2JRKA

Nmr structure and epitope mapping of blo t 5
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
112
structure length
112
Chain Sequence
KKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear magnetic resonance structure and IgE epitopes of Blo t 5, a major dust mite allergen
pubmed rcsb
source organism Blomia tropicalis
molecule tags Allergen
molecule keywords Mite allergen Blo t 5
total genus 34
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2007-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.970 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2jrkA00
2LM9A 2JRKA 2JMHA
chains in the Genus database with same CATH superfamily
5HEOA 3N2GE 5L3GB 5CB4E 4ZHQE 3J7Yq 1UCUA 2DI4A 4EV6A 4WZXA 1YXRA 2XUEA 4NXMT 2YEVC 4E7ZA 3ZC1A 3NVOA 3C4ZA 1N33T 1XMOT 3CWZB 2FJDA 3QOFA 3NRYA 1KF6A 2J47A 5FY1A 3ZN1B 1MIWA 3AE2A 3ONLC 3H37A 2NW9A 1IJ6A 2CWYA 2R6GF 3ZT7A 3HKBE 3MKDA 4KUMB 2YINA 3B57A 1T8BA 1LKXA 4QWNB 5CA0E 2AE9A 2ES0A 4KP3C 1VRBA 4AXPA 2WB5A 3P4WA 3T1HT 2ACXA 4G63A 2WM9A 2MOZA 4FI5A 5LA6E 4JI4T 5J2TE 1XNRT 1HX8A 2WDVA 4AKHA 2CHOA 4L5GA 4ZI3C 4L9IA 4KHPT 5CA1E 1HG5A 2WZIA 3H3AA 2VK9A 2L8KA 3O9XA 2BS4A 3EDVA 4QXCB 4PAGA 3AA6B 3CQGB 5L3DB 3JC6D 2BDEA 2XQ5A 5DQVA 4EZ4A 1G8XA 2V8SV 4LF9T 3FZKB 3MK7C 3RYCE 5JH7E 4HWCA 3RGLA 2KMFA 4HE8A 3ZEFB 5JRCA 4OK0A 2V7IA 3M65A 4I55E 3VKHA 3ZMVB 1W9RA 5BMVE 4A97A 3CIRA 4JI0T 3B13A 2YK0A 1VOMA 2NR4A 2Z6EA 2XQAA 3HA4A 2LSGA 4IE4A 4ILUA 3NWIA 5JR9C 5AQFB 3IF8B 3BQIA 1U4QA 2CCQA 3MJXA 4MHCA 2IW5B 5HYAA 1J5ET 3AEBA 4U7YA 2QGSA 1BR1A 4YTMA 2W2UA 2E2AA 3U78A 4AQFA 2C5KT 3FB2A 1ZV4X 1FMWA 1E7PA 3AEDA 4CN6A 3E0ZA 5HXHA 2FJBA 5LJMA 3VU7H 2YDRA 2V7KA 4X65T 3V5SA 1ZEEA 1XDPA 2JPFA 4TZ4C 1FEWA 5FXZA 3RF1A 3RLFF 3RRCA 2XAGB 4QXHB 3RYFE 3RQWA 5F3JA 3N9NA 4GKKT 2X9HA 3L3PA 4WYVA 1AJ3A 5AQSB 3ONJA 3Q5WA 3QNUA 1NAFA 4YLHA 3RPUA 4Z90A 1L0VA 3SFEA 4EZHA 3FZLB 1IZNB 3ZMUB 2EHOC 1QSDA 2WP9A 3C4WA 3UU4A 1U5PA 2A72A 2XAHB 2HPJA 3AECA 3LDQB 4GYSA 1JNRA 4U2ZA 2VQFT 2VQET 5JVDE 2MYSA 3PUWF 3VR9A 1KNRA 4NUUA 3SS1A 3RKOA 3TLSA 3FBLA 2LSYA 3WAJA 2JMKA 3N9QA 3PURA 3K1SA 5L47A 3EHZA 5HWXA 4BAYB 2WU2A 5LGTB 4OYJA 2V1DB 2BG9E 3SOLA 2WMOA 3T8OA 4P0BA 4V1Av 2Q9QC 1S35A 4ISSA 3UUXB 4DMWA 4EGWA 5ABFA 3T1YT 3Q5EA 2UXDT 4F6RC 1I6ZA 2ODUA 3P4SA 1YQ4A 2XY8B 1CHUA 3NKZA 4N78D 4YHJA 4DVDA 3RIFA 3PJAA 3N5LA 4HWDA 4MLKA 1E2AA 5LBQB 4M1PA 3P4RA 3ANWA 5J2UE 5JDFA 5L4EA 4GYRA 1BR4A 1UK5A 2FJAA 3A8YC 2LLYA 2V7JA 2BKOA 2X9YA 3P4QA 1UURA 4JEUB 3ZPOA 5FXVA 5AQGB 2P9BA 4YTNA 2V5DA 2XHEB 3BQKA 4XAXB 2UU9T 3RIAA 3TLWA 3LG7A 4UVBB 3NZPA 3ZMSB 3ZMTB 1IBLT 4DR4T 3F2EA 3PUAA 4JYAT 1Y01A 2W4XA 3MACA 3L39A 3RKGA 4DBQA 5KX5E 5HXCA 4DR6T 2B1EA 3M3ZB 2XAQB 4ZI2C 5LB7B 2WS3A 5HXEA 3KBTA 2CEAA 5LGNB 3K3QC 3SFDA 3PU3A 2UUAT 2NW7A 2QVAA 5JDHA 5LMUT 1D1BA 2HN2A 4QH5A 3AA1B 3GN5A 4GOUA 5E0OA 5ABEA 3ABVA 4ERRA 3KV6A 5AFUL 2IC6A 4X5TA 2XTLA 2ZLYA 2V7MA 3CQCB 1XNQT 1H7CA 2XQ4A 3HI2A 4ILAA 2XM1A 2L3LA 2Q9QB 1MNDA 3PUZF 4NXNT 3AEAA 3K8PC 2MAWA 3C50A 4FJOA 2KZ7B 3TLUA 2HN1A 2A3DA 1UUSA 3F31A 2JQQA 2NW8A 3JCFA 5FVLA 4PJLA 4ADZA 1KNZA 4EYUA 3E08A 5AQRB 2IDOB 4IL9A 2W0GA 1VCSA 1NENA 5DQWA 4EOZB 2E9XC 4YJ2E 2X66A 3KBUA 4O4IE 4QX7B 2LEHA 2AXDS 4ILBA 