2JRKA

Nmr structure and epitope mapping of blo t 5
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
112
structure length
112
Chain Sequence
b'KKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mite allergen Blo t 5
publication title Nuclear magnetic resonance structure and IgE epitopes of Blo t 5, a major dust mite allergen
pubmed rcsb
source organism Blomia tropicalis
molecule tags Allergen
total genus 34
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2007-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.970 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2jrkA00
2JMHA 2LM9A 2JRKA
chains in the Genus database with same CATH superfamily
3PUQA 2UXNB 2V26A 3AE1A 5JH7E 1YKHB 1QUUA 5FP3A 2BBJA 2ZMAA 5L2LA 1Y01A 5FY1A 4CI1B 5JRCA 3R84B 4CXXA 4JI4T 4ZOLE 3LBXA 2B1EA 4CN6A 4IE6A 3PU8A 4TZ4C 2YDRA 3ESLA 3B57A 3ZT6A 3C4ZA 5DQWA 2QRXA 1FMWA 2NR4A 4AKRB 4F8HA 2DWGA 4Z91A 3ZJ1A 2P9BA 4KMCA 3N5LA 4JYAT 2SPCA 1UGOA 3UUBA 4QH1A 4K0KT 4OK0A 4Z8XA 4U7IA 5JDQA 2E9XC 3GN5A 4KBMB 4U7YA 3P8CD 2Y6XA 5FNVE 3ETVA 3CK6A 2QA7A 2N2NA 4X1YE 1J5ET 1I94T 3QB5A 3UU4A 2X66A 5AQMB 4QXCB 3UQ7A 2WB5A 3TLWA 5CFBA 2ZLYA 4I4TE 5AQPB 3NZQA 1U4QA 3BQKA 3QNUA 2WZIA 2KWIB 2C5JA 1CHUA 4DNDA 4LMKA 3SFEA 5EK2A 2V7IA 2K24A 5LYJE 3RQWA 1IZNB 5AQOB 4QWNB 2X51A 3KBTA 2E9XD 3BQLA 3MZKB 2ACXA 3I9WA 2K48A 2XQ4A 2BDEA 2OLTA 3A5XA 3PJAJ 2XQYA 3PUWF 1X79A 3ANWB 1ZOYA 4EYUA 4YFSA 4IGUA 3N9MA 2N9DA 5ADXL 3EUHA 3KV6A 1BR2A 3LK2B 3GA8A 4ZS2A 5HEJA 1Z0PA 5KMGP 5FXZA 2X0YA 2DWKA 2VQFT 3T1YT 2VURA 3FXDB 2OA5A 4A97A 2ACZA 2UXDT 3JC6D 2VASA 4UF0B 3AE8A 2XM2A 3P4RA 2IDOB 4UIGA 3O4XE 5DABA 3DJBA 3AVSA 3MACA 4NPPA 3X1DA 2J1DG 2CXDA 2KXPB 3AE3A 5JREA 2H7VC 2LHNA 2DI4A 4GIWA 3B13A 2JQKA 3KINB 2BS3A 2XQ3A 1D1AA 4DV2T 4CI3B 1MIVA 4I43B 1HFAA 2XAJB 3EDVA 1D0YA 2JMKA 1QSDA 3KV4A 4P0BA 3EHZA 3NVOA 4JI5T 2IC9A 2YN6A 3RGLA 3LK3B 1SA0E 4A5XA 4ZHQE 1HTJF 2YDQA 3PUVF 3RIUC 2XQ9A 4V1Av 2WU2A 3ONLC 2UUBT 2CBJA 5AQQB 1HF8A 2LOSA 1WR6A 2Q9QB 4ZI2D 3RX6A 4OYKA 3GWHA 3ONJA 3E0ZA 2XAGB 1UX4A 4JEUB 1S94A 3AAEB 1OEDC 4HFVA 3RQUA 3SRZA 4X66T 3DP7A 3L3PA 4DMVA 1OWAA 5AQKB 3AVRA 5ABFA 3K8PC 4HFIA 3RIAA 5J0ZA 4J2CA 1W9RA 1N33T 2D0TA 3ZKRA 5JTGA 3PU3A 2VQET 3D0TA 5CGMA 4HE8A 4L0RA 3VHLA 2CLYC 2BBHA 3UU6A 3C4WA 3KVAA 3MJXA 1XNQT 3RRCA 2QVAA 1UK5A 5F3JA 3M65A 5EK3A 5H6RB 2MYSA 4ANJA 3O1HA 3TLTA 4YTMA 4ZI3C 2CM0A 1XMOT 4OYJA 3VKGA 4QX8B 2V6YA 1VCSA 4YJ2E 1KNZA 3HKBE 1B7TA 3Q5XA 4IE7A 4P1NA 2KT9A 2L9QA 3P4QA 3FBZA 3N9PA 3KV9A 1MMGA 1HS7A 3HKDE 3AA6B 2WSSV 4X1KE 4AQYT 1XWMA 2BS2A 5L3BB 2K5BB 2E5VA 1YQ3A 4OHFA 2RP4A 3DTOA 5HWYA 3R6NA 3Q5DA 4ZI3D 1D1BA 3QB5K 2IAKA 2NP9A 5LG4A 2LSJA 3FZFB 4NXMT 3N2KE 5AQRB 2AE9A 5JQGE 4IE4A 4DO0A 3T1HT 4GKJT 1T8BA 4MALA 4TWHA 2V8SV 3RKGA 4YY3T 3MK7C 5HAXA 4COFA 2WWUA 4M1PA 4ERRA 2E9XB 3PV0F 3LFMA 1IJ5A 2UUCT 5JR9A 3JAFA 4X65T 3JCFA 3TLVA 1HR0T 2MPKA 1ZP0A 2UXCT 2A72A 2KNDA 2IIUA 3E08A 4BA9A 4XAXB 5LGUB 2LRLA 4IDPA 4ILCA 1QLBA 2BKPA 2DL1A 3HKEE 5C3JA 3F31A 2W2UA 4K0UA 1SHZC 3RIFA 4Q25A 2XM1A 4DV4T 4BJNA 1VOMA 3C4XA 4PAGA 1HG5A 3RYCE 4H63V 3HKCE 3RYHE 2XAQB 3AE2A 1YKEB 5L3EB 3TLSA 1W09A 2GK9A 4DMWA 2A3DA 4KUMB 4IL4A 2Q9QC 5IUXA 4YLHA 4DVDA 5E0OA 4UEMA 2B76A 3V5SA 1AJ3A 2ES0A 2KWHA 2V6XA 2VL8A 4B6XA 3ZC1A 2XQ6A 5LHIB 1HG2A 1YW0A 4B3TT 4AQGA 2XJ7A 2CHNA 2EHOA 3H37A 4H9RC 3SS1A 1BR4A 2VKJA 3OTOT 2YKSA 2VK9A 4WNKA 2H89A 4I55E 3AE5A 4YSYA 3H3AA 2W66A 4MFRA 4KHZF 5ABGA 2NW9A 2L8KA 4LF8T 4U3CA 4O8SA 2AXDS 4WYVA 4CXYA 2H3RA 4DR1T 3OYXA 4LF9T 5JDLA 4PNIA 4YJ3E 3CQCB 1L0VA 1SE7A 3O1IA 5FVLA 5FY7A 2BG9A 3G06A 3FBLA 3CX6B 5L3GB 4E7ZA 2ZM2A 3C98B 2MOZA 4PJJA 3UFEA 4YHHT 4OX9T 4AXPA 2LEHA 3FZMB 3C64A 4JV5T 2H88A 3AE9A 1NWMX 3CKDA 3JADA 4HKAA 2KLQA 2W62A 3M3ZB 5LB7B 3L09A 4GK5E 4IDOA 3PUYF 2ODUA 1KEYA 1OEDB 4O2AE 3QC9A 3RKOA 1VCTA 4NUVA 2X0HA 2W00A 4HTEA 3CX8B 3RYIE 4NXNT 3LG7A 2XUEA 4WBOA 3Q2MA 4UV9B 4TNWA 4HWFA 3RRWA 5HXCA 2PJQA 3OBVE 3AAAB 3AXJA 4AIUA 4BJMA 3RPUA 3EVYA 2CLYB 2IC6A 2LSYA 4FJOA 1YXRA 4EEBA 4H63H 2ZM6T 2K9AA 2WY2A 3JC6C 3SWHA 2IHR1 5HYAA 3K3OA 2V7JA 4AI6A 4FI5A 3ZN0B 2XQ8A 3IEEA 4X5TA 3LDQB 3AEFA 4PJMA 4X62T 4GOUA 5JRCB 5FMNA 4ZI7E 3LBXB 3J7Yq 4MHCA 4H9NC 5LJMA 2XPKA 3CPZA 3Q9DA 4HWCA 3CVRA 3IHRA 2VL0A 2VB6A 4P09A 3SFDA 