2JRKA

Nmr structure and epitope mapping of blo t 5
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
112
structure length
112
Chain Sequence
KKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear magnetic resonance structure and IgE epitopes of Blo t 5, a major dust mite allergen
pubmed rcsb
source organism Blomia tropicalis
molecule tags Allergen
molecule keywords Mite allergen Blo t 5
total genus 34
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2007-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.970 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2jrkA00
2JMHA 2LM9A 2JRKA
chains in the Genus database with same CATH superfamily
2LEHA 3KINB 2W67A 4LMKA 2XQYA 4CI3B 5AQIB 4ERRA 5DJQC 3Q5WA 1XDOA 2XASB 4TWDA 3AEFA 2V7LA 3QUJA 4KP3C 5FP3A 3E08A 3RHWA 1OWAA 3ZCJA 2V5DA 3ZYMA 5HWXA 2E5LT 4ILUA 3QC9A 1H7CA 2XM2A 2M67A 5FXXA 2DCFA 2Z6EA 4O8SA 3ZMSB 3EUHA 4MFRA 4H63V 4XAXB 4DR5T 3ZC1A 4LFBT 2WQYA 2YDQA 4HFVA 3KBUA 5H6QB 3JAEA 5AQVB 2B76A 5CFBA 4MALA 4H9NC 3UQ4A 3I0QA 5DABA 5IHYA 3VU7H 4PJLA 2C5KT 2CHNA 5F3JA 2WWVA 4ISSA 4QHOA 1BR1A 4EB6E 1KEYA 2CLYC 2DL1A 2QVAA 2ZMAA 2NW9A 1VOMA 2PFVA 4KI0F 3ZPOA 4B3MT 4DR3T 4P0BA 4AKHA 2FJEA 4ZXLA 2PG8A 1ZV4X 4A5XA 5BR8T 1I94T 3EAMA 2V7KA 5LYJE 4DR2T 2MAWA 3UU4A 5L3GB 2NW7A 5L4HA 2C5JA 3N9NA 3A5XA 3Q5EA 3FZHB 4AXPA 4OK0A 5ABHA 3FZMB 1T7SA 2H89A 2LJLA 4JI5T 3ANWB 2CE7A 3CIRA 4PFOA 4ZEYA 2YOEA 1OEDE 4EYYR 2XQ3A 1J1JA 2ACZA 3Q5DA 4IL4A 4ZI2C 5IYZE 4QXBB 3VHLA 3AE7A 2NOXA 3VKHA 1J5WA 1D1BA 2ZM6T 3GN5B 2L8KA 4ZI2D 5CA0E 4K0UA 2WU2A 2ZLYA 4AI6A 3KV6A 2F4VT 4UF0B 3SRZA 3AE6A 3T8OA 1OXZA 3C64A 2CXFA 2LKGA 3FXEB 1FMVA 2LSJA 3GWHA 4WW0A 5JDLA 3LK42 2LSGA 3CQXC 3I9WA 4TV8E 4ZS2A 4H9QC 2XHEB 4DMWA 5LG4A 1N32T 2XY8B 2OLTA 2NR4A 2WDRA 3EDUA 3EDVA 4JLEA 4DMVA 3PUGA 1IZNB 2FJBA 4HEAA 1D1AA 1B7TA 4CXXA 5DQVA 5C2TA 4E7ZA 3RH3A 1YXRA 2CHOA 3PUAA 4KUMB 4N78D 3BQKA 2PBIA 3OPCA 3RRWA 3N9MA 4BAYB 5L2LA 4H9PC 1T98A 5FXZA 2Q9QC 1YKHB 3QB5A 4L0RA 4AIUA 3DP7A 3ETVA 1UCUA 3ZKRA 4IHJE 4B6XA 2EHOD 3AE3A 5BMVE 3EHZA 2RP4A 1US7B 1JNRA 2B1EA 5AQGB 2VASA 4HWHA 2P9BA 2H7VC 4LMJA 4O4IE 3V5SA 4EOZB 2JRKA 5FL0A 1HS7A 2LM9A 2ODVA 2E9XD 3CX8B 4ANJA 3OYZA 2IHR1 5HXRA 4AISA 3ZMVB 4YHJA 4WBNE 1AJ3A 4DR4T 1T8BA 2I59A 4U31A 3P4RA 3AAIA 4BJMA 4CN6A 4DUZT 1W0BA 2LHNA 4ZI3C 2CLYB 4GKKT 1IBLT 1UK5A 3RRCA 3N9OA 3CK6A 4LF5T 3NRYA 1MMAA 4EV6A 1Y64B 5E0OA 2CBIA 2M6BA 3CX6B 3NKZA 3OVUA 4PK6A 4DNDA 1HF8A 1WYCA 2CWYA 4U72A 3X1DA 2D0UA 2XPKA 5F5WA 5HXEA 4WNKA 2VQET 5FKYA 4P0AA 1UX5A 4X1KE 4NXMT 4B3TT 2H3RA 4JV5T 2D0TA 4X65T 1XWMA 2LOPA 1D1CA 3AEAA 1KNZA 2IUBA 1L0VA 5JR9C 5J2UE 5HXCA 4DV1T 1HNZT 4LFAT 1JNZA 3BK9A 5CA1E 3OYXA 3UUMA 3F31A 5FY1A 4OFZA 3P4PA 2LOSA 4LF9T 5FVLA 3F57A 3PUXF 4DV3T 1ZP0A 3MK7C 3BQIA 4IE6A 5ADXL 1U4QA 1NWMX 4HGAA 1KFYA 4UV8B 3UU8A 4AQFA 2YU1A 5ABGA 4ILCA 4C91A 2ODUA 4YSXA 2MOZA 2KWHA 4EGWA 2H7OA 1QUUA 2YINA 3C98B 1LKXA 4OHFA 3LBXA 3PU8A 1XMQT 4OX9T 2DWKA 2CRBA 2H88A 3PV0F 5HAXA 3RLFF 3UQ7A 2QYWA 3N5LA 2W4XA 5CB4E 2CWOA 2W66A 2UUBT 3LK2B 2VL0A 3RF1A 3N9QA 4DVDA 5JDMA 2IAKA 1HX1B 3AVSA 3QK6A 4JI0T 4AKRB 3L39A 2XAQB 4QH5A 4HFHA 4QX8B 3C4XA 4AQYT 2Q9QD 1M62A 2A9UA 2JPFA 1XMOT 3AA7B 4FI5A 4P09A 2BG9C 3B5MA 4ZI7E 2UUCT 3GN5A 1UGOA 2K5BB 3IBPA 4QH4A 2W2UA 1N34T 3TLUA 3CX7B 2CA5A 5AQSB 1E1HB 2WMOA 3UTKA 1FJGT 4KBMB 3ZCIA 4FJOA 2M6IA 4GKJT 4IDZA 3ANWA 5JTGA 3CQCB 4CI1B 4X20E 4CN4A 5LGTB 2Y8DA 2NTYA 3IF8B 2IW5B 4NUVA 3RYCE 2HPLA 3P8CD 4IREA 2CPTA 2ES0A 3WI3A 3MXZA 4EZ4A 4UVBB 3QB5K 2EHOC 1WR0A 3C4ZA 3ZMTB 5KMGP 1HX8A 1Z8UA 2ZM2A 3EABA 1E7PA 2LLYA 1MNEA 4U33A 4A98A 4TNVA 2X68A 4WZXA 1UURA 1LRZA 3P4WA 5AQPB 4U7YA 5LXTE 1DU2A 2XQ7A 3VR9A 4UF0A 2E9XC 2BZBA 4DIDB 4YHHT 2NWBA 3O1IA 2V6XA 2K3WA 1D0ZA 1MMDA 3PUQA 2WDQA 2XAFB 4P1NA 4ZOLE 4Z90A 5AQRB 3RIAA 4IE7A 3ZSTA 2D5UA 2WY2A 4DV7T 4AKGA 3AEDA 4LF8T 2G0UA 2WM9A 4ZZCA 3SS1A 2YEVC 4CI2B 1MIYA 2JJ9A 3OKQA 4GYSA 3HR0A 2I6HA 2EHOB 2YN6A 3AE8A 2BKNA 3PTRB 4YTPA 1SA0E 4I50E 2XQ4A 2WBLA 4NPPA 4U2ZA 3UFEA 3ZC0A 3AECA 4TNWA 1WRDA 4H9OC 3ZSSA 4ASKA 4CXYA 4DR7T 3SFDA 3AE1A 4IDNA 3DTOA 2Y48B 5HEOA 3PU3A 2WP9A 3RGLA 1ZHCA 4JI2T 1HG5A 4WBOA 4EEDA 4GOUA 5LGNB 5LOVE 3ZJ2A 3ZEFB 5FY0A 4YJ2E 2MTQA 2IC6A 1OEDC 3ZN1B 2LKHA 3M3ZB 4IE5A 3UU3A 3PE0A 