4K0UA 4U31A 5AQOB 1FMVA 5HCMA 2I59A 2F4VT 2Y6XA 4DUYT 2VVSA 4U7IA 4WBNE 3CX7B 5IHYA 4P1NA 1G73A 2KT9A 2RPAA 3GMIA 2I6HA 4O8SA 5JR9A 2FBWA 4LF6T 2ZM0A 4KMCA 1WR6A 2H3RA 3L8RA 2BVMA 4GK0E 5CGMA 3P8CD 2MPKA 1BR0A 4YFSA 2PFVA 1KEYA 4TX5A 1NEKA 2V26A 2N2NA 2VL0A 3EI0A 1X79A 2RP4A 4OFZA 5F5WA 4DV5T 1KK7A 2WSSV 5AQJB 4H9QC 1UGOA 3JAFA 2VKDA 3B5MA 3I0OA 4DNDA 2E5VA 4JI8T 4AQGA 4DMVA 3FZHB 3Q9DA 3OBVE 3D0TA 3AE9A 1HX1B 2W62A 1M62A 3AAIA 3K3NA 3H3MA 5HEHA 3UU5A 2UXCT 3NRXA 3N2KE 5FXWA 5FL1A 2JRKA 3LBXA 5AQKB 3AEFA 2WQYA 2LHRA 2DWKA 2J1DG 2PBIA 2WAUA 3LFMA 4Z91A 3QC9A 5FXXA 3AVRA 3N9PA 5LJNA 4QH1A 2G0UA 1XZYA 2K5BB 2MTQA 2ZM8A 5FYMA 2N1GA 4ZZCA 5KDMC 4WNKA 1UX5A 1J5WA 2XSBA 3PU8A 5AQHB 5AQNB 5HAXA 2V6YB 5JDLA 5J0ZA 2EHOD 4MBQA 5FKYA 4CZZB 1N34T 2RA1A 4YJ3E 4QH4A 4UEMA 1V9DA 3R6NA 5J1GA 5LXTE 2W67A 5JDQA 4XBFB 2NP9A 2JIWA 2NOXA 1QLBA 3HL6A 1M7KA 3QB5A 1OEDC 4HFIA 4HFVA 4IE6A 4TWHA 3ZT6A 1FJGT 1ZOYA 2WY2A 5LOVE 5L3FB 3TLVA 4EIWA 4L0RA 3N9LA 1MMAA 4DR5T 3FZMB 1T72A 2X67A 3PUSA 4DV3T 2XSAA 3L09A 5LP6E 4CI1B 4DR7T 1YKHB 4PK6A 3TKLB 4GIWA 4IE5A 4TUYE 2CMRA 2CXLA 2K9AA 1OEDE 4IT4A 4O4HE 4TV9E 2V7LA 2LSJA 1UX4A 3WI3A 3PUYF 5JDMA 1XMQT 2ZMAA 4OHFA 2PTFA 3PUGA 4IE7A 3I9WA 2X68A 4I43B 3VR8A 2LJLA 3MXZA 3UFEA 4PK5A 5FNVE 4BJMA 4X1YE 5LBMA 5M4YA 4LF5T 1KFYA 2V6YA 4UV9B 5HEUA 5IWAT 2BS2A 4HWIB 5EZYE 4UVAB 1LRZA 5EK4A 4AI6A 2LRLA 5JQGE 3RRWA 4ZXLA 4HWFA 5LMNT 4YXDA 4EEDA 4B3TT 4A56A 2Q9QD 2W61A 3AB3B 4IE0A 3V5UA 3AEGA 1Z8UA 1D0ZA 3VHLA 1FIOA 4QHOA 2IUBA 2A9UA 3AE3A 4I0UA 3UUMA 4HFCA 4DUZT 3EAMA 3KV9A 2X51A 3I1AA 1EZ3A 3C51A 4H63V 2E9XA 2BG9A 4EB6E 4DV7T 3AAAB 3ZSSA 4PJJA 1Y64B 3LK3B 4C90A 4OX9T 5CFBA 1HTJF 3EDUA 4X1KE 3CQXC 4LMJA 3SRZA 5L3BB 5FMNA 2DHRA 2CRBA 1HF8A 3DTOA 3JC6C 2H7VC 2WMNA 4PFOA 3RIUC 3AE7A 4AIUA 2CM0A 5FY7A 4JI1T 1XDOA 2M67A 3FBZA 1MMDA 2CBIA 3EUHA 2BKNA 2XZEA 2D0TA 3FZFB 3LJCA 4HFBA 4IL4A 3ZLIA 2QRXA 4B3RT 2VVNA 3EVYA 4U2YA 2A2FX 2CPTA 3DP7A 4JV5T 4UIGA 2C5JA 5FVKA 2YN6A 4HTEA 4O4JE 3CMLA 1T7SA 4KBMB 5LG3A 2FUPA 3EABA 3QB5K 2VL8A 4JI7T 3ETVA 2HPLA 3IA3A 4DIDB 2WDQA 4YY3T 2YKSA 4JI5T 3MA9A 3QK6A 3JADA 2JQHA 2VASA 2UXXB 1IBKT 4DV4T 2CE7A 4A5XA 2DLRA 2LHNA 2Q9QA 2LE8A 3LBXB 4IDQA 3LK2B 4U74A 4DR2T 4P0AA 1OXZA 3ZKRA 3PV0F 2IMLA 4UV8B 4AKRB 4YT0A 2B76A 2LOSA 2E9XD 2LKGA 2XQ3A 3ZCJA 3PDYA 4ZS2A 2KINB 4X66T 2H88A 1D0YA 2I0MA 4LF4T 3CX8B 1JNZA 3FHNA 3PTRB 2MBGA 3ZYMA 5LYJE 4X62T 4DV1T 3AE5A 4C91A 2XJ7A 4EAHA 4DV2T 3ZCIA 3ZSTA 3UUBA 3HKCE 5L2LA 3UU6A 5C8YE 2NTXA 5FP3A 4DR3T 2CLYB 4B3ST 4CN1A 2W63A 3P50A 2C0SA 3O1IA 2GK9A 5TAOA 4EYYR 1SHZC 5C2TA 3W15B 2BS3A 4G2AA 1US7B 2J4GA 2KSRA 3OKQA 4HN9A 3RQUA 2X0YA 5JR9B 3OYXA 1MIVA 3K3OA 2VKHA 1WCRA 2N9DA 2NTYA 2WU5A 4MALA 4XZCA 4ZI7E 3N9MA 1IBMT 1W0AA 4AKGA 2KNDA 2LOPA 2XAJB 3ANWB 1D1AA 3KFWX 3N2OA 4JBWF 4CN4A 5JTGA 4ZEYA 2LM2A 2LSIA 3C98B 3ETUA 3FXEB 3NBXX 3ONXA 2KXPB 2WBLA 3ZT5A 5ABFB 4DV0T 1HCIA 2UUBT 5JREA 1WR0A 4UVCB 3AA7B 4CI2B 3G06A 4H9PC 3GA8A 4HWHA 2BBHA 2M6BA 2YDQA 4PK4A 4TWDA 4UF0A 3A7MA 3TLTA 4A98A 5KMGP 2H89A 3MZKB 5LGUB 3P7IA 2CLYC 1HNWT 1T98A 2JJ9A 2JQKA 2XPKA 3LK42 4AISA 4CXWA 4U72A 1WFDA 2W66A 4H9SE 3CPZA 4ISTA 2HHHT 1YW0A 4LFCT 3JAEA 4CI3B 4JI3T 4LFAT 4AKIA 2DCFA 5EK3A 3U3IA 