1BR0A 4XBFB 1EZ3A 4BAYB 5HEGA 2JPFA 3PUXF 1GQEA 2JQQA 4GYSA 2BKNA 3UUNA 1JNRA 4TV9E 2WDQA 2WDVA 3ZLIA 2E8IA 1LRZA 2C5KT 4IDZA 4L9IA 3IBPA 3ZJ2A 1N34T 4E7SA 3GN5B 3ZEFB 5HEUA 2VVSA 3OPCA 4G63A 5F5WA 3LSVA 1FMVA 2WZHA 4WZXA 2X67A 3IF8B 4TV8E 3FXEB 2XQAA 4CQIA 3NZPA 3JAEA 4ZI2C 3F57A 3OYZA 3UUXB 5J1GA 2K3WA 5AQHB 2NOXA 4EIWA 5C2TA 2PTFA 2NTYA 4QXHB 4X20E 2LE8A 5LBQB 4HEAA 1H7CA 4QX7B 3PUZF 2CWOA 5KDMC 4DR4T 2YU1A 1KNPA 3L8RA 2XAHB 2YINA 5HWXA 2HN2A 2IUBA 3H3MA 2CXLA 4DV5T 3P4SA 4IL9A 1M62A 3LJCA 4DR5T 4JI8T 3Q5EA 1XDOA 3N9LA 2BG9E 2X9XA 1XMQT 1IAPA 2LM9A 4UVAB 3MXZA 5KXJA 2XQ5A 1JNZA 3HL6A 4AQFC 2YDSA 3LK42 3TLUA 2WP9A 4DR3T 3AE7A 5LNKA 3CX7B 2WQYA 4HFCA 4LF4T 2F4VT 1W0BA 4UV8B 4HWHA 3I0OA 4JBWF 3S4UA 3J9X1 2BKOA 4HWIB 4LF6T 4KX6A 5L4EA 1NEKA 3UULA 2D0UA 2IW5B 4U2YA 4ILBA 2W67A 2FJDA 2LSKA 4I50E 3CQGB 5L3FB 3UTKA 2EHOD 5IYZE 2LSIA 3RYFE 2V7LA 1X9BA 5LA6E 4A98A 2J62A 3FZLB 5JDHA 3ETUA 4H9OC 4PJNA 5EK4A 2L3LA 3NRYA 5DQVA 2M6BA 1M7KA 3ZYKA 3UFGA 2WMNA 2XAFB 5LHGB 2Z6EA 2E2AA 4EB6E 5AQIB 1G8XA 2X68A 2CMRA 2RA1A 2ZM8A 5AQGB 2WCAA 2DLRA 4QH5A 3UU5A 3ZMSB 3ZMVB 4IHJE 4DR2T 3I0QA 4PK5A 3ZT7A 2HH7A 4PK6A 4TX5A 4JI7T 4H9SE 2LLYA 3EABA 4ILUA 3PUAA 3AAIA 5AQVB 3PE0A 3A8YC 3RH3A 1LVKA 5AFUL 4EZHA 3CIRA 3QK6A 4ZZCA 3ZPOA 4IT4A 3NKZA 3W15B 2JRKA 3N2OA 4LFAT 2JQ9A 4IDQA 2XTLA 2KSRA 5AQTB 3EI0A 2XQ7A 5L3CB 1MIWA 3FB2A 3PURA 3N9NA 1T72A 5IWAT 2WBLA 2G0UA 4HN9A 3EDUA 5CJ5A 2XSAA 2ODVA 4ZS3A 5LG3A 1MMDA 2VKOA 4HFEA 5L47A 4JI2T 3F2EA 3AEBA 4LFBT 4HFDA 4UXNB 2LSGA 2V6YB 2DCFA 2BS4A 2W4XA 4AKIA 2VKDA 4HFHA 5GONE 4O4LE 1WR0A 2CWYA 3RIUA 2NW7A 2I59A 1HX8A 1IJ6A 4P0AA 4ZZBA 5LHHB 4DIDB 2KMFA 2CEAA 5ABHA 3P50A 3VKHA 4JEHB 1T7SA 5LJNA 3AE4A 1WLXA 1N36T 1MMNA 1KF6A 4CI2B 4YSXA 1OEDA 2V1DB 4C91A 1G73A 3IA3A 3OVUA 3WAJA 1FJGT 1KK7A 2BVMA 4JI0T 3P7IA 3KVBA 2UU9T 3UT5E 4JI6T 4CZZB 5JR9B 4B3RT 5BR8T 3ABVA 2R6GF 4DUYT 3AEAA 5FKYA 4AKLA 2YEVC 5JVDE 5FXVA 4U31A 2D9DA 2C5IT 2YU2A 4TWDA 1WYBA 2BZBA 1WFDA 1V9DA 2CHOA 1IBKT 2FJAA 3ANWA 2X9YA 3I9YA 2M6IA 4PW8A 1KNRA 4GYRA 4B3MT 4UELA 3OJAA 4ADZA 1W0AA 4HWDA 5LMUT 4PJLA 1U5PA 4GKKT 2HN1A 3EAMA 1UCUA 3RI5A 4QKNA 5LGNB 3K3QC 3NRXA 2DNXA 4KI0F 4UF0A 2E5LT 4EXTA 3AEDA 2W63A 5FXWA 1BR1A 4NUUA 4WW0A 1HCIA 3OKQA 4TN7B 1YD8G 1R8IA 1D0XA 2EHOB 1S35A 5H6QB 4EV6A 3RC3A 3MA9A 2D2SA 3K3NA 1J5WA 2XZEA 3B5MA 4ZXLA 5HCJA 2LOPA 5FXXA 3P4PA 3MKDA 4TUYE 2WU5A 5ETWA 3AA1B 4DUZT 2ZM0A 1WRDA 3UU3A 4EOZB 3CMLA 3T8OA 2J47A 2KINB 1HNWT 2PFVA 4L5GA 5JDFA 1XNRT 4HGAA 4H9QC 3V5UA 1I6ZA 4PK4A 5J2TE 2BG9B 4PFOA 4B3ST 3ZC0A 2LT3A 1NENA 1MNDA 4QHOA 5LP6E 5EZYE 2Q9QA 2X9HA 5HCMA 2CPTA 4O2BE 5LMNT 5JDNA 3ZSSA 4F6RC 3AECA 3VRBA 4IDNA 1HNXT 4C90A 2YK0A 3E22E 5FL0A 2MAWA 3AB3B 4TNVA 1UURA 3BK9A 3CQXC 1E1HB 4IREA 2V7MA 1ZHCA 1D0ZA 3RHWA 5LXTE 1KFYA 2M67A 5CA0E 2MTQA 3QUJA 1FEWA 3HI2A 1UUSA 4UVCB 2HPLA 2CRBA 3KFWX 5JR9C 4DV0T 2LJLA 3L39A 4O4JE 2JQHA 3C50A 4MBQA 5JDGA 2CXFA 5IHYA 4YTNA 4U2ZA 2XY8B 3RC8A 2WMOA 2Y8DA 5F8PA 2HPJA 3AXJB 1OEDE 1E7PA 5JDMA 3ZMUB 5CB4E 1ZV4X 4DBRA 1LKXA 3RF1A 2YOEA 4CN4A 3UQ4A 1SUMB 4LF5T 2H7OA 5LBMA 4IE0A 2JIWA 4I0UA 5FY0A 3FHNA 4UR9A 1US7B 2NW8A 4QXBB 4IE5A 2LHRA 5A1LA 3QOFA 3VRAA 2UXBT 5AQNB 3PJAA 2FJEA 1IBLT 2CBIA 4LFCT 1IBMT 2XASB 5CA1E 3ZYLA 4YTPA 1HX1B 2V5DA 3KV5A 3N2GE 1YQ4A 4EYYR 1Z8UA 2VWAA 4Z90A 1CUNA 4DV6T 4DBQA 2C0SA 4KHPT 2EHOC 4DR7T 4X64T 2E9XA 3KDSE 4ISTA 3AE6A 2RPAA 5J2UE 2BVLA 3ZN1B 4YHJA 3AA7B 2QGSA 4YSZA 3ZMZB 5ABEA 3HR0A 2LKGA 3FZKB 2UXXB 4UVBB 5FL1A 4DV3T 4EAHA 1Y64B 3ONXA 3AEGA 3PUGA 2PBIA 2UUAT 1MMAA 4TWFA 4DV1T 3O1JA 4JI3T 2WS3A 3BQIA 4GK0E 3U3IA 5M4YA 2Y48B 3PUSA 2BG9C 3ZT5A 3A7MA 2FUPA 4O4IE 2LM2A 3NWIA 2CE7A 1XZYA 5HXRA 1N32T 1E2AA 1DU2A 2LRKA 2JMHA 2NTXA 3PDYA 2A2FX 1O3XA 2PG8A 4NIQA 2LKHA 1NAFA 1UX5A 3WI3A 4U72A 4G2AA 5FYMA 1ZKEA 4KP3C 5AQFB 5L4HA 3ZCIA 2HHHT 3SOLA 3TKLB 4AISA 2W0GA 4PFPA 3VU7H 1T98A 4DV7T 3FZHB 4AKGA 3P4WA 3ZMTB 4IIJE 4EGWA 5BMVE 4A56A 4ILAA 5L3DB 3C51A 3ZYMA 4XZCA 5TAOA 4AKHA 2WM9A 4LF7T 5ABFB 4YXDA 2A9UA 2NWBA 2CCQA 5C8YE 1LVFA 3HA4A 4MLKA 3K1SA 5AQLB 3N9QA 4H9PC 2JJ9A 4HFBA 5AQUB 4OFZA 2I6HA 2WWVA 4LMLA 3U78A 5HXHA 2J4GA 2MBGA 3AA0B 5LCYA 4YT0A 3ZSTA 4U74A 4JLEA 5LOVE 2XSBA 1MIYA 4CN1A 4CXWA 4LMJA 3WAKA 2FJBA 5AQSB 2WDRA 1HNZT 3VR9A 2DHRA 4ZEYA 4U33A 2W61A 3N9OA 2D5UA 2VKHA 2V7KA 5HEOA 2OV9A 3UUMA 2CA5A 3ZCJA 3CWZB 4WBNE 1VRBA 5HEHA 2X9WA 4JI1T 2WAUA 1FIOA 2X0LB 2FBWA 1WYCA 3KBUA 3GMIA 3NBXX 4ISSA 4AQFA 3Q5WA 3I1AA 2N1GA 2IMLA 4DR6T 5FVKA 5KX5E 4O4HE 2Q9QD 1WCRA 1D1CA 4JUYA 3VR8A 2XHEB 2KZ7B 1MNEA 5LGTB 5HXEA 4ASKA 5HXSA 4X1IE 3AEEA 2I0MA 4QH4A 1ZEEA 1XDPA 3PTRB 3O9XA 2V5CA 4EEDA 1J1JA 3RLFF 5DJQC 1OXZA 4EZ4A 2QYWA 3UU8A 2VVNA 5AQJB 4N78D