4QXCB 3LDQB 4K0KT 3U3IA 2Q9QB 4F8HA 2SPCA 2KWIB 2X0YA 3KV4A 3NWIA 3I1AA 4G63A 4HFBA 4TV9E 1NEKA 2WAUA 3R84B 3FBZA 2XSAA 3O1JA 2X9HA 4BA9A 1XDPA 2BDEA 3NBXX 1YQ3A 2X67A 3I9YA 4KHPT 2JQKA 4DV4T 1ZOYA 3RYIE 1S94A 1IBMT 3PJAA 2OV9A 2IMLA 3EVYA 3OBVE 3SOLA 3Q9DA 2DNXA 1OEDB 2BBHA 4HE8A 5JDHA 2AE9A 2BG9E 1BR4A 2GK9A 3N9PA 4ZZBA 3RC8A 3PJAJ 4I4TE 2A2FX 4COFA 3RKOA 4YSZA 4TUYE 3H3AA 2XJ7A 4KMCA 4AKLA 3NRXA 1XNRT 2KMFA 2J1DG 5EK4A 2XQAA 4MBQA 3LG7A 2WZHA 5EK2A 3AA6B 3PDYA 4DV6T 4X5TA 4PK4A 1QLBA 2W00A 2YDRA 4JEHB 3NZPA 2NTXA 3KVAA 5LB7B 4XZCA 3AEBA 2LSYA 4IE4A 3CQGB 3TKLB 4U7IA 4AQFC 4KHZF 4JI4T 2CCQA 3ESLA 3KBTA 4HN9A 4YLHA 2DI4A 4PJJA 4QX7B 5LCYA 3ZN0B 4NXNT 5L3BB 2UUAT 5FY7A 4UV9B 1IBKT 3ZLIA 2LRKA 3E22E 4PNIA 3HL6A 5L3DB 5LNKA 4O2AE 3WAJA 4BJNA 1KNRA 5FYMA 2V1DB 3BQLA 2V7JA 2MBGA 4ZI3D 3T1YT 1LVFA 1ZKEA 2V26A 3ABVA 4HTEA 3WAKA 4YT0A 5EK3A 2Y6XA 2XZEA 4X62T 5LMUT 3B57A 3H3MA 5J1GA 2FJAA 2OA5A 2WDVA 2XAHB 5LGUB 2LSKA 4JYAT 4QKNA 3HKDE 1T72A 1CHUA 3N2OA 4AKIA 3C4WA 3EI0A 4JUYA 4MHCA 1Z0PA 3K8PC 4JBWF 3OTOT 1WFDA 2XAGB 3TLWA 3HKCE 2X9YA 4ILAA 4YTNA 5HXHA 5HXSA 2V8SV 2FJDA 2FBWA 2DHRA 5L3CB 3VRBA 3GMIA 3K3OA 5L3FB 2KZ7B 2XQ8A 2YDSA 2W0GA 2YK0A 5ABFA 4IT4A 4O4LE 2HPJA 3AXJB 5JDNA 2E2AA 2J4GA 1MIWA 2JMKA 2X9XA 3KDSE 3MJXA 4IDPA 2E9XA 3AEEA 5FVKA 5HCMA 3OJAA 3UUBA 4HWDA 5H6RB 4HFDA 5GONE 4E7SA 5ABFB 4Z91A 5HEHA 2CXDA 4LF7T 3LK3B 2C5IT 4ADZA 1YQ4A 3QNUA 4U74A 1CUNA 3UULA 2X0LB 3GA8A 3AA0B 4DO0A 5FXVA 1SE7A 1Y01A 4CN1A 1E2AA 5J0ZA 3VRAA 1NENA 5JREA 1FEWA 1BR0A 3DJBA 2WSSV 4X1YE 5A1LA 2XQ9A 4B3ST 2UXCT 4PAGA 4M1PA 3K1SA 3VKGA 5HCJA 1S35A 3AAEB 3N2GE 1LVKA 2BVMA 2D9DA 5M4YA 2PJQA 1I6ZA 3KVBA 2VWAA 5FXWA 2VVNA 2WCAA 4I0UA 3M65A 1HNXT 4CZZB 1QSDA 2A72A 5AQMB 1W09A 3Q2MA 4PK5A 2LE8A 4HWFA 1FMWA 4L9IA 3FZLB 5HYAA 3J7Yq 1J5ET 2E8IA 2VKOA 1HTJF 4GYRA 3UT5E 3PUSA 2HN2A 4QWNB 4Z8XA 2CXLA 4XBFB 2BBJA 2JQHA 3RC3A 5AFUL 2E5VA 1XNQT 5CGMA 4JI7T 2K9AA 2DLRA 2QRXA 3MKDA 4KX6A 4UEMA 5EZYE 3TLVA 5LHHB 4X66T 1YD8G 2LHRA 3JCFA 3LFMA 4EXTA 3ONLC 5LMNT 3O9XA 4EZHA 2LT3A 3AVRA 4QXHB 1M7KA 4TX5A 3RIFA 3ZT7A 4X64T 5AQQB 2ZM0A 4I43B 1VCTA 2L3LA 2YU2A 4CQIA 5LHIB 4LFCT 4JI6T 3C50A 2V5CA 4HFEA 5DQWA 4U3CA 4J2CA 4Q25A 1R8IA 3N2KE 1G8XA 3PUYF 3K3QC 2WU5A 3ZYLA 5TAOA 5AQJB 4CXWA 5KXJA 5J2TE 3TLSA 3FB2A 2V6YB 1WLXA 1EZ3A 3JAFA 2VKJA 3Q5XA 2VURA 4MLKA 4LF4T 2W61A 3HI2A 3KFWX 5KX5E 2K48A 4YJ3E 5AQKB 1O3XA 3IA3A 1YKEB 1YW0A 2A3DA 2XAJB 3AA1B 2UXNB 1OEDA 2CMRA 2X51A 1W0AA 3PUVF 4IGUA 4IDOA 4V1Av 2IIUA 5JDFA 4ZHQE 5CJ5A 4TWHA 4DV0T 4LF6T 3RYFE 4NIQA 2UXBT 3RQUA 3S4UA 2RA1A 4IDQA 2LSIA 3O1HA 4HKAA 4YSYA 3JC6D 3MA9A 3HKBE 2XTLA 3RPUA 3KV5A 5AQNB 3N9LA 2YKSA 5LJMA 2N1GA 4A97A 2UXDT 3RIUA 3B13A 4X1IE 1BR2A 2AXDS 1KK7A 2ACXA 2K24A 2VVSA 3CWZB 3HA4A 4G2AA 5HWYA 1IJ6A 2CM0A 2VKHA 3QOFA 3SFEA 3U78A 4UELA 1X9BA 2N2NA 3D0TA 4C90A 4DUYT 3C51A 2WMNA 4AQGA 5JRCA 2UU9T 2WWUA 1VCSA 1MNDA 3AE4A 4EYUA 3ZMZB 1KF6A 4LMLA 3L3PA 4GK5E 1WR6A 5KDMC 4JI1T 2QA7A 4H9RC 4PW8A 5LBQB 3ZMUB 3KV9A 2JQQA 3FZKB 4TWFA 5ETWA 2C0SA 5AQTB 2KNDA 4ILBA 2EHOA 3E0ZA 4UVCB 5C8YE 5L4EA 4DV5T 3P50A 3RKGA 2WZIA 2XM1A 3FBLA 4HFIA 4UIGA 4YY3T 5AQFB 4I55E 5LA6E 1UX4A 4DV2T 4U2YA 4JI3T 1ZEEA 2X0HA 2JMHA 3SWHA 4YXDA 1N36T 3FXDB 4TN7B 2Q9QA 3K3NA 3RIUC 3AEGA 2ZM8A 3CPZA 4A56A 3JADA 3FHNA 4IIJE 4IE0A 4UR9A 3O4XE 3J9X1 3UU6A 2CEAA 5ABEA 1SHZC 4HWIB 2NW8A 5JDGA 4EAHA 3NZQA 4YFSA 1HFAA 3L09A 3L8RA 4YTMA 2KSRA 5FNVE 4WYVA 5L3EB 2W62A 3ONXA 4L5GA 3PUWF 3FZFB 2BS3A 2V6YA 3ZJ1A 2VQFT 1FIOA 3MACA 1HNWT 1XZYA 3MZKB 3G06A 3ZT5A 2VB6A 4DBRA 3P7IA 3TLTA 1NAFA 3AB3B 2J62A 2VK9A 4GK0E 4H63H 4UVAB 5AQLB 4DBQA 2HHHT 3AE9A 2XQ6A 5C3JA 3AE2A 4O4HE 2R6GF 1IJ5A 1GQEA 4H9SE 3UUNA 1G73A 5AQUB 3AXJA 1HG2A 2RPAA 2BVLA 2V7IA 1UUSA 2N9DA 1WYBA 2E9XB 3I0OA 4O2BE 1WCRA 2XSBA 2PTFA 4PFPA 3RX6A 2BKOA 2MPKA 5L47A 2WS3A 5LP6E 3CMLA 3T1HT 2BS2A 5JR9A 2KXPB 1VRBA 2VL8A 4OYKA 3V5UA 1MIVA 4EIWA 1N33T 5JQGE 2L9QA 4EEBA 1HR0T 3LBXB 4PJNA 3AE5A 5LG3A 2KT9A 1IAPA 4DR6T 2NP9A 2WB5A 3UUXB 2MYSA 5F8PA 3CKDA 2QGSA 2JQ9A 2UXXB 2VKDA 1W9RA 2X9WA 5HEUA 5AQHB 3ZT6A 5FL1A 4DR1T 3CVRA 2D2SA 3PURA 1HCIA 2I0MA 2LRLA 5IWAT 4HFCA 1SUMB 5IUXA 3RYHE 2FUPA 3A8YC 3A7MA 3IEEA 2KLQA 3P4QA 5FMNA 4UXNB 1MMNA 2BS4A 4TZ4C 2KINB 2IDOB 5LHGB 4GIWA 5LJNA 3RI5A 5HEGA 4ISTA 2XUEA 2DWGA 2BG9B 2HH7A 3VR8A 5HEJA 4QH1A 5JR9B 3LJCA 1X79A 3AAAB 4NUUA 1KNPA 1MMGA 4JEUB 1U5PA 1D0YA 5JVDE 4ZS3A 1V9DA 2V7MA 3JC6C 3HKEE 2X66A 3IHRA 4O4JE 4PJMA 5JH7E 4OYJA 3R6NA 3W15B 2XQ5A 2J47A 2W63A 3RQWA 3F2EA 3H37A 1D0XA 4IL9A 2IC9A 5AQOB 4HWCA 3PUZF 2HN1A 2CBJA 2LM2A 5JRCB 3UFGA 2BKPA 3ETUA 5LBMA 3LSVA 3NVOA 3UU5A 4F6RC 4B3RT 2JIWA 3ZYKA 2BG9A 5JDQA 3ONJA 3P4SA 4JI8T