4NUVA 3UU3A 4AKLA 1HR0T 3QUJA 2VURA 2V6XA 1D1CA 2XQ8A 4KHZF 4ZS3A 5AQPB 4LMKA 4JI2T 1LVKA 2VWAA 3SWHA 2LM9A 4IDNA 2YOEA 2E5LT 5CJ5A 3ZYKA 4IIJE 1YKEB 2CXFA 4AQFC 1SUMB 1MIYA 1LVFA 3AAEB 1OWAA 3PUVF 3RX6A 3BQLA 1NWMX 3PUQA 5FY0A 3AVSA 2LKHA 2VB6A 4IREA 4PNIA 3RYHE 4COFA 5LHIB 3IEEA 4QX8B 2PJQA 3ZN0B 4MFRA 3RC3A 4YTPA 2X9XA 2XASB 1N32T 4TNVA 4AQYT 4HFHA 4HGAA 5GONE 5HEGA 4PJMA 3X1DA 5KXJA 5LHHB 2XQ9A 2WWVA 5JDGA 2XM2A 5AQTB 3UU8A 2ODVA 2DNXA 3ZJ2A 5EK2A 4H9OC 4GK5E 1XWMA 3KVBA 4H9NC 4UELA 4WBOA 2IIUA 4LF8T 3UFGA 3ZYLA 3KDSE 2W00A 4HFEA 2C5IT 3GWHA 4U3CA 3A5XA 2XQ6A 1HFAA 2J62A 4IDOA 4X1IE 4LF7T 4HKAA 4YSZA 3Q5DA 1W0BA 2M6IA 1HNXT 4B3MT 1WLXA 5AQUB 2KWHA 3ESLA 1J1JA 4ANJA 4JLEA 5H6RB 3R84B 3S4UA 2UUCT 4JEHB 1Z0PA 2D5UA 4Z8XA 2DL1A 4CXYA 1HS7A 2EHOB 2D9DA 4TN7B 2WZHA 4UR9A 3GN5B 5HXRA 4ZOLE 4QKNA 3OJAA 2ZM2A 1HG2A 4DBRA 2YU1A 2XQYA 2Y8DA 4KI0F 3Q5XA 4NIQA 3O4XE 3RH3A 4X20E 2L9QA 2UXNB 3O1JA 4EXTA 3O1HA 1DU2A 2E9XB 2IC9A 1OEDA 3DJBA 2WCAA 4Q25A 4TV8E 5AQQB 4CQIA 4YSXA 5LG4A 1ZHCA 4H63H 1MMNA 2YU2A 4DR1T 3HR0A 2BKPA 3FXDB 4IHJE 3AE6A 3OVUA 4O2AE 5DABA 2OA5A 5H6QB 5C3JA 4H9RC 5HXSA 4JI6T 2ZM6T 2LSKA 3VRAA 2FJEA 4PW8A 2CHNA 4O2BE 4PJNA 1MNEA 1SE7A 2LRKA 2BVLA 2QYWA 2VKOA 3N9OA 4EEBA 2CWOA 3CX6B 3NZQA 4P09A 1W09A 1YD8G 5JDNA 1CUNA 3WAKA 5L3CB 4O4LE 2LT3A 1KNPA 4U33A 4TWFA 2KLQA 3KINB 5JRCB 4J2CA 5F8PA 1BR2A 1X9BA 4K0KT 1D0XA 4JUYA 3RI5A 4BJNA 4IDZA 3UULA 3ZC0A 5L3EB 1R8IA 3E22E 2IHR1 3AXJA 4NPPA 3OPCA 4I50E 4QXBB 5AQIB 3RHWA 4CXXA 3UUNA 2D0UA 3CK6A 5LCYA 4E7SA 1OEDB 5LNKA 3LSVA 3OYZA 4ASKA 3J9X1 3UQ7A 3PJAJ 3RC8A 1GQEA 2NWBA 3KV4A 2E8IA 5HCJA 4DV6T 2JMHA 3C64A 3PE0A 5ETWA 1N36T 1I94T 5AQLB 4B6XA 3UTKA 2HH7A 2OV9A 3AE8A 2DWGA 4OYKA 1WYBA 1WYCA 2BG9C 3AEEA 5FL0A 2UXBT 5DJQC 2XQ7A 5AQVB 2K3WA 2H7OA 2VKJA 4PFPA 3UT5E 3CKDA 4ZZBA 4GKJT 4IGUA 1WRDA 1YQ3A 5L4HA 5A1LA 1E1HB 2D2SA 3KVAA 2X0LB 3PUXF 1SA0E 4I4TE 5AQMB 4YHHT 4ZI2D 3VRBA 3I9YA 3AE4A 4ILCA 4DO0A 3RIUA 5LHGB 3ZJ1A 3RYIE 1MMGA 2BBJA 3P4PA 2IAKA 4UXNB 2EHOA 2WWUA 2X9WA 5ADXL 4LMLA 3VKGA 1ZKEA 5ABHA 5IUXA 4ZI3D 3AE1A 5ABGA 2KWIB 3KV5A 4BA9A 2JQ9A 1HNZT 4LFBT 3Q2MA 2CBJA 4YSYA 3OTOT 1IAPA 2YDSA 5HWYA 2ACZA 2Y48B 3BK9A 1S94A 4KX6A 1B7TA 2CA5A 2SPCA 1IJ5A 5HEJA 1QUUA 3F57A 2PG8A 2CXDA 1VCTA 2BZBA 3AXJB 3C4XA 3AA0B 3UQ4A 4HFDA 2BG9B 3ZMZB 2XAFB 4X64T 2V5CA 3HKDE 3IBPA 2OLTA 4TNWA 4WW0A 1ZP0A 3CVRA 4F8HA 3HKEE 2K48A 4IDPA 2QA7A 3I0QA 5BR8T 4UF0B 4HEAA 2K24A 5IYZE 2X0HA 3IHRA 2WDRA 1O3XA
chains in the Genus database with same CATH topology
3N2GE 5L3GB 5CB4E 4ZHQE 3J7Yq 1UCUA 2DI4A 2XUEA 2YEVC 4E7ZA 3ZC1A 3C4ZA 3CWZB 3NRYA 5FY1A 3ZN1B 1MIWA 3H37A 2NW9A 1IJ6A 2CWYA 3HKBE 3MKDA 4KUMB 2YINA 3B57A 1LKXA 4QWNB 5CA0E 2ES0A 4KP3C 1VRBA 4AXPA 2ACXA 4G63A 2WM9A 2MOZA 4FI5A 5LA6E 5J2TE 1HX8A 4AKHA 4L5GA 4ZI3C 4L9IA 5CA1E 1HG5A 3H3AA 2VK9A 2L8KA 3O9XA 3EDVA 4QXCB 4PAGA 3AA6B 3CQGB 5L3DB 3JC6D 2BDEA 5DQVA 4EZ4A 1G8XA 3MK7C 3RYCE 5JH7E 2KMFA 4HE8A 3ZEFB 5JRCA 4OK0A 2V7IA 3M65A 4I55E 3VKHA 3ZMVB 5BMVE 3B13A 2YK0A 1VOMA 2Z6EA 3HA4A 4ILUA 2LSGA 4IE4A 5JR9C 3IF8B 3BQIA 1U4QA 2CCQA 3MJXA 4MHCA 2IW5B 5HYAA 2QGSA 1BR1A 3U78A 4AQFA 2C5KT 3FB2A 1ZV4X 1FMWA 3E0ZA 5HXHA 5LJMA 3VU7H 2V7KA 3V5SA 1ZEEA 2JPFA 5FXZA 