chains in the Genus database with same CATH topology
3PUQA 3N9LA 2UXNB 2V26A 2A72A 5LP6E 5EZYE 2KNDA 2Q9QA 2X9HA 2X9XA 1IAPA 2LM9A 3E08A 4O2BE 4UVAB 4BA9A 3MXZA 4XAXB 5JDNA 1YKHB 5JH7E 4F6RC 1QUUA 5FP3A 5LGUB 3HL6A 2ZMAA 4AQFC 4C90A 5L2LA 2YK0A 3E22E 3LK42 3HKEE 3F31A 5LNKA 3CX7B 3AB3B 4K0UA 5FY1A 4CI1B 1SHZC 5JRCA 3R84B 4CXXA 4ZOLE 4UV8B 3LBXA 2B1EA 4BJNA 3I0OA 4IE6A 3S4UA 1VOMA 3BK9A 1E1HB 3CQXC 3PU8A 2V7MA 3C4XA 3J9X1 4PAGA 3UULA 4TZ4C 1HG5A 1ZHCA 3RYCE 1D0ZA 2D0UA 3ESLA 3B57A 4H63V 5LXTE 2IW5B 3C4ZA 2M67A 3HKCE 3RYHE 5DQWA 5CA0E 2XAQB 2MTQA 3QUJA 1FMWA 1FEWA 1YKEB 3HI2A 5L3EB 4AKRB 2LSKA 4I50E 4UVCB 3CQGB 2HPLA 5L3FB 2GK9A 2DWGA 3KFWX 3UTKA 4DMWA 5JR9C 2EHOD 3ZJ1A 5IYZE 2P9BA 2A3DA 2LSIA 3RYFE 2LJLA 2V7LA 4KMCA 4O4JE 3N5LA 5LA6E 4MBQA 3C50A 4KUMB 5JDGA 2Q9QC 2SPCA 4YLHA 4DVDA 2CXFA 5IHYA 5E0OA 3RC8A 4OK0A 4Z8XA 4UEMA 5JDHA 3ETUA 3V5SA 5JDQA 4H9OC 4PJNA 2E9XC 2WMOA 2Y8DA 3GN5A 4KBMB 5F8PA 2HPJA 5EK4A 3P8CD 1AJ3A 2ES0A 2KWHA 2VL8A 2Y6XA 4B6XA 5FNVE 3ZC1A 3ETVA 2L3LA 3NRYA 5LHIB 5DQVA 2QA7A 1HG2A 5JDMA 2N2NA 1YW0A 4X1YE 3ZYKA 4AQGA 3ZMUB 5CB4E 1ZV4X 2X66A 3RRWA 2WMNA 4DBRA 2XAFB 1LKXA 2EHOA 3H37A 4QXCB 4H9RC 3SS1A 1BR4A 2ZLYA 5LHGB 2Z6EA 4I4TE 2H7OA 5LBMA 3NZQA 4EB6E 2VKJA 4IE0A 1G8XA 2X68A 1U4QA 2CMRA 3BQKA 2RA1A 2VK9A 2ZM8A 5FY0A 2KWIB 2C5JA 4WNKA 3FHNA 4DNDA 2DLRA 1US7B 4I55E 2NW8A 3ZMSB 3ZMVB 5EK2A 4IHJE 2V7IA 4QXBB 2K24A 5LYJE 1IZNB 3H3AA 4IE5A 2LHRA 3I0QA 5A1LA 4PK5A 4QWNB 2X51A 3KBTA 2E9XD 2HH7A 4PK6A 4MFRA 4TX5A 3BQLA 3MZKB 2NW9A 2L8KA 2ACXA 4H9SE 3I9WA 2XASB 2K48A 4ILUA 5CA1E 3PUAA 3A5XA 2BDEA 3ZYLA 3AAIA 2XQYA 3PE0A 1X79A 4O8SA 3KV5A 3RH3A 4CXYA 3N2GE 1LVKA 4EYYR 4EZHA 3ANWB 5AFUL 2VWAA 3QK6A 4EYUA 4YFSA 1CUNA 2H3RA 4IGUA 3N9MA 3ZPOA 5HXCA 3W15B 3OYXA 2JRKA 5JDLA 3N2OA 2N9DA 4DBQA 2C0SA 4PNIA 5ADXL 3EUHA 3KV6A 1BR2A 3CQCB 3LK2B 4YJ3E 3GA8A 3O1IA 2EHOC 4ZS2A 1Z0PA 2XTLA 5KMGP 5FXZA 2E9XA 3KDSE 4ISTA 5FY7A 2DWKA 5J2UE 5L3CB 2BVLA 3FBLA 3ZN1B 3FXDB 1MIWA 3FB2A 2OA5A 3PURA 3N9NA 3CX6B 5L3GB 4YHJA 2WBLA 3AA7B 2G0UA 2QGSA 4HN9A 3EDUA 3ZMZB 2ZM2A 3C98B 4E7ZA 2MOZA 4PJJA 2ODVA 4ZS3A 3UFEA 4AXPA 2LEHA 2VASA 3JC6D 3HR0A 4UF0B 1MMDA 2VKOA 3C64A 2UXXB 4UVBB 3F2EA 4UXNB 2LSGA 4EAHA 1Y64B 3ONXA 2DCFA 1NWMX 4UIGA 3CKDA 4AKIA 2VKDA 3O4XE 5DABA 5GONE 3DJBA 4O4LE 4HKAA 3PUGA 2CWYA 2PBIA 3AVSA 2KLQA 2W62A 1MMAA 3MACA 3L09A 4GK5E 2NW7A 2ODUA 3O1JA 2I59A 1HX8A 3BQIA 4O2AE 3QC9A 2J1DG 2CXDA 4GK0E 3RKOA 3U3IA 1IJ6A 5M4YA 4P0AA 2Y48B 5LHHB 3PUSA 4NUVA 2KXPB 5JREA 2H7VC 2KMFA 4HTEA 2W00A 4O4IE 3CX8B 2CEAA 2LHNA 2CE7A 2DI4A 5HXRA 4GIWA 3VKHA 4JEHB 3RYIE 5LJNA 3B13A 3LG7A 1WLXA 2XUEA 3Q2MA 4WBOA 4UV9B 3KINB 1MMNA 2JMHA 2NTXA 1D1AA 4CI2B 3PDYA 2A2FX 2PJQA 1O3XA 2V1DB 2PG8A 1MIVA 4I43B 1NAFA 1HFAA 1UX5A 2XAJB 3OBVE 4CI3B 3AAAB 3EDVA 4C91A 3WI3A 4U72A 1D0YA 2JMKA 4G2AA 1QSDA 1G73A 4BJMA 5FYMA 3RPUA 1ZKEA 3KV4A 4KP3C 4P0BA 3EVYA 2CLYB 3WAJA 2IC9A 3ZCIA 2IC6A 3SOLA 3TKLB 3LK3B 1KK7A 2BVMA 1SA0E 2W0GA 2LSYA 3P7IA 4PFPA 3VU7H 4ZHQE 4FJOA 1T98A 1HTJF 4H63H 3KVBA 4AKGA 4V1Av 3ZMTB 3UT5E 2K9AA 4IIJE 4CZZB 5BMVE 4A56A 5JR9B 3JC6C 3SWHA 5L3DB 3C51A 3ZYMA 1HF8A 2LOSA 3K3OA 4XZCA 1WR6A 2YEVC 4AKLA 5TAOA 2V7JA 5HYAA 2Q9QB 4ZI2D 4AKHA 4FI5A 5FXVA 5JVDE 3RX6A 4OYKA 4AI6A 3GWHA 3ZN0B 2WM9A 3IEEA 2C5IT 3E0ZA 2YU2A 2XAGB 2NWBA 2CCQA 1UX4A 1WYBA 5C8YE 1LVFA 4PJMA 4JEUB 1S94A 3AAEB 3HA4A 4HFVA 4MLKA 2BZBA 4GOUA 3N9QA 4H9PC 5JRCB 2JJ9A 1V9DA 5FMNA 3SRZA 4ZI7E 3LBXB 3DP7A 3ANWA 4OFZA 3J7Yq 2X9YA 3I9YA 4MHCA 3L3PA 4DMVA 1OWAA 4H9NC 5LJMA 3AVRA 3K8PC 3U78A 5HXHA 3CPZA 3Q9DA 4J2CA 4PW8A 3CVRA 3IHRA 4GYRA 2MBGA 3AA0B 2VB6A 4P09A 1BR0A 5LCYA 2D0TA 4UELA 3OJAA 4XBFB 1EZ3A 4ADZA 4BAYB 3PU3A 4PJLA 4U74A 2JPFA 3D0TA 4JLEA 1U5PA 2JQQA 4GYSA 5LOVE 4HE8A 4L0RA 3VHLA 3UUNA 2CLYC 4TV9E 1UCUA 3ZLIA 1MIYA 4QKNA 5LGNB 3K3QC 3C4WA 2E8IA 