chains in the Genus database with same CATH topology
2LEHA 3KINB 2XQYA 4CI3B 4ERRA 5DJQC 3Q5WA 2XASB 3ZCJA 2V7LA 3QUJA 4KP3C 5FP3A 3E08A 3ZYMA 1OWAA 5HWXA 4ILUA 3QC9A 1H7CA 2M67A 5FXXA 2DCFA 2Z6EA 4O8SA 3ZMSB 3EUHA 4MFRA 4H63V 4XAXB 3ZC1A 4HFVA 3KBUA 5H6QB 4MALA 4H9NC 3I0QA 5DABA 5IHYA 3VU7H 4PJLA 2C5KT 5F3JA 4ISSA 4QHOA 1BR1A 4EB6E 2ZMAA 2CLYC 5LHGB 2NW9A 1VOMA 2PFVA 3ZPOA 4AKHA 4P0BA 2PG8A 1ZV4X 2V7KA 5LYJE 5L3GB 2NW7A 2C5JA 3N9NA 3A5XA 4AXPA 4OK0A 2LJLA 3ANWB 2CE7A 4PFOA 4EYYR 4ZI2C 5IYZE 4QXBB 3VHLA 2NOXA 3VKHA 1D1BA 3GN5B 2L8KA 4ZI2D 5CA0E 4K0UA 2ZLYA 4AI6A 3KV6A 4UF0B 3SRZA 3T8OA 1OXZA 3C64A 2CXFA 3FXEB 4WW0A 1FMVA 2LSJA 3GWHA 5JDLA 3LK42 2LSGA 3CQXC 3I9WA 4TV8E 4ZS2A 4H9QC 2XHEB 4DMWA 5LG4A 3EDVA 4JLEA 3EDUA 4DMVA 3PUGA 1IZNB 4HEAA 1D1AA 1B7TA 4CXXA 5DQVA 4E7ZA 3RH3A 3PUAA 4KUMB 4N78D 3BQKA 2PBIA 3RRWA 4BAYB 3N9MA 5L2LA 4H9PC 1T98A 5FXZA 2Q9QC 1YKHB 4L0RA 3DP7A 3ETVA 1UCUA 4B6XA 4IHJE 2EHOD 5BMVE 2RP4A 1US7B 2B1EA 2VASA 4O4IE 2P9BA 2H7VC 3V5SA 4EOZB 1HS7A 2JRKA 2LM9A 2ODVA 2E9XD 3CX8B 4ANJA 3OYZA 5HXRA 4WBNE 3ZMVB 4YHJA 1AJ3A 2I59A 4BJMA 3AAIA 2LHNA 4ZI3C 2CLYB 3RRCA 3N9OA 3NRYA 1MMAA 1Y64B 5E0OA 3CX6B 4PK6A 4DNDA 1HF8A 1WYCA 2CWYA 4U72A 2D0UA 5HXEA 4WNKA 4P0AA 1UX5A 2H3RA 2D0TA 2LOPA 1D1CA 1KNZA 5JR9C 5J2UE 5HXCA 3BK9A 5CA1E 3OYXA 3UUMA 3F31A 5FY1A 4OFZA 2LOSA 3F57A 3MK7C 3BQIA 4IE6A 5ADXL 1NWMX 1U4QA 4HGAA 4UV8B 4AQFA 4C91A 2YU1A 2ODUA 2MOZA 2KWHA 2H7OA 1QUUA 2YINA 3C98B 1LKXA 4OHFA 3LBXA 3PU8A 2DWKA 5HAXA 3N5LA 5CB4E 2CWOA 3LK2B 3N9QA 4DVDA 5JDMA 2IAKA 3QK6A 3AVSA 4AKRB 2XAQB 4QX8B 3C4XA 2Q9QD 2JPFA 3AA7B 4FI5A 4P09A 4ZI7E 3GN5A 2K5BB 3IBPA 3CX7B 2CA5A 3UTKA 1E1HB 2WMOA 4KBMB 3ZCIA 4FJOA 4IDZA 3ANWA 3CQCB 4CI1B 4X20E 5LGTB 2Y8DA 2NTYA 3IF8B 2IW5B 4NUVA 3RYCE 2HPLA 3P8CD 3WI3A 2ES0A 3MXZA 4EZ4A 4UVBB 2EHOC 3C4ZA 3ZMTB 5KMGP 1HX8A 2ZM2A 1MNEA 2X68A 1LRZA 5LXTE 4UF0A 2E9XC 2BZBA 2NWBA 3O1IA 4F6RC 1D0ZA 1MMDA 3PUQA 2XAFB 4ZOLE 4AKGA 4IE7A 2D5UA 2G0UA 2WM9A 3SS1A 2YEVC 4CI2B 1MIYA 2JJ9A 3OKQA 4GYSA 3HR0A 3PTRB 2EHOB 4IIJE 1SA0E 4I50E 2WBLA 3UFEA 3ZC0A 1WRDA 4H9OC 4ASKA 4CXYA 3DTOA 2Y48B 3PU3A 1ZHCA 1HG5A 4WBOA 4GOUA 5LGNB 5LOVE 3ZJ2A 3ZEFB 5FY0A 4YJ2E 2MTQA 2IC6A 3ZN1B 4IE5A 3PE0A 4QXCB 3U3IA 2Q9QB 2SPCA 2KWIB 3KV4A 4X1KE 3I1AA 4G63A 4TV9E 2WAUA 3R84B 3FBZA 3O1JA 2X9HA 4BA9A 2BDEA 3NBXX 2X67A 3I9YA 3RYIE 1S94A 3EVYA 3OBVE 5JDHA 3SOLA 3Q9DA 2DNXA 4HE8A 2GK9A 1BR4A 3N9PA 3RC8A 4I4TE 2A2FX 3RKOA 4TUYE 3H3AA 4KMCA 4AKLA 3NRXA 2KMFA 2J1DG 5EK4A 4MBQA 3LG7A 5EK2A 3AA6B 3PDYA 4PK4A 2W00A 4JEHB 3NZPA 2NTXA 3KVAA 4XZCA 4IE4A 2LSYA 3CQGB 3TKLB 4AQFC 3ESLA 2CCQA 3KBTA 4HN9A 4YLHA 2DI4A 4PJJA 4QX7B 5LCYA 3ZN0B 5L3BB 5FY7A 4UV9B 3ZLIA 3E22E 4PNIA 3HL6A 5L3DB 5LNKA 4O2AE 3WAJA 4BJNA 5FYMA 2V1DB 3BQLA 2V7JA 2MBGA 4ZI3D 1LVFA 1ZKEA 2V26A 4HTEA 3WAKA 5EK3A 2Y6XA 3B57A 5J1GA 2OA5A 2XAHB 5LGUB 2LSKA 4QKNA 3HKDE 3N2OA 4AKIA 3C4WA 4JUYA 4MHCA 1Z0PA 3K8PC 2XAGB 3HKCE 2X9YA 5HXHA 5HXSA 5L3FB 5L3CB 2DHRA 3GMIA 3K3OA 2KZ7B 2YK0A 2W0GA 4O4LE 2HPJA 5JDNA 2JMKA 3KDSE 1MIWA 3MJXA 2X9XA 2E9XA 3OJAA 5H6RB 4E7SA 5GONE 2CXDA 3LK3B 2C5IT 4ADZA 4U74A 1CUNA 3UULA 2X0LB 3GA8A 3AA0B 4DO0A 5FXVA 5JREA 1FEWA 1BR0A 3DJBA 2WSSV 4X1YE 5A1LA 4PAGA 4M1PA 3VKGA 1S35A 3AAEB 3N2GE 1LVKA 2BVMA 5M4YA 2PJQA 3KVBA 2VWAA 5FXWA 3M65A 4CZZB 2A72A 1QSDA 3Q2MA 4PK5A 2LE8A 5HYAA 1FMWA 4L9IA 3J7Yq 2E8IA 2VKOA 1HTJF 4GYRA 3UT5E 3PUSA 4Z8XA 4QWNB 4XBFB 2CXLA 3RC3A 5AFUL 2K9AA 2DLRA 3MKDA 4UEMA 5EZYE 5LHHB 1YD8G 2LHRA 3LFMA 4EXTA 3O9XA 4EZHA 2LT3A 3AVRA 4QXHB 4TX5A 2ZM0A 4I43B 2L3LA 2YU2A 4CQIA 5LHIB 3C50A 5DQWA 4J2CA 3N2KE 4CXWA 1G8XA 3K3QC 3ZYLA 5TAOA 5J2TE 3FB2A 1WLXA 1EZ3A 2VKJA 3Q5XA 4MLKA 2W61A 3HI2A 3KFWX 5KX5E 2K48A 4YJ3E 1O3XA 1YKEB 1YW0A 2A3DA 2XAJB 3AA1B 2UXNB 2X51A 2CMRA 4IGUA 4ZHQE 4V1Av 5JDFA 3RYFE 3S4UA 2RA1A 2LSIA 3O1HA 4HKAA 