4TZ4C 1FEWA 3RRCA 2XAGB 4QXHB 3RYFE 5F3JA 3N9NA 2X9HA 3L3PA 1AJ3A 3Q5WA 1NAFA 4YLHA 3RPUA 1IZNB 3ZMUB 2EHOC 3C4WA 1QSDA 1U5PA 2A72A 2XAHB 2HPJA 4GYSA 5JVDE 2MYSA 4NUUA 3SS1A 3RKOA 3FBLA 2LSYA 3WAJA 2JMKA 3N9QA 3PURA 5HWXA 4BAYB 5LGTB 4OYJA 2V1DB 3SOLA 2WMOA 3T8OA 4P0BA 4V1Av 2Q9QC 1S35A 4ISSA 3UUXB 4DMWA 4F6RC 2ODUA 4N78D 4YHJA 4DVDA 3N5LA 4MLKA 5LBQB 4M1PA 3ANWA 5J2UE 5JDFA 4GYRA 1BR4A 4JEUB 2X9YA 2V7JA 4A56A 5FXVA 2P9BA 3BQKA 2XHEB 4XAXB 3LG7A 4UVBB 3NZPA 3ZMSB 3ZMTB 3F2EA 3PUAA 3MACA 5KX5E 4DBQA 5HXCA 2B1EA 4ZI2C 2XAQB 5HXEA 3KBTA 2CEAA 5LGNB 3K3QC 3PU3A 2NW7A 5JDHA 1D1BA 3GN5A 3AA1B 4GOUA 5E0OA 4ERRA 3KV6A 5AFUL 2IC6A 2XTLA 2ZLYA 2V7MA 3CQCB 1H7CA 3HI2A 2L3LA 2Q9QB 1MNDA 3K8PC 3C50A 4FJOA 2KZ7B 5LGUB 2A3DA 3F31A 2JQQA 2NW8A 1KNZA 4ADZA 4PJLA 4EYUA 3E08A 2W0GA 5DQWA 4EOZB 2E9XC 4YJ2E 2X66A 3KBUA 4O4IE 4QX7B 2LEHA 3ZPOA 4K0UA 1FMVA 2I59A 2Y6XA 4WBNE 3CX7B 5IHYA 5JR9A 1G73A 2KT9A 3GMIA 4O8SA 2ZM0A 4KMCA 1WR6A 2H3RA 2BVMA 4GK0E 3P8CD 1BR0A 4YFSA 2PFVA 4TX5A 2V26A 2N2NA 1X79A 2RP4A 4OFZA 1KK7A 2WSSV 4H9QC 2VKDA 3I0OA 4DNDA 4AQGA 4DMVA 3Q9DA 3OBVE 3D0TA 2W62A 3AAIA 3K3NA 3NRXA 3N2KE 5FXWA 2JRKA 3LBXA 2LHRA 2DWKA 2J1DG 2PBIA 2WAUA 3LFMA 3QC9A 5FXXA 3AVRA 3N9PA 5LJNA 2G0UA 2K5BB 2MTQA 2ZM8A 5FYMA 2N1GA 5KDMC 4WNKA 1UX5A 3PU8A 5HAXA 5JDLA 2EHOD 4MBQA 4CZZB 2RA1A 4YJ3E 4UEMA 1V9DA 3R6NA 5J1GA 5LXTE 5JDQA 4XBFB 2NP9A 2NOXA 3HL6A 4IE6A 4HFVA 5LOVE 5L3FB 4EIWA 4L0RA 3N9LA 1MMAA 2X67A 3PUSA 3L09A 5LP6E 4CI1B 1YKHB 4PK6A 3TKLB 4GIWA 4IE5A 4TUYE 2CMRA 2CXLA 2K9AA 4O4HE 4TV9E 2V7LA 2LSJA 1UX4A 3WI3A 5JDMA 2ZMAA 4OHFA 3PUGA 3I9WA 2X68A 4I43B 2LJLA 3MXZA 3UFEA 4PK5A 5FNVE 4BJMA 4X1YE 5LBMA 5M4YA 4UV9B 5EZYE 4UVAB 1LRZA 5EK4A 4AI6A 5JQGE 3RRWA 2Q9QD 2W61A 3AB3B 4IE0A 3V5UA 3VHLA 1D0ZA 1FIOA 4QHOA 3UUMA 3KV9A 2X51A 3I1AA 1EZ3A 3C51A 4H63V 2E9XA 4EB6E 3AAAB 4PJJA 1Y64B 3LK3B 4C90A 1HTJF 3EDUA 4X1KE 3CQXC 3SRZA 5L3BB 5FMNA 2DHRA 3DTOA 1HF8A 3JC6C 2H7VC 2WMNA 4PFOA 2CM0A 5FY7A 2M67A 3FBZA 1MMDA 3EUHA 4IE7A 3LJCA 3ZLIA 2D0TA 3EVYA 2A2FX 3DP7A 4UIGA 2C5JA 4HTEA 4O4JE 3CMLA 4KBMB 2VL8A 3ETVA 2HPLA 3MA9A 3QK6A 2VASA 2UXXB 2CE7A 2DLRA 2LHNA 2Q9QA 2LE8A 3LBXB 4U74A 3LK2B 4P0AA 1OXZA 4UV8B 4AKRB 2LOSA 2E9XD 3ZCJA 3PDYA 4ZS2A 2KINB 1D0YA 3CX8B 3FHNA 2MBGA 3PTRB 3ZYMA 5LYJE 4C91A 4EAHA 3ZCIA 5L2LA 3HKCE 5C8YE 2NTXA 5FP3A 2CLYB 2W63A 2C0SA 3O1IA 2GK9A 5TAOA 4EYYR 1SHZC 3W15B 4G2AA 1US7B 3OKQA 4HN9A 5JR9B 3OYXA 1MIVA 3K3OA 2VKHA 2N9DA 2NTYA 4MALA 4XZCA 4ZI7E 3N9MA 4AKGA 2KNDA 2LOPA 2XAJB 3ANWB 1D1AA 3KFWX 3N2OA 3ETUA 2LSIA 3C98B 3NBXX 3FXEB 3ONXA 2KXPB 2WBLA 1HCIA 5JREA 4UVCB 3AA7B 4CI2B 4H9PC 3GA8A 4UF0A 4PK4A 5KMGP 3MZKB 3P7IA 2CLYC 1T98A 2JJ9A 4CXWA 3LK42 4U72A 4H9SE 3CPZA 4ISTA 1YW0A 4CI3B 4AKIA 2DCFA 5EK3A 3U3IA 4NUVA 4AKLA 3QUJA 1D1CA 4ZS3A 1LVKA 2VWAA 3SWHA 2LM9A 3ZYKA 4IIJE 1YKEB 2CXFA 4AQFC 1MIYA 1LVFA 3AAEB 1OWAA 3RX6A 3BQLA 1NWMX 3PUQA 5FY0A 3AVSA 2VB6A 3RYHE 5LHIB 4PNIA 3IEEA 4QX8B 2PJQA 3ZN0B 4MFRA 3RC3A 2X9XA 2XASB 4HGAA 5GONE 4PJMA 5LHHB 5JDGA 2ODVA 2DNXA 3ZJ2A 5EK2A 4H9OC 4GK5E 3KVBA 4H9NC 4UELA 4WBOA 3ZYLA 4EZHA 3KDSE 2W00A 2C5IT 3GWHA 3A5XA 4X1IE 1HFAA 4HKAA 1WLXA 2KWHA 3ESLA 4ANJA 4JLEA 5H6RB 3R84B 3S4UA 4JEHB 1Z0PA 2D5UA 4Z8XA 