3NRXA 3KVAA 4CXWA 3MJXA 2DNXA 1LRZA 2C5KT 4IDZA 4L9IA 3IBPA 4UF0A 3RRCA 3WAKA 3ZJ2A 4EXTA 5F3JA 3M65A 5EK3A 5H6RB 2W63A 5FXWA 2MYSA 4ANJA 4E7SA 3GN5B 3ZEFB 3O1HA 2DHRA 4ZI3C 2CM0A 1BR1A 4NUUA 4G63A 4WW0A 1HCIA 2W61A 3N9OA 4OYJA 3OKQA 3VKGA 4QX8B 4TN7B 1YD8G 1FMVA 4YJ2E 1KNZA 2D5UA 2VKHA 2V7KA 2X67A 3HKBE 1B7TA 3IF8B 3UUMA 2CA5A 4TV8E 1D0XA 2EHOB 3Q5XA 4IE7A 3ZCJA 3FXEB 3CWZB 1S35A 5H6QB 3NZPA 1VRBA 2KT9A 2L9QA 3FBZA 3N9PA 4CQIA 4WBNE 3RC3A 4ZI2C 3KV9A 3F57A 3MA9A 3OYZA 1MMGA 2D2SA 1HS7A 3K3NA 2X9WA 3AA6B 3HKDE 2WSSV 4X1KE 3UUXB 5J1GA 5L3BB 2WAUA 1FIOA 2K5BB 2LOPA 2X0LB 2NOXA 4OHFA 5FXXA 4EIWA 2RP4A 3DTOA 1WYCA 5HWYA 3R6NA 3KBUA 4ZI3D 3MKDA 3GMIA 2NTYA 1D1BA 3NBXX 4ISSA 4QXHB 4TUYE 4AQFA 3Q5WA 3I1AA 2IAKA 3AA1B 5ETWA 4X20E 2N1GA 2NP9A 2LE8A 5LBQB 5LG4A 2ZM0A 2LSJA 1WRDA 4HEAA 1H7CA 3N2KE 4QX7B 2CWOA 5KDMC 5JQGE 4EOZB 3CMLA 4O4HE 5KX5E 4IE4A 4DO0A 3T8OA 2Q9QD 1D1CA 2KINB 2YU1A 2XHEB 2KZ7B 4JUYA 1MNEA 2XAHB 5LGTB 2YINA 4MALA 5HWXA 5HXEA 4ASKA 5HXSA 4X1IE 2CXLA 2PFVA 4L5GA 5JDFA 1ZEEA 3MK7C 5HAXA 3PTRB 4HGAA 3LJCA 3O9XA 2WWUA 4M1PA 4ERRA 2E9XB 4H9QC 3V5UA 4PK4A 5J2TE 3LFMA 4PFOA 3ZC0A 2LT3A 1IJ5A 5DJQC 1OXZA 1MNDA 5JR9A 4EZ4A 4QHOA 4N78D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMH A;  2LM9 A;  2JRK A; 
#chains in the Genus database with same CATH topology
 3PUQ A;  2UXN B;  2V26 A;  3AE1 A;  5JH7 E;  1YKH B;  1QUU A;  5FP3 A;  2BBJ A;  2ZMA A;  5L2L A;  1Y01 A;  5FY1 A;  4CI1 B;  5JRC A;  3R84 B;  4CXX A;  4JI4 T;  4ZOL E;  3LBX A;  2B1E A;  4CN6 A;  4IE6 A;  3PU8 A;  4TZ4 C;  2YDR A;  3ESL A;  3B57 A;  3ZT6 A;  3C4Z A;  5DQW A;  2QRX A;  1FMW A;  2NR4 A;  4AKR B;  4F8H A;  2DWG A;  4Z91 A;  3ZJ1 A;  2P9B A;  4KMC A;  3N5L A;  4JYA T;  2SPC A;  1UGO A;  3UUB A;  4QH1 A;  4K0K T;  4OK0 A;  4Z8X A;  4U7I A;  5JDQ A;  2E9X C;  3GN5 A;  4KBM B;  4U7Y A;  3P8C D;  2Y6X A;  5FNV E;  3ETV A;  3CK6 A;  2QA7 A;  2N2N A;  4X1Y E;  1J5E T;  1I94 T;  3QB5 A;  3UU4 A;  2X66 A;  5AQM B;  4QXC B;  3UQ7 A;  2WB5 A;  3TLW A;  5CFB A;  2ZLY A;  4I4T E;  5AQP B;  3NZQ A;  1U4Q A;  3BQK A;  3QNU A;  2WZI A;  2KWI B;  2C5J A;  1CHU A;  4DND A;  4LMK A;  3SFE A;  5EK2 A;  2V7I A;  2K24 A;  5LYJ E;  3RQW A;  1IZN B;  5AQO B;  4QWN B;  2X51 A;  3KBT A;  2E9X D;  3BQL A;  3MZK B;  2ACX A;  3I9W A;  2K48 A;  2XQ4 A;  2BDE A;  2OLT A;  3A5X A;  3PJA J;  2XQY A;  3PUW F;  1X79 A;  3ANW B;  1ZOY A;  4EYU A;  4YFS A;  4IGU A;  3N9M A;  2N9D A;  5ADX L;  3EUH A;  3KV6 A;  1BR2 A;  3LK2 B;  3GA8 A;  4ZS2 A;  5HEJ A;  1Z0P A;  5KMG P;  5FXZ A;  2X0Y A;  2DWK A;  2VQF T;  3T1Y T;  2VUR A;  3FXD B;  2OA5 A;  4A97 A;  2ACZ A;  2UXD T;  3JC6 D;  2VAS A;  4UF0 B;  3AE8 A;  2XM2 A;  3P4R A;  2IDO B;  4UIG A;  3O4X E;  5DAB A;  3DJB A;  3AVS A;  3MAC A;  4NPP A;  3X1D A;  2J1D G;  2CXD A;  2KXP B;  3AE3 A;  5JRE A;  2H7V C;  2LHN A;  2DI4 A;  4GIW A;  3B13 A;  2JQK A;  3KIN B;  2BS3 A;  2XQ3 A;  1D1A A;  4DV2 T;  4CI3 B;  1MIV A;  4I43 B;  1HFA A;  2XAJ B;  3EDV A;  1D0Y A;  2JMK A;  1QSD A;  3KV4 A;  4P0B A;  3EHZ A;  3NVO A;  4JI5 T;  2IC9 A;  2YN6 A;  3RGL A;  3LK3 B;  1SA0 E;  4A5X A;  4ZHQ E;  1HTJ F;  2YDQ A;  3PUV F;  3RIU C;  2XQ9 A;  4V1A v;  2WU2 A;  3ONL C;  2UUB T;  2CBJ A;  5AQQ B;  1HF8 A;  2LOS A;  1WR6 A;  2Q9Q B;  4ZI2 D;  3RX6 A;  4OYK A;  3GWH A;  3ONJ A;  3E0Z A;  2XAG B;  1UX4 A;  4JEU B;  1S94 A;  3AAE B;  1OED C;  4HFV A;  3RQU A;  3SRZ A;  4X66 T;  3DP7 A;  3L3P A;  4DMV A;  1OWA A;  5AQK B;  3AVR A;  5ABF A;  3K8P C;  4HFI A;  3RIA A;  5J0Z A;  4J2C A;  1W9R A;  1N33 T;  2D0T A;  3ZKR A;  5JTG A;  3PU3 A;  2VQE T;  3D0T A;  5CGM A;  4HE8 A;  4L0R A;  3VHL A;  2CLY C;  2BBH A;  3UU6 A;  3C4W A;  3KVA A;  3MJX A;  1XNQ T;  3RRC A;  2QVA A;  1UK5 A;  5F3J A;  3M65 A;  5EK3 A;  5H6R B;  2MYS A;  4ANJ A;  3O1H A;  3TLT A;  4YTM A;  4ZI3 C;  2CM0 A;  1XMO T;  4OYJ A;  3VKG A;  4QX8 B;  2V6Y A;  1VCS A;  4YJ2 E;  1KNZ A;  3HKB E;  1B7T A;  3Q5X A;  4IE7 A;  4P1N A;  2KT9 A;  2L9Q A;  3P4Q A;  3FBZ A;  3N9P A;  3KV9 A;  1MMG A;  1HS7 A;  3HKD E;  3AA6 B;  2WSS V;  4X1K E;  4AQY T;  1XWM A;  2BS2 A;  5L3B B;  2K5B B;  2E5V A;  1YQ3 A;  4OHF A;  2RP4 A;  3DTO A;  5HWY A;  3R6N A;  3Q5D A;  4ZI3 D;  