3JC6D 3MA9A 3HKBE 2XTLA 3RPUA 3KV5A 3N9LA 5LJMA 2N1GA 3B13A 4X1IE 1BR2A 3CWZB 1KK7A 2ACXA 2K24A 3HA4A 4G2AA 5HWYA 1IJ6A 2CM0A 2VKHA 3U78A 4UELA 2N2NA 3D0TA 4C90A 3C51A 2WMNA 4AQGA 5JRCA 2WWUA 1MNDA 4EYUA 3ZMZB 3L3PA 4GK5E 1WR6A 5KDMC 2QA7A 4H9RC 4PW8A 5LBQB 3ZMUB 3KV9A 2JQQA 5ETWA 2C0SA 2KNDA 2EHOA 3E0ZA 4UVCB 5C8YE 4UIGA 3FBLA 4I55E 5LA6E 1UX4A 1ZEEA 2JMHA 3SWHA 3FXDB 4TN7B 2Q9QA 3K3NA 2ZM8A 3CPZA 4A56A 3FHNA 4IE0A 3J9X1 3O4XE 2CEAA 1SHZC 2NW8A 5JDGA 4EAHA 3NZQA 4YFSA 1HFAA 3L09A 5FNVE 5L3EB 2W62A 3ONXA 4L5GA 3ZJ1A 1FIOA 3MACA 3MZKB 4DBRA 2VB6A 3P7IA 1NAFA 3AB3B 4GK0E 2VK9A 4H63H 4UVAB 4DBQA 4O4HE 1IJ5A 4H9SE 3UUNA 1G73A 1HG2A 2BVLA 2V7IA 2N9DA 3I0OA 1WYBA 2E9XB 4O2BE 4PFPA 3RX6A 5LP6E 3CMLA 5JR9A 2KXPB 1VRBA 2VL8A 4OYKA 3V5UA 1MIVA 4EIWA 5JQGE 2L9QA 3LBXB 4PJNA 2KT9A 1IAPA 2NP9A 3UUXB 2MYSA 5F8PA 3CKDA 2QGSA 2UXXB 2VKDA 2X9WA 3CVRA 2D2SA 3PURA 1HCIA 3RYHE 3IEEA 2KLQA 5FMNA 4UXNB 1MMNA 4TZ4C 2KINB 4GIWA 5LJNA 4ISTA 2XUEA 2DWGA 2HH7A 5JR9B 3LJCA 1X79A 3AAAB 4NUUA 1MMGA 4JEUB 1U5PA 1D0YA 5JVDE 4ZS3A 1V9DA 2V7MA 3JC6C 3HKEE 2X66A 3IHRA 4O4JE 4PJMA 5JH7E 4OYJA 3R6NA 3W15B 2W63A 3F2EA 3H37A 1D0XA 2IC9A 5JRCB 5LBMA 3ETUA 3ZYKA 5JDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMH A;  2LM9 A;  2JRK A; 
#chains in the Genus database with same CATH topology
 2LEH A;  3KIN B;  2W67 A;  4LMK A;  2XQY A;  4CI3 B;  5AQI B;  4ERR A;  5DJQ C;  3Q5W A;  1XDO A;  2XAS B;  4TWD A;  3AEF A;  2V7L A;  3QUJ A;  4KP3 C;  5FP3 A;  3E08 A;  3RHW A;  1OWA A;  3ZCJ A;  2V5D A;  3ZYM A;  5HWX A;  2E5L T;  4ILU A;  3QC9 A;  1H7C A;  2XM2 A;  2M67 A;  5FXX A;  2DCF A;  2Z6E A;  4O8S A;  3ZMS B;  3EUH A;  4MFR A;  4H63 V;  4XAX B;  4DR5 T;  3ZC1 A;  4LFB T;  2WQY A;  2YDQ A;  4HFV A;  3KBU A;  5H6Q B;  3JAE A;  5AQV B;  2B76 A;  5CFB A;  4MAL A;  4H9N C;  3UQ4 A;  3I0Q A;  5DAB A;  5IHY A;  3VU7 H;  4PJL A;  2C5K T;  2CHN A;  5F3J A;  2WWV A;  4ISS A;  4QHO A;  1BR1 A;  4EB6 E;  1KEY A;  2CLY C;  2DL1 A;  2QVA A;  2ZMA A;  2NW9 A;  1VOM A;  2PFV A;  4KI0 F;  3ZPO A;  4B3M T;  4DR3 T;  4P0B A;  4AKH A;  2FJE A;  4ZXL A;  2PG8 A;  1ZV4 X;  4A5X A;  5BR8 T;  1I94 T;  3EAM A;  2V7K A;  5LYJ E;  4DR2 T;  2MAW A;  3UU4 A;  5L3G B;  2NW7 A;  5L4H A;  2C5J A;  3N9N A;  3A5X A;  3Q5E A;  3FZH B;  4AXP A;  4OK0 A;  5ABH A;  3FZM B;  1T7S A;  2H89 A;  2LJL A;  4JI5 T;  3ANW B;  2CE7 A;  3CIR A;  4PFO A;  4ZEY A;  2YOE A;  1OED E;  4EYY R;  2XQ3 A;  1J1J A;  2ACZ A;  3Q5D A;  4IL4 A;  4ZI2 C;  5IYZ E;  4QXB B;  3VHL A;  3AE7 A;  2NOX A;  3VKH A;  1J5W A;  1D1B A;  2ZM6 T;  3GN5 B;  2L8K A;  4ZI2 D;  5CA0 E;  4K0U A;  2WU2 A;  2ZLY A;  4AI6 A;  3KV6 A;  2F4V T;  4UF0 B;  3SRZ A;  3AE6 A;  3T8O A;  1OXZ A;  3C64 A;  2CXF A;  2LKG A;  3FXE B;  1FMV A;  2LSJ A;  3GWH A;  4WW0 A;  5JDL A;  3LK4 2;  2LSG A;  3CQX C;  3I9W A;  4TV8 E;  4ZS2 A;  4H9Q C;  2XHE B;  4DMW A;  5LG4 A;  1N32 T;  2XY8 B;  2OLT A;  2NR4 A;  2WDR A;  3EDU A;  3EDV A;  4JLE A;  4DMV A;  3PUG A;  1IZN B;  2FJB A;  4HEA A;  1D1A A;  1B7T A;  4CXX A;  5DQV A;  5C2T A;  4E7Z A;  3RH3 A;  1YXR A;  2CHO A;  3PUA A;  4KUM B;  4N78 D;  3BQK A;  2PBI A;  3OPC A;  3RRW A;  3N9M A;  4BAY B;  5L2L A;  4H9P C;  1T98 A;  5FXZ A;  2Q9Q C;  1YKH B;  3QB5 A;  4L0R A;  4AIU A;  3DP7 A;  3ETV A;  1UCU A;  3ZKR A;  4IHJ E;  4B6X A;  2EHO D;  3AE3 A;  5BMV E;  3EHZ A;  2RP4 A;  1US7 B;  1JNR A;  2B1E A;  5AQG B;  2VAS A;  4HWH A;  2P9B A;  2H7V C;  4LMJ A;  4O4I E;  3V5S A;  4EOZ B;  2JRK A;  5FL0 A;  1HS7 A;  2LM9 A;  2ODV A;  2E9X D;  3CX8 B;  4ANJ A;  3OYZ A;  2IHR 1;  5HXR A;  4AIS A;  3ZMV B;  4YHJ A;  4WBN E;  1AJ3 A;  4DR4 T;  1T8B A;  2I59 A;  4U31 A;  3P4R A;  3AAI A;  4BJM A;  4CN6 A;  4DUZ T;  1W0B A;  2LHN A;  4ZI3 C;  2CLY B;  4GKK T;  1IBL T;  1UK5 A;  3RRC A;  3N9O A;  3CK6 A;  4LF5 T;  3NRY A;  1MMA A;  4EV6 A;  1Y64 B;  5E0O A;  2CBI A;  2M6B A;  3CX6 B;  3NKZ A;  3OVU A;  4PK6 A;  4DND A;  1HF8 A;  1WYC A;  2CWY A;  4U72 A;  3X1D A;  2D0U A;  2XPK A;  5F5W A;  5HXE A;  4WNK A;  2VQE T;  5FKY A;  4P0A A;  1UX5 A;  4X1K E;  4NXM T;  4B3T T;  2H3R A;  4JV5 T;  2D0T A;  4X65 T;  1XWM A;  2LOP A;  1D1C A;  3AEA A;  1KNZ A;  2IUB A;  1L0V A;  5JR9 C;  5J2U