4CXYA 1HS7A 2EHOB 4TN7B 3GN5B 5HXRA 4ZOLE 4QKNA 3OJAA 2ZM2A 1HG2A 4DBRA 2YU1A 2XQYA 2Y8DA 3RH3A 3Q5XA 3ZJ1A 3O4XE 4X20E 2L9QA 2UXNB 3O1JA 4EXTA 3O1HA 2E9XB 2IC9A 3DJBA 4TV8E 4CQIA 5LG4A 1ZHCA 4H63H 1MMNA 2YU2A 3HR0A 3FXDB 4IHJE 4O2AE 5DABA 5HXSA 2OA5A 5H6QB 4H9RC 2LSKA 4PW8A 4O2BE 4PJNA 1MNEA 2VKOA 3N9OA 2BVLA 2CWOA 3CX6B 3NZQA 4P09A 1YD8G 5JDNA 1CUNA 3WAKA 5L3CB 4O4LE 2LT3A 2KLQA 3KINB 5JRCB 4J2CA 5F8PA 1BR2A 1D0XA 4JUYA 4BJNA 4IDZA 3UULA 3ZC0A 5L3EB 3E22E 4CXXA 4QXBB 4I50E 4E7SA 5LNKA 3UUNA 2D0UA 5LCYA 4ASKA 3OYZA 3J9X1 3RC8A 2NWBA 3KV4A 2E8IA 2JMHA 3C64A 3PE0A 5ETWA 4B6XA 3UTKA 2HH7A 2DWGA 4OYKA 1WYBA 1WYCA 5DJQC 2H7OA 2VKJA 4PFPA 3UT5E 3CKDA 4IGUA 1WRDA 5A1LA 1E1HB 2D2SA 3KVAA 2X0LB 4I4TE 1SA0E 4ZI2D 3I9YA 4DO0A 5LHGB 3RYIE 1MMGA 2IAKA 4UXNB 2EHOA 2WWUA 2X9WA 5ADXL 3VKGA 1ZKEA 4ZI3D 2KWIB 3KV5A 4BA9A 3Q2MA 1IAPA 5HWYA 2Y48B 3BK9A 1S94A 1B7TA 2CA5A 2SPCA 1IJ5A 1QUUA 3F57A 2PG8A 2CXDA 3C4XA 2BZBA 3ZMZB 3AA0B 2XAFB 3HKDE 3IBPA 4WW0A 3CVRA 3HKEE 2K48A 2QA7A 3I0QA 4UF0B 4HEAA 2K24A 5IYZE 3IHRA 1O3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LM9 A;  2JRK A;  2JMH A; 
#chains in the Genus database with same CATH topology
 5HEO A;  3N2G E;  5L3G B;  5CB4 E;  4ZHQ E;  3J7Y q;  1UCU A;  2DI4 A;  4EV6 A;  4WZX A;  1YXR A;  2XUE A;  4NXM T;  2YEV C;  4E7Z A;  3ZC1 A;  3NVO A;  3C4Z A;  1N33 T;  1XMO T;  3CWZ B;  2FJD A;  3QOF A;  3NRY A;  1KF6 A;  2J47 A;  5FY1 A;  3ZN1 B;  1MIW A;  3AE2 A;  3ONL C;  3H37 A;  2NW9 A;  1IJ6 A;  2CWY A;  2R6G F;  3ZT7 A;  3HKB E;  3MKD A;  4KUM B;  2YIN A;  3B57 A;  1T8B A;  1LKX A;  4QWN B;  5CA0 E;  2AE9 A;  2ES0 A;  4KP3 C;  1VRB A;  4AXP A;  2WB5 A;  3P4W A;  3T1H T;  2ACX A;  4G63 A;  2WM9 A;  2MOZ A;  4FI5 A;  5LA6 E;  4JI4 T;  5J2T E;  1XNR T;  1HX8 A;  2WDV A;  4AKH A;  2CHO A;  4L5G A;  4ZI3 C;  4L9I A;  4KHP T;  5CA1 E;  1HG5 A;  2WZI A;  3H3A A;  2VK9 A;  2L8K A;  3O9X A;  2BS4 A;  3EDV A;  4QXC B;  4PAG A;  3AA6 B;  3CQG B;  5L3D B;  3JC6 D;  2BDE A;  2XQ5 A;  5DQV A;  4EZ4 A;  1G8X A;  2V8S V;  4LF9 T;  3FZK B;  3MK7 C;  3RYC E;  5JH7 E;  4HWC A;  3RGL A;  2KMF A;  4HE8 A;  3ZEF B;  5JRC A;  4OK0 A;  2V7I A;  3M65 A;  4I55 E;  3VKH A;  3ZMV B;  1W9R A;  5BMV E;  4A97 A;  3CIR A;  4JI0 T;  3B13 A;  2YK0 A;  1VOM A;  2NR4 A;  2Z6E A;  2XQA A;  3HA4 A;  2LSG A;  4IE4 A;  4ILU A;  3NWI A;  5JR9 C;  5AQF B;  3IF8 B;  3BQI A;  1U4Q A;  2CCQ A;  3MJX A;  4MHC A;  2IW5 B;  5HYA A;  1J5E T;  3AEB A;  4U7Y A;  2QGS A;  1BR1 A;  4YTM A;  2W2U A;  2E2A A;  3U78 A;  4AQF A;  2C5K T;  3FB2 A;  1ZV4 X;  1FMW A;  1E7P A;  3AED A;  4CN6 A;  3E0Z A;  5HXH A;  2FJB A;  5LJM A;  3VU7 H;  2YDR A;  2V7K A;  4X65 T;  3V5S A;  1ZEE A;  1XDP A;  2JPF A;  4TZ4 C;  1FEW A;  5FXZ A;  3RF1 A;  3RLF F;  3RRC A;  2XAG B;  4QXH B;  3RYF E;  3RQW A;  5F3J A;  3N9N A;  4GKK T;  2X9H A;  3L3P A;  4WYV A;  1AJ3 A;  5AQS B;  3ONJ A;  3Q5W A;  3QNU A;  1NAF A;  4YLH A;  3RPU A;  4Z90 A;  1L0V A;  3SFE A;  4EZH A;  3FZL B;  1IZN B;  3ZMU B;  2EHO C;  1QSD A;  2WP9 A;  3C4W A;  3UU4 A;  1U5P A;  2A72 A;  2XAH B;  2HPJ A;  3AEC A;  3LDQ B;  4GYS A;  1JNR A;  4U2Z A;  2VQF T;  2VQE T;  5JVD E;  2MYS A;  3PUW F;  3VR9 