1D1B A;  3QB5 K;  2IAK A;  2NP9 A;  5LG4 A;  2LSJ A;  3FZF B;  4NXM T;  3N2K E;  5AQR B;  2AE9 A;  5JQG E;  4IE4 A;  4DO0 A;  3T1H T;  4GKJ T;  1T8B A;  4MAL A;  4TWH A;  2V8S V;  3RKG A;  4YY3 T;  3MK7 C;  5HAX A;  4COF A;  2WWU A;  4M1P A;  4ERR A;  2E9X B;  3PV0 F;  3LFM A;  1IJ5 A;  2UUC T;  5JR9 A;  3JAF A;  4X65 T;  3JCF A;  3TLV A;  1HR0 T;  2MPK A;  1ZP0 A;  2UXC T;  2A72 A;  2KND A;  2IIU A;  3E08 A;  4BA9 A;  4XAX B;  5LGU B;  2LRL A;  4IDP A;  4ILC A;  1QLB A;  2BKP A;  2DL1 A;  3HKE E;  5C3J A;  3F31 A;  2W2U A;  4K0U A;  1SHZ C;  3RIF A;  4Q25 A;  2XM1 A;  4DV4 T;  4BJN A;  1VOM A;  3C4X A;  4PAG A;  1HG5 A;  3RYC E;  4H63 V;  3HKC E;  3RYH E;  2XAQ B;  3AE2 A;  1YKE B;  5L3E B;  3TLS A;  1W09 A;  2GK9 A;  4DMW A;  2A3D A;  4KUM B;  4IL4 A;  2Q9Q C;  5IUX A;  4YLH A;  4DVD A;  5E0O A;  4UEM A;  2B76 A;  3V5S A;  1AJ3 A;  2ES0 A;  2KWH A;  2V6X A;  2VL8 A;  4B6X A;  3ZC1 A;  2XQ6 A;  5LHI B;  1HG2 A;  1YW0 A;  4B3T T;  4AQG A;  2XJ7 A;  2CHN A;  2EHO A;  3H37 A;  4H9R C;  3SS1 A;  1BR4 A;  2VKJ A;  3OTO T;  2YKS A;  2VK9 A;  4WNK A;  2H89 A;  4I55 E;  3AE5 A;  4YSY A;  3H3A A;  2W66 A;  4MFR A;  4KHZ F;  5ABG A;  2NW9 A;  2L8K A;  4LF8 T;  4U3C A;  4O8S A;  2AXD S;  4WYV A;  4CXY A;  2H3R A;  4DR1 T;  3OYX A;  4LF9 T;  5JDL A;  4PNI A;  4YJ3 E;  3CQC B;  1L0V A;  1SE7 A;  3O1I A;  5FVL A;  5FY7 A;  2BG9 A;  3G06 A;  3FBL A;  3CX6 B;  5L3G B;  4E7Z A;  2ZM2 A;  3C98 B;  2MOZ A;  4PJJ A;  3UFE A;  4YHH T;  4OX9 T;  4AXP A;  2LEH A;  3FZM B;  3C64 A;  4JV5 T;  2H88 A;  3AE9 A;  1NWM X;  3CKD A;  3JAD A;  4HKA A;  2KLQ A;  2W62 A;  3M3Z B;  5LB7 B;  3L09 A;  4GK5 E;  4IDO A;  3PUY F;  2ODU A;  1KEY A;  1OED B;  4O2A E;  3QC9 A;  3RKO A;  1VCT A;  4NUV A;  2X0H A;  2W00 A;  4HTE A;  3CX8 B;  3RYI E;  4NXN T;  3LG7 A;  2XUE A;  4WBO A;  3Q2M A;  4UV9 B;  4TNW A;  4HWF A;  3RRW A;  5HXC A;  2PJQ A;  3OBV E;  3AAA B;  3AXJ A;  4AIU A;  4BJM A;  3RPU A;  3EVY A;  2CLY B;  2IC6 A;  2LSY A;  4FJO A;  1YXR A;  4EEB A;  4H63 H;  2ZM6 T;  2K9A A;  2WY2 A;  3JC6 C;  3SWH A;  2IHR 1;  5HYA A;  3K3O A;  2V7J A;  4AI6 A;  4FI5 A;  3ZN0 B;  2XQ8 A;  3IEE A;  4X5T A;  3LDQ B;  3AEF A;  4PJM A;  4X62 T;  4GOU A;  5JRC B;  5FMN A;  4ZI7 E;  3LBX B;  3J7Y q;  4MHC A;  4H9N C;  5LJM A;  2XPK A;  3CPZ A;  3Q9D A;  4HWC A;  3CVR A;  3IHR A;  2VL0 A;  2VB6 A;  4P09 A;  3SFD A;  1BR0 A;  4XBF B;  1EZ3 A;  4BAY B;  5HEG A;  2JPF A;  3PUX F;  1GQE A;  2JQQ A;  4GYS A;  2BKN A;  3UUN A;  1JNR A;  4TV9 E;  2WDQ A;  2WDV A;  3ZLI A;  2E8I A;  1LRZ A;  2C5K T;  4IDZ A;  4L9I A;  3IBP A;  3ZJ2 A;  1N34 T;  4E7S A;  3GN5 B;  3ZEF B;  5HEU A;  2VVS A;  3OPC A;  4G63 A;  5F5W A;  3LSV A;  1FMV A;  2WZH A;  4WZX A;  2X67 A;  3IF8 B;  4TV8 E;  3FXE B;  2XQA A;  4CQI A;  3NZP A;  3JAE A;  4ZI2 C;  3F57 A;  3OYZ A;  3UUX B;  5J1G A;  2K3W A;  5AQH B;  2NOX A;  4EIW A;  5C2T A;  2PTF A;  2NTY A;  4QXH B;  4X20 E;  2LE8 A;  5LBQ B;  4HEA A;  1H7C A;  4QX7 B;  3PUZ F;  2CWO A;  5KDM C;  4DR4 T;  2YU1 A;  1KNP A;  3L8R A;  2XAH B;  2YIN A;  5HWX A;  2HN2 A;  2IUB A;  3H3M A;  2CXL A;  4DV5 T;  3P4S A;  4IL9 A;  1M62 A;  3LJC A;  4DR5 T;  4JI8 T;  3Q5E A;  1XDO A;  3N9L A;  2BG9 E;  2X9X A;  1XMQ T;  1IAP A;  2LM9 A;  4UVA B;  3MXZ A;  5KXJ A;  2XQ5 A;  1JNZ A;  3HL6 A;  4AQF C;  2YDS A;  3LK4 2;  3TLU A;  2WP9 A;  4DR3 T;  3AE7 A;  5LNK A;  3CX7 B;  2WQY A;  4HFC A;  4LF4 T;  2F4V T;  1W0B A;  4UV8 B;  4HWH A;  3I0O A;  4JBW F;  3S4U A;  3J9X 1;  2BKO A;  4HWI B;  4LF6 T;  4KX6 A;  5L4E A;  1NEK A;  3UUL A;  2D0U A;  2IW5 B;  4U2Y A;  4ILB A;  2W67 A;  2FJD A;  2LSK A;  4I50 E;  3CQG B;  5L3F B;  3UTK A;  2EHO D;  5IYZ E;  2LSI A;  3RYF E;  2V7L A;  1X9B A;  5LA6 E;  4A98 A;  2J62 A;  3FZL B;  5JDH A;  3ETU A;  4H9O C;  4PJN A;  5EK4 A;  2L3L A;  3NRY A;  5DQV A;  2M6B A;  1M7K A;  3ZYK A;  3UFG A;  2WMN A;  2XAF B;  5LHG B;  2Z6E A;  2E2A A;  4EB6 E;  5AQI B;  1G8X A;  2X68 A;  2CMR A;  2RA1 A;  2ZM8 A;  5AQG B;  2WCA A;  2DLR A;  4QH5 A;  3UU5 A;  3ZMS B;  3ZMV B;  4IHJ E;  4DR2 T;  3I0Q A;  4PK5 A;  3ZT7 A;  2HH7 A;  4PK6 A;  4TX5 A;  4JI7 T;  4H9S E;  2LLY A;  3EAB A;  4ILU A;  3PUA A;  3AAI A;  5AQV B;  3PE0 A;  