E;  5HXC A;  4DV1 T;  1HNZ T;  4LFA T;  1JNZ A;  3BK9 A;  5CA1 E;  3OYX A;  3UUM A;  3F31 A;  5FY1 A;  4OFZ A;  3P4P A;  2LOS A;  4LF9 T;  5FVL A;  3F57 A;  3PUX F;  4DV3 T;  1ZP0 A;  3MK7 C;  3BQI A;  4IE6 A;  5ADX L;  1U4Q A;  1NWM X;  4HGA A;  1KFY A;  4UV8 B;  3UU8 A;  4AQF A;  2YU1 A;  5ABG A;  4ILC A;  4C91 A;  2ODU A;  4YSX A;  2MOZ A;  2KWH A;  4EGW A;  2H7O A;  1QUU A;  2YIN A;  3C98 B;  1LKX A;  4OHF A;  3LBX A;  3PU8 A;  1XMQ T;  4OX9 T;  2DWK A;  2CRB A;  2H88 A;  3PV0 F;  5HAX A;  3RLF F;  3UQ7 A;  2QYW A;  3N5L A;  2W4X A;  5CB4 E;  2CWO A;  2W66 A;  2UUB T;  3LK2 B;  2VL0 A;  3RF1 A;  3N9Q A;  4DVD A;  5JDM A;  2IAK A;  1HX1 B;  3AVS A;  3QK6 A;  4JI0 T;  4AKR B;  3L39 A;  2XAQ B;  4QH5 A;  4HFH A;  4QX8 B;  3C4X A;  4AQY T;  2Q9Q D;  1M62 A;  2A9U A;  2JPF A;  1XMO T;  3AA7 B;  4FI5 A;  4P09 A;  2BG9 C;  3B5M A;  4ZI7 E;  2UUC T;  3GN5 A;  1UGO A;  2K5B B;  3IBP A;  4QH4 A;  2W2U A;  1N34 T;  3TLU A;  3CX7 B;  2CA5 A;  5AQS B;  1E1H B;  2WMO A;  3UTK A;  1FJG T;  4KBM B;  3ZCI A;  4FJO A;  2M6I A;  4GKJ T;  4IDZ A;  3ANW A;  5JTG A;  3CQC B;  4CI1 B;  4X20 E;  4CN4 A;  5LGT B;  2Y8D A;  2NTY A;  3IF8 B;  2IW5 B;  4NUV A;  3RYC E;  2HPL A;  3P8C D;  4IRE A;  2CPT A;  2ES0 A;  3WI3 A;  3MXZ A;  4EZ4 A;  4UVB B;  3QB5 K;  2EHO C;  1WR0 A;  3C4Z A;  3ZMT B;  5KMG P;  1HX8 A;  1Z8U A;  2ZM2 A;  3EAB A;  1E7P A;  2LLY A;  1MNE A;  4U33 A;  4A98 A;  4TNV A;  2X68 A;  4WZX A;  1UUR A;  1LRZ A;  3P4W A;  5AQP B;  4U7Y A;  5LXT E;  1DU2 A;  2XQ7 A;  3VR9 A;  4UF0 A;  2E9X C;  2BZB A;  4DID B;  4YHH T;  2NWB A;  3O1I A;  2V6X A;  2K3W A;  1D0Z A;  1MMD A;  3PUQ A;  2WDQ A;  2XAF B;  4P1N A;  4ZOL E;  4Z90 A;  5AQR B;  3RIA A;  4IE7 A;  3ZST A;  2D5U A;  2WY2 A;  4DV7 T;  4AKG A;  3AED A;  4LF8 T;  2G0U A;  2WM9 A;  4ZZC A;  3SS1 A;  2YEV C;  4CI2 B;  1MIY A;  2JJ9 A;  3OKQ A;  4GYS A;  3HR0 A;  2I6H A;  2EHO B;  2YN6 A;  3AE8 A;  2BKN A;  3PTR B;  4YTP A;  1SA0 E;  4I50 E;  2XQ4 A;  2WBL A;  4NPP A;  4U2Z A;  3UFE A;  3ZC0 A;  3AEC A;  4TNW A;  1WRD A;  4H9O C;  3ZSS A;  4ASK A;  4CXY A;  4DR7 T;  3SFD A;  3AE1 A;  4IDN A;  3DTO A;  2Y48 B;  5HEO A;  3PU3 A;  2WP9 A;  3RGL A;  1ZHC A;  4JI2 T;  1HG5 A;  4WBO A;  4EED A;  4GOU A;  5LGN B;  5LOV E;  3ZJ2 A;  3ZEF B;  5FY0 A;  4YJ2 E;  2MTQ A;  2IC6 A;  1OED C;  3ZN1 B;  2LKH A;  3M3Z B;  4IE5 A;  3UU3 A;  3PE0 A;  4QXC B;  3LDQ B;  4K0K T;  3U3I A;  2Q9Q B;  4F8H A;  2SPC A;  2KWI B;  2X0Y A;  3KV4 A;  3NWI A;  3I1A A;  4G63 A;  4HFB A;  4TV9 E;  1NEK A;  2WAU A;  3R84 B;  3FBZ A;  2XSA A;  3O1J A;  2X9H A;  4BA9 A;  1XDP A;  2BDE A;  3NBX X;  1YQ3 A;  2X67 A;  3I9Y A;  4KHP T;  2JQK A;  4DV4 T;  1ZOY A;  3RYI E;  1S94 A;  1IBM T;  3PJA A;  2OV9 A;  2IML A;  3EVY A;  3OBV E;  3SOL A;  3Q9D A;  2DNX A;  1OED B;  2BBH A;  4HE8 A;  5JDH A;  2AE9 A;  2BG9 E;  1BR4 A;  2GK9 A;  3N9P A;  4ZZB A;  3RC8 A;  3PJA J;  4I4T E;  2A2F X;  4COF A;  3RKO A;  4YSZ A;  4TUY E;  3H3A A;  2XJ7 A;  4KMC A;  4AKL A;  3NRX A;  1XNR T;  2KMF A;  2J1D G;  5EK4 A;  2XQA A;  4MBQ A;  3LG7 A;  2WZH A;  5EK2 A;  3AA6 B;  3PDY A;  4DV6 T;  4X5T A;  4PK4 A;  1QLB A;  2W00 A;  2YDR A;  4JEH B;  3NZP A;  2NTX A;  3KVA A;  5LB7 B;  4XZC A;  3AEB A;  2LSY A;  4IE4 A;  3CQG B;  3TKL B;  4U7I A;  4AQF C;  4KHZ F;  4JI4 T;  2CCQ A;  3ESL A;  3KBT A;  4HN9 A;  4YLH A;  2DI4 A;  4PJJ A;  4QX7 B;  5LCY A;  3ZN0 B;  4NXN T;  5L3B B;  2UUA T;  5FY7 A;  4UV9 B;  1IBK T;  3ZLI A;  2LRK A;  3E22 E;  4PNI A;  3HL6 A;  5L3D B;  5LNK A;  4O2A E;  3WAJ A;  4BJN A;  1KNR A;  5FYM A;  2V1D B;  3BQL A;  2V7J A;  2MBG A;  4ZI3 D;  3T1Y T;  1LVF A;  1ZKE A;  2V26 A;  3ABV A;  4HTE A;  3WAK A;  4YT0 A;  5EK3 A;  2Y6X A;  2XZE A;  4X62 T;  5LMU T;  3B57 A;  3H3M A;  5J1G A;  2FJA A;  2OA5 A;  2WDV A;  2XAH B;  5LGU B;  2LSK A;  4JYA T;  4QKN A;  3HKD E;  1T72 A;  1CHU A;  3N2O A;  4AKI A;  3C4W A;  3EI0 A;  4JUY A;  4MHC A;  1Z0P A;  3K8P C;  4JBW F;  3OTO T;  1WFD A;  2XAG B;  3TLW A;  3HKC E;  2X9Y A;  4ILA A;  4YTN A;  5HXH A;  5HXS A;  2V8S V;  2FJD A;  2FBW A;  2DHR A;  5L3C B;  3VRB A;  3GMI A;  3K3O A;  5L3F B;  2KZ7 B;  2XQ8 A;  2YDS A;  2W0G A;  2YK0 A;  5ABF A;  4IT4 A;  