A;  1KNR A;  4NUU A;  3SS1 A;  3RKO A;  3TLS A;  3FBL A;  2LSY A;  3WAJ A;  2JMK A;  3N9Q A;  3PUR A;  3K1S A;  5L47 A;  3EHZ A;  5HWX A;  4BAY B;  2WU2 A;  5LGT B;  4OYJ A;  2V1D B;  2BG9 E;  3SOL A;  2WMO A;  3T8O A;  4P0B A;  4V1A v;  2Q9Q C;  1S35 A;  4ISS A;  3UUX B;  4DMW A;  4EGW A;  5ABF A;  3T1Y T;  3Q5E A;  2UXD T;  4F6R C;  1I6Z A;  2ODU A;  3P4S A;  1YQ4 A;  2XY8 B;  1CHU A;  3NKZ A;  4N78 D;  4YHJ A;  4DVD A;  3RIF A;  3PJA A;  3N5L A;  4HWD A;  4MLK A;  1E2A A;  5LBQ B;  4M1P A;  3P4R A;  3ANW A;  5J2U E;  5JDF A;  5L4E A;  4GYR A;  1BR4 A;  1UK5 A;  2FJA A;  3A8Y C;  2LLY A;  2V7J A;  2BKO A;  2X9Y A;  3P4Q A;  1UUR A;  4JEU B;  3ZPO A;  5FXV A;  5AQG B;  2P9B A;  4YTN A;  2V5D A;  2XHE B;  3BQK A;  4XAX B;  2UU9 T;  3RIA A;  3TLW A;  3LG7 A;  4UVB B;  3NZP A;  3ZMS B;  3ZMT B;  1IBL T;  4DR4 T;  3F2E A;  3PUA A;  4JYA T;  1Y01 A;  2W4X A;  3MAC A;  3L39 A;  3RKG A;  4DBQ A;  5KX5 E;  5HXC A;  4DR6 T;  2B1E A;  3M3Z B;  2XAQ B;  4ZI2 C;  5LB7 B;  2WS3 A;  5HXE A;  3KBT A;  2CEA A;  5LGN B;  3K3Q C;  3SFD A;  3PU3 A;  2UUA T;  2NW7 A;  2QVA A;  5JDH A;  5LMU T;  1D1B A;  2HN2 A;  4QH5 A;  3AA1 B;  3GN5 A;  4GOU A;  5E0O A;  5ABE A;  3ABV A;  4ERR A;  3KV6 A;  5AFU L;  2IC6 A;  4X5T A;  2XTL A;  2ZLY A;  2V7M A;  3CQC B;  1XNQ T;  1H7C A;  2XQ4 A;  3HI2 A;  4ILA A;  2XM1 A;  2L3L A;  2Q9Q B;  1MND A;  3PUZ F;  4NXN T;  3AEA A;  3K8P C;  2MAW A;  3C50 A;  4FJO A;  2KZ7 B;  3TLU A;  2HN1 A;  2A3D A;  1UUS A;  3F31 A;  2JQQ A;  2NW8 A;  3JCF A;  5FVL A;  4PJL A;  4ADZ A;  1KNZ A;  4EYU A;  3E08 A;  5AQR B;  2IDO B;  4IL9 A;  2W0G A;  1VCS A;  1NEN A;  5DQW A;  4EOZ B;  2E9X C;  4YJ2 E;  2X66 A;  3KBU A;  4O4I E;  4QX7 B;  2LEH A;  2AXD S;  4ILB A;  4K0U A;  4U31 A;  5AQO B;  1FMV A;  5HCM A;  2I59 A;  2F4V T;  2Y6X A;  4DUY T;  2VVS A;  4U7I A;  4WBN E;  3CX7 B;  5IHY A;  4P1N A;  1G73 A;  2KT9 A;  2RPA A;  3GMI A;  2I6H A;  4O8S A;  5JR9 A;  2FBW A;  4LF6 T;  2ZM0 A;  4KMC A;  1WR6 A;  2H3R A;  3L8R A;  2BVM A;  4GK0 E;  5CGM A;  3P8C D;  2MPK A;  1BR0 A;  4YFS A;  2PFV A;  1KEY A;  4TX5 A;  1NEK A;  2V26 A;  2N2N A;  2VL0 A;  3EI0 A;  1X79 A;  2RP4 A;  4OFZ A;  5F5W A;  4DV5 T;  1KK7 A;  2WSS V;  5AQJ B;  4H9Q C;  1UGO A;  3JAF A;  2VKD A;  3B5M A;  3I0O A;  4DND A;  2E5V A;  4JI8 T;  4AQG A;  4DMV A;  3FZH B;  3Q9D A;  3OBV E;  3D0T A;  3AE9 A;  1HX1 B;  2W62 A;  1M62 A;  3AAI A;  3K3N A;  3H3M A;  5HEH A;  3UU5 A;  2UXC T;  3NRX A;  3N2K E;  5FXW A;  5FL1 A;  2JRK A;  3LBX A;  5AQK B;  3AEF A;  2WQY A;  2LHR A;  2DWK A;  2J1D G;  2PBI A;  2WAU A;  3LFM A;  4Z91 A;  3QC9 A;  5FXX A;  3AVR A;  3N9P A;  5LJN A;  4QH1 A;  2G0U A;  1XZY A;  2K5B B;  2MTQ A;  2ZM8 A;  5FYM A;  2N1G A;  4ZZC A;  5KDM C;  4WNK A;  1UX5 A;  1J5W A;  2XSB A;  3PU8 A;  5AQH B;  5AQN B;  5HAX A;  2V6Y B;  5JDL A;  5J0Z A;  2EHO D;  4MBQ A;  5FKY A;  4CZZ B;  1N34 T;  2RA1 A;  4YJ3 E;  4QH4 A;  4UEM A;  1V9D A;  3R6N A;  5J1G A;  5LXT E;  2W67 A;  5JDQ A;  4XBF B;  2NP9 A;  2JIW A;  2NOX A;  1QLB A;  3HL6 A;  1M7K A;  3QB5 A;  1OED C;  4HFI A;  4HFV A;  4IE6 A;  4TWH A;  3ZT6 A;  1FJG T;  1ZOY A;  2WY2 A;  5LOV E;  5L3F B;  3TLV A;  4EIW