;  2GBM A;  3EHV A;  4GDK A;  2MA9 B;  4WJQ A;  2DZM A;  4EZJ A;  5J17 A;  5J18 A;  2O6V A;  3DOW A;  3R7R A;  4BBN F;  4MSQ B;  3V60 A;  1WFY A;  4KZC A;  1Y8R C;  4A20 A;  1R4M I;  2AL6 A;  3VHT C;  2CKH B;  2FAZ A;  4HCP B;  4HLE A;  2MX2 A;  3U7D A;  2CS4 A;  2C7N B;  1E8W A;  2RR9 A;  3K9O B;  4MGY E;  2MRP A;  5JH5 C;  2LXA A;  4RM8 A;  3N32 A;  4W9G A;  4HDO A;  4NQL B;  3CST A;  2KMA A;  2HD5 B;  4HWI B;  2JZZ A;  1P0R A;  2DYO A;  4AUQ C;  2C9W B;  4MEL A;  1OTR B;  4FJY A;  3IFW B;  4BOS C;  4GSW A;  2Z0E B;  3PPA A;  4GOC A;  1NBF C;  2MP2 B;  4II2 B;  4KZ0 A;  4MH0 E;  3M3J A;  2MSE D;  4PYU A;  1KOT A;  2MW5 A;  4AJY B;  2D07 B;  2MBO A;  3TL5 A;  4AWJ A;  2V4L A;  2C60 A;  1BT0 A;  2LVP A;  4BKT A;  2R2O A;  3IG3 A;  3T8M A;  2FID A;  3A9J A;  2WX1 A;  1OGW A;  5EDS A;  2KTF A;  4XX5 A;  3A4R A;  4OVV A;  1V2Y A;  3WIM A;  3CF6 E;  5JHB A;  2KWV B;  5JHA A;  3WAO A;  4CHK A;  2JRI B;  1A5R A;  2JT4 B;  2Z0D B;  5C23 A;  4B95 A;  1WX8 A;  1F9J A;  3CSF A;  1WX7 A;  3R66 C;  3VH3 B;  1UBI A;  3RUI B;  2DZI A;  4N9F 4;  4W9J A;  4ICV A;  3VVW B;  1VCB A;  4W9C A;  5IAA C;  4F7Z A;  2EKE C;  3PTF C;  4G3X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...