3A8Y C;  3RH3 A;  1LVK A;  5AFU L;  4EZH A;  3CIR A;  3QK6 A;  4ZZC A;  3ZPO A;  4IT4 A;  3NKZ A;  3W15 B;  2JRK A;  3N2O A;  4LFA T;  2JQ9 A;  4IDQ A;  2XTL A;  2KSR A;  5AQT B;  3EI0 A;  2XQ7 A;  5L3C B;  1MIW A;  3FB2 A;  3PUR A;  3N9N A;  1T72 A;  5IWA T;  2WBL A;  2G0U A;  4HN9 A;  3EDU A;  5CJ5 A;  2XSA A;  2ODV A;  4ZS3 A;  5LG3 A;  1MMD A;  2VKO A;  4HFE A;  5L47 A;  4JI2 T;  3F2E A;  3AEB A;  4LFB T;  4HFD A;  4UXN B;  2LSG A;  2V6Y B;  2DCF A;  2BS4 A;  2W4X A;  4AKI A;  2VKD A;  4HFH A;  5GON E;  4O4L E;  1WR0 A;  2CWY A;  3RIU A;  2NW7 A;  2I59 A;  1HX8 A;  1IJ6 A;  4P0A A;  4ZZB A;  5LHH B;  4DID B;  2KMF A;  2CEA A;  5ABH A;  3P50 A;  3VKH A;  4JEH B;  1T7S A;  5LJN A;  3AE4 A;  1WLX A;  1N36 T;  1MMN A;  1KF6 A;  4CI2 B;  4YSX A;  1OED A;  2V1D B;  4C91 A;  1G73 A;  3IA3 A;  3OVU A;  3WAJ A;  1FJG T;  1KK7 A;  2BVM A;  4JI0 T;  3P7I A;  3KVB A;  2UU9 T;  3UT5 E;  4JI6 T;  4CZZ B;  5JR9 B;  4B3R T;  5BR8 T;  3ABV A;  2R6G F;  4DUY T;  3AEA A;  5FKY A;  4AKL A;  2YEV C;  5JVD E;  5FXV A;  4U31 A;  2D9D A;  2C5I T;  2YU2 A;  4TWD A;  1WYB A;  2BZB A;  1WFD A;  1V9D A;  2CHO A;  1IBK T;  2FJA A;  3ANW A;  2X9Y A;  3I9Y A;  2M6I A;  4PW8 A;  1KNR A;  4GYR A;  4B3M T;  4UEL A;  3OJA A;  4ADZ A;  1W0A A;  4HWD A;  5LMU T;  4PJL A;  1U5P A;  4GKK T;  2HN1 A;  3EAM A;  1UCU A;  3RI5 A;  4QKN A;  5LGN B;  3K3Q C;  3NRX A;  2DNX A;  4KI0 F;  4UF0 A;  2E5L T;  4EXT A;  3AED A;  2W63 A;  5FXW A;  1BR1 A;  4NUU A;  4WW0 A;  1HCI A;  3OKQ A;  4TN7 B;  1YD8 G;  1R8I A;  1D0X A;  2EHO B;  1S35 A;  5H6Q B;  4EV6 A;  3RC3 A;  3MA9 A;  2D2S A;  3K3N A;  1J5W A;  2XZE A;  3B5M A;  4ZXL A;  5HCJ A;  2LOP A;  5FXX A;  3P4P A;  3MKD A;  4TUY E;  2WU5 A;  5ETW A;  3AA1 B;  4DUZ T;  2ZM0 A;  1WRD A;  3UU3 A;  4EOZ B;  3CML A;  3T8O A;  2J47 A;  2KIN B;  1HNW T;  2PFV A;  4L5G A;  5JDF A;  1XNR T;  4HGA A;  4H9Q C;  3V5U A;  1I6Z A;  4PK4 A;  5J2T E;  2BG9 B;  4PFO A;  4B3S T;  3ZC0 A;  2LT3 A;  1NEN A;  1MND A;  4QHO A;  5LP6 E;  5EZY E;  2Q9Q A;  2X9H A;  5HCM A;  2CPT A;  4O2B E;  5LMN T;  5JDN A;  3ZSS A;  4F6R C;  3AEC A;  3VRB A;  4IDN A;  1HNX T;  4C90 A;  2YK0 A;  3E22 E;  5FL0 A;  2MAW A;  3AB3 B;  4TNV A;  1UUR A;  3BK9 A;  3CQX C;  1E1H B;  4IRE A;  2V7M A;  1ZHC A;  1D0Z A;  3RHW A;  5LXT E;  1KFY A;  2M67 A;  5CA0 E;  2MTQ A;  3QUJ A;  1FEW A;  3HI2 A;  1UUS A;  4UVC B;  2HPL A;  2CRB A;  3KFW X;  5JR9 C;  4DV0 T;  2LJL A;  3L39 A;  4O4J E;  2JQH A;  3C50 A;  4MBQ A;  5JDG A;  2CXF A;  5IHY A;  4YTN A;  4U2Z A;  2XY8 B;  3RC8 A;  2WMO A;  2Y8D A;  5F8P A;  2HPJ A;  3AXJ B;  1OED E;  1E7P A;  5JDM A;  3ZMU B;  5CB4 E;  1ZV4 X;  4DBR A;  1LKX A;  3RF1 A;  2YOE A;  4CN4 A;  3UQ4 A;  1SUM B;  4LF5 T;  2H7O A;  5LBM A;  4IE0 A;  2JIW A;  4I0U A;  5FY0 A;  3FHN A;  4UR9 A;  1US7 B;  2NW8 A;  4QXB B;  4IE5 A;  2LHR A;  5A1L A;  3QOF A;  3VRA A;  2UXB T;  5AQN B;  3PJA A;  2FJE A;  1IBL T;  2CBI A;  4LFC T;  1IBM T;  2XAS B;  5CA1 E;  3ZYL A;  4YTP A;  1HX1 B;  2V5D A;  3KV5 A;  3N2G E;  1YQ4 A;  4EYY R;  1Z8U A;  2VWA A;  4Z90 A;  1CUN A;  4DV6 T;  4DBQ A;  2C0S A;  4KHP T;  2EHO C;  4DR7 T;  4X64 T;  2E9X A;  3KDS E;  4IST A;  3AE6 A;  2RPA A;  5J2U E;  2BVL A;  3ZN1 B;  4YHJ A;  3AA7 B;  2QGS A;  4YSZ A;  3ZMZ B;  5ABE A;  3HR0 A;  2LKG A;  3FZK B;  2UXX B;  4UVB B;  5FL1 A;  4DV3 T;  4EAH A;  1Y64 B;  3ONX A;  3AEG A;  3PUG A;  2PBI A;  2UUA T;  1MMA A;  4TWF A;  4DV1 T;  3O1J A;  4JI3 T;  2WS3 A;  3BQI A;  4GK0 E;  3U3I A;  5M4Y A;  2Y48 B;  3PUS A;  2BG9 C;  3ZT5 A;  3A7M A;  2FUP A;  4O4I E;  2LM2 A;  3NWI A;  2CE7 A;  1XZY A;  5HXR A;  1N32 T;  1E2A A;  1DU2 A;  2LRK A;  2JMH A;  2NTX A;  3PDY A;  2A2F X;  1O3X A;  2PG8 A;  4NIQ A;  2LKH A;  1NAF A;  1UX5 A;  3WI3 A;  4U72 A;  4G2A A;  5FYM A;  1ZKE A;  4KP3 C;  5AQF B;  5L4H A;  3ZCI A;  2HHH T;  3SOL A;  3TKL B;  4AIS A;  2W0G A;  4PFP A;  3VU7 H;  1T98 A;  4DV7 T;  3FZH B;  4AKG A;  3P4W A;  3ZMT B;  4IIJ E;  4EGW A;  5BMV E;  4A56 A;  4ILA A;  5L3D B;  3C51 A;  3ZYM A;  4XZC A;  5TAO A;  4AKH A;  2WM9 A;  4LF7 T;  5ABF B;  4YXD A;  2A9U A;  2NWB A;  2CCQ A;  5C8Y E;  1LVF A;  3HA4 A;  4MLK A;  3K1S A;  5AQL B;  3N9Q A;  4H9P