A;  4L0R A;  3N9L A;  1MMA A;  4DR5 T;  3FZM B;  1T72 A;  2X67 A;  3PUS A;  4DV3 T;  2XSA A;  3L09 A;  5LP6 E;  4CI1 B;  4DR7 T;  1YKH B;  4PK6 A;  3TKL B;  4GIW A;  4IE5 A;  4TUY E;  2CMR A;  2CXL A;  2K9A A;  1OED E;  4IT4 A;  4O4H E;  4TV9 E;  2V7L A;  2LSJ A;  1UX4 A;  3WI3 A;  3PUY F;  5JDM A;  1XMQ T;  2ZMA A;  4OHF A;  2PTF A;  3PUG A;  4IE7 A;  3I9W A;  2X68 A;  4I43 B;  3VR8 A;  2LJL A;  3MXZ A;  3UFE A;  4PK5 A;  5FNV E;  4BJM A;  4X1Y E;  5LBM A;  5M4Y A;  4LF5 T;  1KFY A;  2V6Y A;  4UV9 B;  5HEU A;  5IWA T;  2BS2 A;  4HWI B;  5EZY E;  4UVA B;  1LRZ A;  5EK4 A;  4AI6 A;  2LRL A;  5JQG E;  3RRW A;  4ZXL A;  4HWF A;  5LMN T;  4YXD A;  4EED A;  4B3T T;  4A56 A;  2Q9Q D;  2W61 A;  3AB3 B;  4IE0 A;  3V5U A;  3AEG A;  1Z8U A;  1D0Z A;  3VHL A;  1FIO A;  4QHO A;  2IUB A;  2A9U A;  3AE3 A;  4I0U A;  3UUM A;  4HFC A;  4DUZ T;  3EAM A;  3KV9 A;  2X51 A;  3I1A A;  1EZ3 A;  3C51 A;  4H63 V;  2E9X A;  2BG9 A;  4EB6 E;  4DV7 T;  3AAA B;  3ZSS A;  4PJJ A;  1Y64 B;  3LK3 B;  4C90 A;  4OX9 T;  5CFB A;  1HTJ F;  3EDU A;  4X1K E;  3CQX C;  4LMJ A;  3SRZ A;  5L3B B;  5FMN A;  2DHR A;  2CRB A;  1HF8 A;  3DTO A;  3JC6 C;  2H7V C;  2WMN A;  4PFO A;  3RIU C;  3AE7 A;  4AIU A;  2CM0 A;  5FY7 A;  4JI1 T;  1XDO A;  2M67 A;  3FBZ A;  1MMD A;  2CBI A;  3EUH A;  2BKN A;  2XZE A;  2D0T A;  3FZF B;  3LJC A;  4HFB A;  4IL4 A;  3ZLI A;  2QRX A;  4B3R T;  2VVN A;  3EVY A;  4U2Y A;  2A2F X;  2CPT A;  3DP7 A;  4JV5 T;  4UIG A;  2C5J A;  5FVK A;  2YN6 A;  4HTE A;  4O4J E;  3CML A;  1T7S A;  4KBM B;  5LG3 A;  2FUP A;  3EAB A;  3QB5 K;  2VL8 A;  4JI7 T;  3ETV A;  2HPL A;  3IA3 A;  4DID B;  2WDQ A;  4YY3 T;  2YKS A;  4JI5 T;  3MA9 A;  3QK6 A;  3JAD A;  2JQH A;  2VAS A;  2UXX B;  1IBK T;  4DV4 T;  2CE7 A;  4A5X A;  2DLR A;  2LHN A;  2Q9Q A;  2LE8 A;  3LBX B;  4IDQ A;  3LK2 B;  4U74 A;  4DR2 T;  4P0A A;  1OXZ A;  3ZKR A;  3PV0 F;  2IML A;  4UV8 B;  4AKR B;  4YT0 A;  2B76 A;  2LOS A;  2E9X D;  2LKG A;  2XQ3 A;  3ZCJ A;  3PDY A;  4ZS2 A;  2KIN B;  4X66 T;  2H88 A;  1D0Y A;  2I0M A;  4LF4 T;  3CX8 B;  1JNZ A;  3FHN A;  3PTR B;  2MBG A;  3ZYM A;  5LYJ E;  4X62 T;  4DV1 T;  3AE5 A;  4C91 A;  2XJ7 A;  4EAH A;  4DV2 T;  3ZCI A;  3ZST A;  3UUB A;  3HKC E;  5L2L A;  3UU6 A;  5C8Y E;  2NTX A;  5FP3 A;  4DR3 T;  2CLY B;  4B3S T;  4CN1 A;  2W63 A;  3P50 A;  2C0S A;  3O1I A;  2GK9 A;  5TAO A;  4EYY R;  1SHZ C;  5C2T A;  3W15 B;  2BS3 A;  4G2A A;  1US7 B;  2J4G A;  2KSR A;  3OKQ A;  4HN9 A;  3RQU A;  2X0Y A;  5JR9 B;  3OYX A;  1MIV A;  3K3O A;  2VKH A;  1WCR A;  2N9D A;  2NTY A;  2WU5 A;  4MAL A;  4XZC A;  4ZI7 E;  3N9M A;  1IBM T;  1W0A A;  4AKG A;  2KND A;  2LOP A;  2XAJ B;  3ANW B;  1D1A A;  3KFW X;  3N2O A;  4JBW F;  4CN4 A;  5JTG A;  4ZEY A;  2LM2 A;  2LSI A;  3C98 B;  3ETU A;  3FXE B;  3NBX X;  3ONX A;  2KXP B;  2WBL A;  3ZT5 A;  5ABF B;  4DV0 T;  1HCI A;  2UUB T;  5JRE A;  1WR0 A;  4UVC B;  3AA7 B;  4CI2 B;  3G06 A;  4H9P C;  3GA8 A;  4HWH A;  2BBH A;  2M6B A;  2YDQ A;  4PK4 A;  4TWD A;  4UF0 A;  3A7M A;  3TLT A;  4A98 A;  5KMG P;  2H89 A;  3MZK B;  5LGU B;  3P7I A;  2CLY C;  1HNW T;  1T98 A;  2JJ9 A;  2JQK A;  2XPK A;  3LK4 2;  4AIS A;  4CXW A;  4U72 A;  