4O4L E;  2HPJ A;  3AXJ B;  5JDN A;  2E2A A;  2J4G A;  1MIW A;  2JMK A;  2X9X A;  3KDS E;  3MJX A;  4IDP A;  2E9X A;  3AEE A;  5FVK A;  5HCM A;  3OJA A;  3UUB A;  4HWD A;  5H6R B;  4HFD A;  5GON E;  4E7S A;  5ABF B;  4Z91 A;  5HEH A;  2CXD A;  4LF7 T;  3LK3 B;  2C5I T;  4ADZ A;  1YQ4 A;  3QNU A;  4U74 A;  1CUN A;  3UUL A;  2X0L B;  3GA8 A;  3AA0 B;  4DO0 A;  5FXV A;  1SE7 A;  1Y01 A;  4CN1 A;  1E2A A;  5J0Z A;  3VRA A;  1NEN A;  5JRE A;  1FEW A;  1BR0 A;  3DJB A;  2WSS V;  4X1Y E;  5A1L A;  2XQ9 A;  4B3S T;  2UXC T;  4PAG A;  4M1P A;  3K1S A;  3VKG A;  5HCJ A;  1S35 A;  3AAE B;  3N2G E;  1LVK A;  2BVM A;  2D9D A;  5M4Y A;  2PJQ A;  1I6Z A;  3KVB A;  2VWA A;  5FXW A;  2VVN A;  2WCA A;  4I0U A;  3M65 A;  1HNX T;  4CZZ B;  1QSD A;  2A72 A;  5AQM B;  1W09 A;  3Q2M A;  4PK5 A;  2LE8 A;  4HWF A;  1FMW A;  4L9I A;  3FZL B;  5HYA A;  3J7Y q;  1J5E T;  2E8I A;  2VKO A;  1HTJ F;  4GYR A;  3UT5 E;  3PUS A;  2HN2 A;  4QWN B;  4Z8X A;  2CXL A;  4XBF B;  2BBJ A;  2JQH A;  3RC3 A;  5AFU L;  2E5V A;  1XNQ T;  5CGM A;  4JI7 T;  2K9A A;  2DLR A;  2QRX A;  3MKD A;  4KX6 A;  4UEM A;  5EZY E;  3TLV A;  5LHH B;  4X66 T;  1YD8 G;  2LHR A;  3JCF A;  3LFM A;  4EXT A;  3ONL C;  5LMN T;  3O9X A;  4EZH A;  2LT3 A;  3AVR A;  4QXH B;  1M7K A;  4TX5 A;  3RIF A;  3ZT7 A;  4X64 T;  5AQQ B;  2ZM0 A;  4I43 B;  1VCT A;  2L3L A;  2YU2 A;  4CQI A;  5LHI B;  4LFC T;  4JI6 T;  3C50 A;  2V5C A;  4HFE A;  5DQW A;  4U3C A;  4J2C A;  4Q25 A;  1R8I A;  3N2K E;  1G8X A;  3PUY F;  3K3Q C;  2WU5 A;  3ZYL A;  5TAO A;  5AQJ B;  4CXW A;  5KXJ A;  5J2T E;  3TLS A;  3FB2 A;  2V6Y B;  1WLX A;  1EZ3 A;  3JAF A;  2VKJ A;  3Q5X A;  2VUR A;  4MLK A;  4LF4 T;  2W61 A;  3HI2 A;  3KFW X;  5KX5 E;  2K48 A;  4YJ3 E;  5AQK B;  1O3X A;  3IA3 A;  1YKE B;  1YW0 A;  2A3D A;  2XAJ B;  3AA1 B;  2UXN B;  1OED A;  2CMR A;  2X51 A;  1W0A A;  3PUV F;  4IGU A;  4IDO A;  4V1A v;  2IIU A;  5JDF A;  4ZHQ E;  5CJ5 A;  4TWH A;  4DV0 T;  4LF6 T;  3RYF E;  4NIQ A;  2UXB T;  3RQU A;  3S4U A;  2RA1 A;  4IDQ A;  2LSI A;  3O1H A;  4HKA A;  4YSY A;  3JC6 D;  3MA9 A;  3HKB E;  2XTL A;  3RPU A;  3KV5 A;  5AQN B;  3N9L A;  2YKS A;  5LJM A;  2N1G A;  4A97 A;  2UXD T;  3RIU A;  3B13 A;  4X1I E;  1BR2 A;  2AXD S;  1KK7 A;  2ACX A;  2K24 A;  2VVS A;  3CWZ B;  3HA4 A;  4G2A A;  5HWY A;  1IJ6 A;  2CM0 A;  2VKH A;  3QOF A;  3SFE A;  3U78 A;  4UEL A;  1X9B A;  2N2N A;  3D0T A;  4C90 A;  4DUY T;  3C51 A;  2WMN A;  4AQG A;  5JRC A;  2UU9 T;  2WWU A;  1VCS A;  1MND A;  3AE4 A;  4EYU A;  3ZMZ B;  1KF6 A;  4LML A;  3L3P A;  4GK5 E;  1WR6 A;  5KDM C;  4JI1 T;  2QA7 A;  4H9R C;  4PW8 A;  5LBQ B;  3ZMU B;  3KV9 A;  2JQQ A;  3FZK B;  4TWF A;  5ETW A;  2C0S A;  5AQT B;  2KND A;  4ILB A;  2EHO A;  3E0Z A;  4UVC B;  5C8Y E;  5L4E A;  4DV5 T;  3P50 A;  3RKG A;  2WZI A;  2XM1 A;  3FBL A;  4HFI A;  4UIG A;  4YY3 T;  5AQF B;  4I55 E;  5LA6 E;  1UX4 A;  4DV2 T;  4U2Y A;  4JI3 T;  1ZEE A;  2X0H A;  2JMH A;  3SWH A;  4YXD A;  1N36 T;  3FXD B;  4TN7 B;  2Q9Q A;  3K3N A;  3RIU C;  3AEG A;  2ZM8 A;  3CPZ A;  4A56 A;  3JAD A;  3FHN A;  4IIJ E;  4IE0 A;  4UR9 A;  3O4X E;  3J9X 1;  3UU6 A;  2CEA A;  5ABE A;  1SHZ C;  4HWI B;  2NW8 A;  5JDG A;  4EAH A;  3NZQ A;  4YFS A;  1HFA A;  3L09 A;  3L8R A;  4YTM A;  2KSR A;  5FNV E;  4WYV A;  5L3E B;  2W62 A;  3ONX A;  4L5G A;  3PUW F;  3FZF B;  2BS3 A;  2V6Y A;  3ZJ1 A;  2VQF T;  1FIO A;  3MAC A;  1HNW T;  1XZY A;  3MZK B;  3G06 A;  3ZT5 A;  2VB6 A;  4DBR A;  3P7I A;  3TLT A;  1NAF A;  3AB3 B;  2J62 A;  2VK9 A;  4GK0 E;  4H63 H;  4UVA B;  5AQL B;  4DBQ A;  2HHH T;  3AE9 A;  2XQ6 A;  5C3J A;  3AE2 A;  4O4H E;  2R6G F;  1IJ5 A;  1GQE A;  4H9S E;  3UUN A;  1G73 A;  5AQU B;  3AXJ A;  1HG2 A;  2RPA A;  2BVL A;  2V7I A;  1UUS A;  2N9D A;  1WYB A;  2E9X B;  3I0O A;  4O2B E;  1WCR A;  2XSB A;  2PTF A;  4PFP A;  3RX6 A;  2BKO A;  2MPK A;  5L47 A;  2WS3 A;  5LP6 E;  3CML A;  3T1H T;  2BS2 A;  5JR9 A;  2KXP B;  1VRB A;  2VL8 A;  4OYK A;  3V5U A;  1MIV A;  4EIW A;  1N33 T;  5JQG E;  2L9Q A;  4EEB A;  1HR0 T;  3LBX B;  4PJN A;  3AE5 A;  5LG3 A;  2KT9 A;  1IAP A;  4DR6 T;  2NP9 A;  2WB5 A;  3UUX B;  2MYS A;  5F8P A;  3CKD A;  2QGS A;  2JQ9 A;  2UXX B;  2VKD A;  1W9R A;  2X9W