C;  2JJ9 A;  4HFB A;  5AQU B;  4OFZ A;  2I6H A;  2WWV A;  4LML A;  3U78 A;  5HXH A;  2J4G A;  2MBG A;  3AA0 B;  5LCY A;  4YT0 A;  3ZST A;  4U74 A;  4JLE A;  5LOV E;  2XSB A;  1MIY A;  4CN1 A;  4CXW A;  4LMJ A;  3WAK A;  2FJB A;  5AQS B;  2WDR A;  1HNZ T;  3VR9 A;  2DHR A;  4ZEY A;  4U33 A;  2W61 A;  3N9O A;  2D5U A;  2VKH A;  2V7K A;  5HEO A;  2OV9 A;  3UUM A;  2CA5 A;  3ZCJ A;  3CWZ B;  4WBN E;  1VRB A;  5HEH A;  2X9W A;  4JI1 T;  2WAU A;  1FIO A;  2X0L B;  2FBW A;  1WYC A;  3KBU A;  3GMI A;  3NBX X;  4ISS A;  4AQF A;  3Q5W A;  3I1A A;  2N1G A;  2IML A;  4DR6 T;  5FVK A;  5KX5 E;  4O4H E;  2Q9Q D;  1WCR A;  1D1C A;  4JUY A;  3VR8 A;  2XHE B;  2KZ7 B;  1MNE A;  5LGT B;  5HXE A;  4ASK A;  5HXS A;  4X1I E;  3AEE A;  2I0M A;  4QH4 A;  1ZEE A;  1XDP A;  3PTR B;  3O9X A;  2V5C A;  4EED A;  1J1J A;  3RLF F;  5DJQ C;  1OXZ A;  4EZ4 A;  2QYW A;  3UU8 A;  2VVN A;  5AQJ B;  4N78 D; 
#chains in the Genus database with same CATH homology
 3PUQ A;  3N9L A;  2UXN B;  2V26 A;  2A72 A;  5LP6 E;  5EZY E;  2KND A;  2Q9Q A;  2X9H A;  2X9X A;  1IAP A;  2LM9 A;  3E08 A;  4O2B E;  4UVA B;  4BA9 A;  3MXZ A;  4XAX B;  5JDN A;  1YKH B;  5JH7 E;  4F6R C;  1QUU A;  5FP3 A;  5LGU B;  3HL6 A;  2ZMA A;  4AQF C;  4C90 A;  5L2L A;  2YK0 A;  3E22 E;  3LK4 2;  3HKE E;  3F31 A;  5LNK A;  3CX7 B;  3AB3 B;  4K0U A;  5FY1 A;  4CI1 B;  1SHZ C;  5JRC A;  3R84 B;  4CXX A;  4ZOL E;  4UV8 B;  3LBX A;  2B1E A;  4BJN A;  3I0O A;  4IE6 A;  3S4U A;  1VOM A;  3BK9 A;  1E1H B;  3CQX C;  3PU8 A;  2V7M A;  3C4X A;  3J9X 1;  4PAG A;  3UUL A;  4TZ4 C;  1HG5 A;  1ZHC A;  3RYC E;  1D0Z A;  2D0U A;  3ESL A;  3B57 A;  4H63 V;  5LXT E;  2IW5 B;  3C4Z A;  2M67 A;  3HKC E;  3RYH E;  5DQW A;  5CA0 E;  2XAQ B;  2MTQ A;  3QUJ A;  1FMW A;  1FEW A;  1YKE B;  3HI2 A;  5L3E B;  4AKR B;  2LSK A;  4I50 E;  4UVC B;  3CQG B;  2HPL A;  5L3F B;  2GK9 A;  2DWG A;  3KFW X;  3UTK A;  4DMW A;  5JR9 C;  2EHO D;  3ZJ1 A;  5IYZ E;  2P9B A;  2A3D A;  2LSI A;  3RYF E;  2LJL A;  2V7L A;  4KMC A;  4O4J E;  3N5L A;  5LA6 E;  4MBQ A;  3C50 A;  4KUM B;  5JDG A;  2Q9Q C;  2SPC A;  4YLH A;  4DVD A;  2CXF A;  5IHY A;  5E0O A;  3RC8 A;  4OK0 A;  4Z8X A;  4UEM A;  5JDH A;  3ETU A;  3V5S A;  5JDQ A;  4H9O C;  4PJN A;  2E9X C;  2WMO A;  2Y8D A;  3GN5 A;  4KBM B;  5F8P A;  2HPJ A;  5EK4 A;  3P8C D;  1AJ3 A;  2ES0 A;  2KWH A;  2VL8 A;  2Y6X A;  4B6X A;  5FNV E;  3ZC1 A;  3ETV A;  2L3L A;  3NRY A;  5LHI B;  5DQV A;  2QA7 A;  1HG2 A;  5JDM A;  2N2N A;  1YW0 A;  4X1Y E;  3ZYK A;  4AQG A;  3ZMU B;  5CB4 E;  1ZV4 X;  2X66 A;  3RRW A;  2WMN A;  4DBR A;  2XAF B;  1LKX A;  2EHO A;  3H37 A;  4QXC B;  4H9R C;  3SS1 A;  1BR4 A;  2ZLY A;  5LHG B;  2Z6E A;  4I4T E;  2H7O A;  5LBM A;  3NZQ A;  4EB6 E;  2VKJ A;  4IE0 A;  1G8X A;  2X68 A;  1U4Q A;  2CMR A;  3BQK A;  2RA1 A;  2VK9 A;  2ZM8 A;  5FY0 A;  2KWI B;  2C5J A;  4WNK A;  3FHN A;  4DND A;  2DLR A;  1US7 B;  4I55 E;  2NW8 A;  3ZMS B;  3ZMV B;  5EK2 A;  4IHJ E;  2V7I A;  4QXB B;  2K24 A;  5LYJ E;  1IZN B;  3H3A A;  4IE5 A;  2LHR A;  3I0Q A;  5A1L A;  4PK5 A;  4QWN B;  2X51 A;  3KBT A;  2E9X D;  2HH7 A;  4PK6 A;  4MFR A;  4TX5 A;  3BQL A;  3MZK B;  2NW9 A;  2L8K A;  2ACX A;  4H9S E;  3I9W A;  2XAS B;  2K48 A;  4ILU A;  5CA1 E;  3PUA A;  3A5X A;  2BDE A;  3ZYL A;  3AAI A;  2XQY A;  3PE0 A;  1X79 A;  4O8S A;  3KV5 A;  3RH3 A;  4CXY A;  3N2G E;  1LVK A;  4EYY R;  4EZH A;  3ANW B;  5AFU L;  2VWA A;  3QK6 A;  4EYU A;  4YFS A;  1CUN A;  2H3R A;  4IGU A;  3N9M A;  3ZPO A;  5HXC A;  3W15 B;  3OYX A;  2JRK A;  5JDL A;  3N2O A;  2N9D A;  4DBQ A;  2C0S A;  4PNI A;  5ADX L;  3EUH A;  3KV6 A;  1BR2 A;  3CQC B;  3LK2 B;  4YJ3 E;  3GA8 A;  3O1I A;  2EHO C;  4ZS2 A;  1Z0P A;  2XTL A;  5KMG P;  5FXZ A;  2E9X A;  3KDS E;  4IST A;  5FY7 A;  2DWK A;  5J2U E;  5L3C B;  2BVL A;  3FBL A;  3ZN1 B;  3FXD B;  1MIW A;  3FB2 A;  2OA5 A;  3PUR A;  3N9N A;  3CX6 B;  5L3G B;  4YHJ A;  2WBL A;  3AA7 B;  2G0U A;  2QGS A;  4HN9 A;  3EDU A;  3ZMZ B;  2ZM2 A;  3C98 B;  4E7Z A;  2MOZ A;  4PJJ A;  2ODV A;  4ZS3 A;  3UFE A;  4AXP A;  2LEH A;  2VAS A;  3JC6 D;  3HR0 A;  4UF0 B;  1MMD A;  2VKO A;  3C64 A;  2UXX B;  4UVB B;  3F2E A;  4UXN B;  2LSG A;  4EAH A;  1Y64 B;  3ONX A;  