A;  5HEU A;  5AQH B;  3ZT6 A;  5FL1 A;  4DR1 T;  3CVR A;  2D2S A;  3PUR A;  1HCI A;  2I0M A;  2LRL A;  5IWA T;  4HFC A;  1SUM B;  5IUX A;  3RYH E;  2FUP A;  3A8Y C;  3A7M A;  3IEE A;  2KLQ A;  3P4Q A;  5FMN A;  4UXN B;  1MMN A;  2BS4 A;  4TZ4 C;  2KIN B;  2IDO B;  5LHG B;  4GIW A;  5LJN A;  3RI5 A;  5HEG A;  4IST A;  2XUE A;  2DWG A;  2BG9 B;  2HH7 A;  3VR8 A;  5HEJ A;  4QH1 A;  5JR9 B;  3LJC A;  1X79 A;  3AAA B;  4NUU A;  1KNP A;  1MMG A;  4JEU B;  1U5P A;  1D0Y A;  5JVD E;  4ZS3 A;  1V9D A;  2V7M A;  3JC6 C;  3HKE E;  2X66 A;  3IHR A;  4O4J E;  4PJM A;  5JH7 E;  4OYJ A;  3R6N A;  3W15 B;  2XQ5 A;  2J47 A;  2W63 A;  3RQW A;  3F2E A;  3H37 A;  1D0X A;  4IL9 A;  2IC9 A;  5AQO B;  4HWC A;  3PUZ F;  2HN1 A;  2CBJ A;  2LM2 A;  5JRC B;  3UFG A;  2BKP A;  3ETU A;  5LBM A;  3LSV A;  3NVO A;  3UU5 A;  4F6R C;  4B3R T;  2JIW A;  3ZYK A;  2BG9 A;  5JDQ A;  3ONJ A;  3P4S A;  4JI8 T; 
#chains in the Genus database with same CATH homology
 2LEH A;  3KIN B;  2XQY A;  4CI3 B;  4ERR A;  5DJQ C;  3Q5W A;  2XAS B;  3ZCJ A;  2V7L A;  3QUJ A;  4KP3 C;  5FP3 A;  3E08 A;  3ZYM A;  1OWA A;  5HWX A;  4ILU A;  3QC9 A;  1H7C A;  2M67 A;  5FXX A;  2DCF A;  2Z6E A;  4O8S A;  3ZMS B;  3EUH A;  4MFR A;  4H63 V;  4XAX B;  3ZC1 A;  4HFV A;  3KBU A;  5H6Q B;  4MAL A;  4H9N C;  3I0Q A;  5DAB A;  5IHY A;  3VU7 H;  4PJL A;  2C5K T;  5F3J A;  4ISS A;  4QHO A;  1BR1 A;  4EB6 E;  2ZMA A;  2CLY C;  5LHG B;  2NW9 A;  1VOM A;  2PFV A;  3ZPO A;  4AKH A;  4P0B A;  2PG8 A;  1ZV4 X;  2V7K A;  5LYJ E;  5L3G B;  2NW7 A;  2C5J A;  3N9N A;  3A5X A;  4AXP A;  4OK0 A;  2LJL A;  3ANW B;  2CE7 A;  4PFO A;  4EYY R;  4ZI2 C;  5IYZ E;  4QXB B;  3VHL A;  2NOX A;  3VKH A;  1D1B A;  3GN5 B;  2L8K A;  4ZI2 D;  5CA0 E;  4K0U A;  2ZLY A;  4AI6 A;  3KV6 A;  4UF0 B;  3SRZ A;  3T8O A;  1OXZ A;  3C64 A;  2CXF A;  3FXE B;  4WW0 A;  1FMV A;  2LSJ A;  3GWH A;  5JDL A;  3LK4 2;  2LSG A;  3CQX C;  3I9W A;  4TV8 E;  4ZS2 A;  4H9Q C;  2XHE B;  4DMW A;  5LG4 A;  3EDV A;  4JLE A;  3EDU A;  4DMV A;  3PUG A;  1IZN B;  4HEA A;  1D1A A;  1B7T A;  4CXX A;  5DQV A;  4E7Z A;  3RH3 A;  3PUA A;  4KUM B;  4N78 D;  3BQK A;  2PBI A;  3RRW A;  4BAY B;  3N9M A;  5L2L A;  4H9P C;  1T98 A;  5FXZ A;  2Q9Q C;  1YKH B;  4L0R A;  3DP7 A;  3ETV A;  1UCU A;  4B6X A;  4IHJ E;  2EHO D;  5BMV E;  2RP4 A;  1US7 B;  2B1E A;  2VAS A;  4O4I E;  2P9B A;  2H7V C;  3V5S A;  4EOZ B;  1HS7 A;  2JRK A;  2LM9 A;  2ODV A;  2E9X D;  3CX8 B;  4ANJ A;  3OYZ A;  5HXR A;  4WBN E;  3ZMV B;  4YHJ A;  1AJ3 A;  2I59 A;  4BJM A;  3AAI A;  2LHN A;  4ZI3 C;  2CLY B;  3RRC A;  3N9O A;  3NRY A;  1MMA A;  1Y64 B;  5E0O A;  3CX6 B;  4PK6 A;  4DND A;  1HF8 A;  1WYC A;  2CWY A;  4U72 A;  2D0U A;  5HXE A;  4WNK A;  4P0A A;  1UX5 A;  2H3R A;  2D0T A;  2LOP A;  1D1C A;  1KNZ A;  5JR9 C;  5J2U E;  5HXC A;  3BK9 A;  5CA1 E;  3OYX A;  3UUM A;  3F31 A;  5FY1 A;  4OFZ A;  2LOS A;  3F57 A;  3MK7 C;  3BQI A;  4IE6 A;  5ADX L;  1NWM X;  1U4Q A;  4HGA A;  4UV8 B;  4AQF A;  4C91 A;  2YU1 A;  2ODU A;  2MOZ A;  2KWH A;  2H7O A;  1QUU A;  2YIN A;  3C98 B;  1LKX A;  4OHF A;  3LBX A;  3PU8 A;  2DWK A;  5HAX A;  3N5L A;  5CB4 E;  2CWO A;  3LK2 B;  3N9Q A;  4DVD A;  5JDM A;  2IAK A;  3QK6 A;  3AVS A;  4AKR B;  2XAQ B;  4QX8 B;  3C4X A;  2Q9Q D;  2JPF A;  3AA7 B;  4FI5 A;  4P09 A;  4ZI7 E;  3GN5 A;  2K5B B;  3IBP A;  3CX7 B;  2CA5 A;  3UTK A;  1E1H B;  2WMO A;  4KBM B;  3ZCI A;  4FJO A;  4IDZ A;  3ANW A;  3CQC B;  4CI1 B;  4X20 E;  5LGT B;  2Y8D A;  2NTY A;  3IF8 B;  2IW5 B;  4NUV A;  3RYC E;  2HPL A;  3P8C D;  3WI3 A;  2ES0 A;  3MXZ A;  4EZ4 A;  4UVB B;  2EHO C;  3C4Z A;  3ZMT B;  5KMG P;  1HX8 A;  2ZM2 A;  1MNE A;  2X68 A;  1LRZ A;  5LXT E;  4UF0 A;  2E9X C;  2BZB A;  2NWB A;  3O1I A;  4F6R C;  1D0Z A;  1MMD A;  3PUQ A;  2XAF B;  4ZOL E;  4AKG A;  4IE7 A;  2D5U A;  2G0U A;  2WM9 A;  3SS1 A;  2YEV C;  4CI2 B;  1MIY A;  2JJ9 A;  3OKQ A;  4GYS A;  3HR0 A;  3PTR B;  2EHO B;  4IIJ E;  1SA0 E;  4I50 E;  2WBL A;  3UFE A;  3ZC0 A;  1WRD A;  4H9O C;  4ASK A;  4CXY A;  3DTO A;  2Y48 B;  3PU3 A;  1ZHC A;  1HG5 A;  4WBO A;  4GOU A;  5LGN B;  5LOV E;  3ZJ2 A;  3ZEF B;  5FY0 A;  4YJ2 E;  2MTQ A;  2IC6 A;  3ZN1 B;  4IE5 A;  3PE0 A;  4QXC B;  