2DCF A;  1NWM X;  4UIG A;  3CKD A;  4AKI A;  2VKD A;  3O4X E;  5DAB A;  5GON E;  3DJB A;  4O4L E;  4HKA A;  3PUG A;  2CWY A;  2PBI A;  3AVS A;  2KLQ A;  2W62 A;  1MMA A;  3MAC A;  3L09 A;  4GK5 E;  2NW7 A;  2ODU A;  3O1J A;  2I59 A;  1HX8 A;  3BQI A;  4O2A E;  3QC9 A;  2J1D G;  2CXD A;  4GK0 E;  3RKO A;  3U3I A;  1IJ6 A;  5M4Y A;  4P0A A;  2Y48 B;  5LHH B;  3PUS A;  4NUV A;  2KXP B;  5JRE A;  2H7V C;  2KMF A;  4HTE A;  2W00 A;  4O4I E;  3CX8 B;  2CEA A;  2LHN A;  2CE7 A;  2DI4 A;  5HXR A;  4GIW A;  3VKH A;  4JEH B;  3RYI E;  5LJN A;  3B13 A;  3LG7 A;  1WLX A;  2XUE A;  3Q2M A;  4WBO A;  4UV9 B;  3KIN B;  1MMN A;  2JMH A;  2NTX A;  1D1A A;  4CI2 B;  3PDY A;  2A2F X;  2PJQ A;  1O3X A;  2V1D B;  2PG8 A;  1MIV A;  4I43 B;  1NAF A;  1HFA A;  1UX5 A;  2XAJ B;  3OBV E;  4CI3 B;  3AAA B;  3EDV A;  4C91 A;  3WI3 A;  4U72 A;  1D0Y A;  2JMK A;  4G2A A;  1QSD A;  1G73 A;  4BJM A;  5FYM A;  3RPU A;  1ZKE A;  3KV4 A;  4KP3 C;  4P0B A;  3EVY A;  2CLY B;  3WAJ A;  2IC9 A;  3ZCI A;  2IC6 A;  3SOL A;  3TKL B;  3LK3 B;  1KK7 A;  2BVM A;  1SA0 E;  2W0G A;  2LSY A;  3P7I A;  4PFP A;  3VU7 H;  4ZHQ E;  4FJO A;  1T98 A;  1HTJ F;  4H63 H;  3KVB A;  4AKG A;  4V1A v;  3ZMT B;  3UT5 E;  2K9A A;  4IIJ E;  4CZZ B;  5BMV E;  4A56 A;  5JR9 B;  3JC6 C;  3SWH A;  5L3D B;  3C51 A;  3ZYM A;  1HF8 A;  2LOS A;  3K3O A;  4XZC A;  1WR6 A;  2YEV C;  4AKL A;  5TAO A;  2V7J A;  5HYA A;  2Q9Q B;  4ZI2 D;  4AKH A;  4FI5 A;  5FXV A;  5JVD E;  3RX6 A;  4OYK A;  4AI6 A;  3GWH A;  3ZN0 B;  2WM9 A;  3IEE A;  2C5I T;  3E0Z A;  2YU2 A;  2XAG B;  2NWB A;  2CCQ A;  1UX4 A;  1WYB A;  5C8Y E;  1LVF A;  4PJM A;  4JEU B;  1S94 A;  3AAE B;  3HA4 A;  4HFV A;  4MLK A;  2BZB A;  4GOU A;  3N9Q A;  4H9P C;  5JRC B;  2JJ9 A;  1V9D A;  5FMN A;  3SRZ A;  4ZI7 E;  3LBX B;  3DP7 A;  3ANW A;  4OFZ A;  3J7Y q;  2X9Y A;  3I9Y A;  4MHC A;  3L3P A;  4DMV A;  1OWA A;  4H9N C;  5LJM A;  3AVR A;  3K8P C;  3U78 A;  5HXH A;  3CPZ A;  3Q9D A;  4J2C A;  4PW8 A;  3CVR A;  3IHR A;  4GYR A;  2MBG A;  3AA0 B;  2VB6 A;  4P09 A;  1BR0 A;  5LCY A;  2D0T A;  4UEL A;  3OJA A;  4XBF B;  1EZ3 A;  4ADZ A;  4BAY B;  3PU3 A;  4PJL A;  4U74 A;  2JPF A;  3D0T A;  4JLE A;  1U5P A;  2JQQ A;  4GYS A;  5LOV E;  4HE8 A;  4L0R A;  3VHL A;  3UUN A;  2CLY C;  4TV9 E;  1UCU A;  3ZLI A;  1MIY A;  4QKN A;  5LGN B;  3K3Q C;  3C4W A;  2E8I A;  3NRX A;  3KVA A;  4CXW A;  3MJX A;  2DNX A;  1LRZ A;  2C5K T;  4IDZ A;  4L9I A;  3IBP A;  4UF0 A;  3RRC A;  3WAK A;  3ZJ2 A;  4EXT A;  5F3J A;  3M65 A;  5EK3 A;  5H6R B;  2W63 A;  5FXW A;  2MYS A;  4ANJ A;  4E7S A;  3GN5 B;  3ZEF B;  3O1H A;  2DHR A;  4ZI3 C;  2CM0 A;  1BR1 A;  4NUU A;  4G63 A;  4WW0 A;  1HCI A;  2W61 A;  3N9O A;  4OYJ A;  3OKQ A;  3VKG A;  4QX8 B;  4TN7 B;  1YD8 G;  1FMV A;  4YJ2 E;  1KNZ A;  2D5U A;  2VKH A;  2V7K A;  2X67 A;  3HKB E;  1B7T A;  3IF8 B;  3UUM A;  2CA5 A;  4TV8 E;  1D0X A;  2EHO B;  3Q5X A;  4IE7 A;  3ZCJ A;  3FXE B;  3CWZ B;  1S35 A;  5H6Q B;  3NZP A;  1VRB A;  2KT9 A;  2L9Q A;  3FBZ A;  3N9P A;  4CQI A;  4WBN E;  3RC3 A;  4ZI2 C;  3KV9 A;  3F57 A;  3MA9 A;  3OYZ A;  1MMG A;  2D2S A;  1HS7 A;  3K3N A;  2X9W A;  3AA6 B;  3HKD E;  2WSS V;  4X1K E;  3UUX B;  5J1G A;  5L3B B;  2WAU A;  1FIO A;  2K5B B;  2LOP A;  2X0L B;  2NOX A;  4OHF A;  5FXX A;  4EIW A;  2RP4 A;  3DTO A;  1WYC A;  5HWY A;  3R6N A;  3KBU A;  4ZI3 D;  3MKD A;  3GMI A;  2NTY A;  1D1B A;  3NBX X;  4ISS A;  4QXH B;  4TUY E;  4AQF A;  3Q5W A;  3I1A A;  2IAK A;  3AA1 B;  5ETW A;  4X20 E;  2N1G A;  2NP9 A;  2LE8 A;  5LBQ B;  5LG4 A;  2ZM0 A;  2LSJ A;  1WRD A;  4HEA A;  1H7C A;  3N2K E;  4QX7 B;  2CWO A;  5KDM C;  5JQG E;  4EOZ B;  3CML A;  4O4H E;  5KX5 E;  4IE4 A;  4DO0 A;  3T8O A;  2Q9Q D;  1D1C A;  2KIN B;  2YU1 A;  2XHE B;  2KZ7 B;  4JUY A;  1MNE A;  2XAH B;  5LGT B;  2YIN A;  4MAL A;  5HWX A;  5HXE A;  4ASK A;  5HXS A;  4X1I E;  2CXL A;  2PFV A;  4L5G A;  5JDF A;  1ZEE A;  3MK7 C;  5HAX A;  3PTR B;  4HGA A;  3LJC A;  3O9X A;  2WWU A;  4M1P A;  4ERR A;  2E9X B;  4H9Q C;  3V5U A;  4PK4 A;  5J2T E;  3LFM A;  4PFO A;  3ZC0 A;  2LT3 A;  1IJ5 A;  5DJQ C;  1OXZ A;  1MND A;  5JR9 A;  4EZ4 A;  4QHO A;  4N78 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...