3U3I A;  2Q9Q B;  2SPC A;  2KWI B;  3KV4 A;  4X1K E;  3I1A A;  4G63 A;  4TV9 E;  2WAU A;  3R84 B;  3FBZ A;  3O1J A;  2X9H A;  4BA9 A;  2BDE A;  3NBX X;  2X67 A;  3I9Y A;  3RYI E;  1S94 A;  3EVY A;  3OBV E;  5JDH A;  3SOL A;  3Q9D A;  2DNX A;  4HE8 A;  2GK9 A;  1BR4 A;  3N9P A;  3RC8 A;  4I4T E;  2A2F X;  3RKO A;  4TUY E;  3H3A A;  4KMC A;  4AKL A;  3NRX A;  2KMF A;  2J1D G;  5EK4 A;  4MBQ A;  3LG7 A;  5EK2 A;  3AA6 B;  3PDY A;  4PK4 A;  2W00 A;  4JEH B;  3NZP A;  2NTX A;  3KVA A;  4XZC A;  4IE4 A;  2LSY A;  3CQG B;  3TKL B;  4AQF C;  3ESL A;  2CCQ A;  3KBT A;  4HN9 A;  4YLH A;  2DI4 A;  4PJJ A;  4QX7 B;  5LCY A;  3ZN0 B;  5L3B B;  5FY7 A;  4UV9 B;  3ZLI A;  3E22 E;  4PNI A;  3HL6 A;  5L3D B;  5LNK A;  4O2A E;  3WAJ A;  4BJN A;  5FYM A;  2V1D B;  3BQL A;  2V7J A;  2MBG A;  4ZI3 D;  1LVF A;  1ZKE A;  2V26 A;  4HTE A;  3WAK A;  5EK3 A;  2Y6X A;  3B57 A;  5J1G A;  2OA5 A;  2XAH B;  5LGU B;  2LSK A;  4QKN A;  3HKD E;  3N2O A;  4AKI A;  3C4W A;  4JUY A;  4MHC A;  1Z0P A;  3K8P C;  2XAG B;  3HKC E;  2X9Y A;  5HXH A;  5HXS A;  5L3F B;  5L3C B;  2DHR A;  3GMI A;  3K3O A;  2KZ7 B;  2YK0 A;  2W0G A;  4O4L E;  2HPJ A;  5JDN A;  2JMK A;  3KDS E;  1MIW A;  3MJX A;  2X9X A;  2E9X A;  3OJA A;  5H6R B;  4E7S A;  5GON E;  2CXD A;  3LK3 B;  2C5I T;  4ADZ A;  4U74 A;  1CUN A;  3UUL A;  2X0L B;  3GA8 A;  3AA0 B;  4DO0 A;  5FXV A;  5JRE A;  1FEW A;  1BR0 A;  3DJB A;  2WSS V;  4X1Y E;  5A1L A;  4PAG A;  4M1P A;  3VKG A;  1S35 A;  3AAE B;  3N2G E;  1LVK A;  2BVM A;  5M4Y A;  2PJQ A;  3KVB A;  2VWA A;  5FXW A;  3M65 A;  4CZZ B;  2A72 A;  1QSD A;  3Q2M A;  4PK5 A;  2LE8 A;  5HYA A;  1FMW A;  4L9I A;  3J7Y q;  2E8I A;  2VKO A;  1HTJ F;  4GYR A;  3UT5 E;  3PUS A;  4Z8X A;  4QWN B;  4XBF B;  2CXL A;  3RC3 A;  5AFU L;  2K9A A;  2DLR A;  3MKD A;  4UEM A;  5EZY E;  5LHH B;  1YD8 G;  2LHR A;  3LFM A;  4EXT A;  3O9X A;  4EZH A;  2LT3 A;  3AVR A;  4QXH B;  4TX5 A;  2ZM0 A;  4I43 B;  2L3L A;  2YU2 A;  4CQI A;  5LHI B;  3C50 A;  5DQW A;  4J2C A;  3N2K E;  4CXW A;  1G8X A;  3K3Q C;  3ZYL A;  5TAO A;  5J2T E;  3FB2 A;  1WLX A;  1EZ3 A;  2VKJ A;  3Q5X A;  4MLK A;  2W61 A;  3HI2 A;  3KFW X;  5KX5 E;  2K48 A;  4YJ3 E;  1O3X A;  1YKE B;  1YW0 A;  2A3D A;  2XAJ B;  3AA1 B;  2UXN B;  2X51 A;  2CMR A;  4IGU A;  4ZHQ E;  4V1A v;  5JDF A;  3RYF E;  3S4U A;  2RA1 A;  2LSI A;  3O1H A;  4HKA A;  3JC6 D;  3MA9 A;  3HKB E;  2XTL A;  3RPU A;  3KV5 A;  3N9L A;  5LJM A;  2N1G A;  3B13 A;  4X1I E;  1BR2 A;  3CWZ B;  1KK7 A;  2ACX A;  2K24 A;  3HA4 A;  4G2A A;  5HWY A;  1IJ6 A;  2CM0 A;  2VKH A;  3U78 A;  4UEL A;  2N2N A;  3D0T A;  4C90 A;  3C51 A;  2WMN A;  4AQG A;  5JRC A;  2WWU A;  1MND A;  4EYU A;  3ZMZ B;  3L3P A;  4GK5 E;  1WR6 A;  5KDM C;  2QA7 A;  4H9R C;  4PW8 A;  5LBQ B;  3ZMU B;  3KV9 A;  2JQQ A;  5ETW A;  2C0S A;  2KND A;  2EHO A;  3E0Z A;  4UVC B;  5C8Y E;  4UIG A;  3FBL A;  4I55 E;  5LA6 E;  1UX4 A;  1ZEE A;  2JMH A;  3SWH A;  3FXD B;  4TN7 B;  2Q9Q A;  3K3N A;  2ZM8 A;  3CPZ A;  4A56 A;  3FHN A;  4IE0 A;  3J9X 1;  3O4X E;  2CEA A;  1SHZ C;  2NW8 A;  5JDG A;  4EAH A;  3NZQ A;  4YFS A;  1HFA A;  3L09 A;  5FNV E;  5L3E B;  2W62 A;  3ONX A;  4L5G A;  3ZJ1 A;  1FIO A;  3MAC A;  3MZK B;  4DBR A;  2VB6 A;  3P7I A;  1NAF A;  3AB3 B;  4GK0 E;  2VK9 A;  4H63 H;  4UVA B;  4DBQ A;  4O4H E;  1IJ5 A;  4H9S E;  3UUN A;  1G73 A;  1HG2 A;  2BVL A;  2V7I A;  2N9D A;  3I0O A;  1WYB A;  2E9X B;  4O2B E;  4PFP A;  3RX6 A;  5LP6 E;  3CML A;  5JR9 A;  2KXP B;  1VRB A;  2VL8 A;  4OYK A;  3V5U A;  1MIV A;  4EIW A;  5JQG E;  2L9Q A;  3LBX B;  4PJN A;  2KT9 A;  1IAP A;  2NP9 A;  3UUX B;  2MYS A;  5F8P A;  3CKD A;  2QGS A;  2UXX B;  2VKD A;  2X9W A;  3CVR A;  2D2S A;  3PUR A;  1HCI A;  3RYH E;  3IEE A;  2KLQ A;  5FMN A;  4UXN B;  1MMN A;  4TZ4 C;  2KIN B;  4GIW A;  5LJN A;  4IST A;  2XUE A;  2DWG A;  2HH7 A;  5JR9 B;  3LJC A;  1X79 A;  3AAA B;  4NUU A;  1MMG A;  4JEU B;  1U5P A;  1D0Y A;  5JVD E;  4ZS3 A;  1V9D A;  2V7M A;  3JC6 C;  3HKE E;  2X66 A;  3IHR A;  4O4J E;  4PJM A;  5JH7 E;  4OYJ A;  3R6N A;  3W15 B;  2W63 A;  3F2E A;  3H37 A;  1D0X A;  2IC9 A;  5JRC B;  5LBM A;  3ETU A;  3ZYK A;  5JDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...