1WFD A;  2W66 A;  4H9S E;  3CPZ A;  4IST A;  2HHH T;  1YW0 A;  4LFC T;  3JAE A;  4CI3 B;  4JI3 T;  4LFA T;  4AKI A;  2DCF A;  5EK3 A;  3U3I A;  4NUV A;  3UU3 A;  4AKL A;  1HR0 T;  3QUJ A;  2VUR A;  2V6X A;  1D1C A;  2XQ8 A;  4KHZ F;  4ZS3 A;  5AQP B;  4LMK A;  4JI2 T;  1LVK A;  2VWA A;  3SWH A;  2LM9 A;  4IDN A;  2YOE A;  2E5L T;  5CJ5 A;  3ZYK A;  4IIJ E;  1YKE B;  2CXF A;  4AQF C;  1SUM B;  1MIY A;  1LVF A;  3AAE B;  1OWA A;  3PUV F;  3RX6 A;  3BQL A;  1NWM X;  3PUQ A;  5FY0 A;  3AVS A;  2LKH A;  2VB6 A;  4IRE A;  4PNI A;  3RYH E;  4COF A;  5LHI B;  3IEE A;  4QX8 B;  2PJQ A;  3ZN0 B;  4MFR A;  3RC3 A;  4YTP A;  2X9X A;  2XAS B;  1N32 T;  4TNV A;  4AQY T;  4HFH A;  4HGA A;  5GON E;  5HEG A;  4PJM A;  3X1D A;  5KXJ A;  5LHH B;  2XQ9 A;  2WWV A;  5JDG A;  2XM2 A;  5AQT B;  3UU8 A;  2ODV A;  2DNX A;  3ZJ2 A;  5EK2 A;  4H9O C;  4GK5 E;  1XWM A;  3KVB A;  4H9N C;  4UEL A;  4WBO A;  2IIU A;  4LF8 T;  3UFG A;  3ZYL A;  3KDS E;  2W00 A;  4HFE A;  2C5I T;  3GWH A;  4U3C A;  3A5X A;  2XQ6 A;  1HFA A;  2J62 A;  4IDO A;  4X1I E;  4LF7 T;  4HKA A;  4YSZ A;  3Q5D A;  1W0B A;  2M6I A;  1HNX T;  4B3M T;  1WLX A;  5AQU B;  2KWH A;  3ESL A;  1J1J A;  4ANJ A;  4JLE A;  5H6R B;  3R84 B;  3S4U A;  2UUC T;  4JEH B;  1Z0P A;  2D5U A;  4Z8X A;  2DL1 A;  4CXY A;  1HS7 A;  2EHO B;  2D9D A;  4TN7 B;  2WZH A;  4UR9 A;  3GN5 B;  5HXR A;  4ZOL E;  4QKN A;  3OJA A;  2ZM2 A;  1HG2 A;  4DBR A;  2YU1 A;  2XQY A;  2Y8D A;  4KI0 F;  3Q5X A;  4NIQ A;  3O4X E;  3RH3 A;  4X20 E;  2L9Q A;  2UXN B;  3O1J A;  4EXT A;  3O1H A;  1DU2 A;  2E9X B;  2IC9 A;  1OED A;  3DJB A;  2WCA A;  4Q25 A;  4TV8 E;  5AQQ B;  4CQI A;  4YSX A;  5LG4 A;  1ZHC A;  4H63 H;  1MMN A;  2YU2 A;  4DR1 T;  3HR0 A;  2BKP A;  3FXD B;  4IHJ E;  3AE6 A;  3OVU A;  4O2A E;  5DAB A;  2OA5 A;  5H6Q B;  5C3J A;  4H9R C;  5HXS A;  4JI6 T;  2ZM6 T;  2LSK A;  3VRA A;  2FJE A;  4PW8 A;  2CHN A;  4O2B E;  4PJN A;  1MNE A;  1SE7 A;  2LRK A;  2BVL A;  2QYW A;  2VKO A;  3N9O A;  4EEB A;  2CWO A;  3CX6 B;  3NZQ A;  4P09 A;  1W09 A;  1YD8 G;  5JDN A;  1CUN A;  3WAK A;  5L3C B;  4O4L E;  2LT3 A;  1KNP A;  4U33 A;  4TWF A;  2KLQ A;  3KIN B;  5JRC B;  4J2C A;  5F8P A;  1BR2 A;  1X9B A;  4K0K T;  1D0X A;  4JUY A;  3RI5 A;  4BJN A;  4IDZ A;  3UUL A;  3ZC0 A;  5L3E B;  1R8I A;  3E22 E;  2IHR 1;  3AXJ A;  4NPP A;  3OPC A;  4I50 E;  4QXB B;  5AQI B;  3RHW A;  4CXX A;  3UUN A;  2D0U A;  3CK6 A;  5LCY A;  4E7S A;  1OED B;  5LNK A;  3LSV A;  3OYZ A;  4ASK A;  3J9X 1;  3UQ7 A;  3PJA J;  3RC8 A;  1GQE A;  2NWB A;  3KV4 A;  2E8I A;  5HCJ A;  4DV6 T;  2JMH A;  3C64 A;  3PE0 A;  5ETW A;  1N36 T;  1I94 T;  5AQL B;  4B6X A;  3UTK A;  2HH7 A;  2OV9 A;  3AE8 A;  2DWG A;  4OYK A;  1WYB A;  1WYC A;  2BG9 C;  3AEE A;  5FL0 A;  2UXB T;  5DJQ C;  2XQ7 A;  5AQV B;  2K3W A;  2H7O A;  2VKJ A;  4PFP A;  3UT5 E;  3CKD A;  4ZZB A;  4GKJ T;  4IGU A;  1WRD A;  1YQ3 A;  5L4H A;  5A1L A;  1E1H B;  2D2S A;  3KVA A;  2X0L B;  3PUX F;  1SA0 E;  4I4T E;  5AQM B;  4YHH T;  4ZI2 D;  3VRB A;  3I9Y A;  3AE4 A;  4ILC A;  4DO0 A;  3RIU A;  5LHG B;  3ZJ1 A;  3RYI E;  1MMG A;  2BBJ A;  3P4P A;  2IAK A;  4UXN B;  2EHO A;  2WWU A;  2X9W A;  5ADX L;  4LML A;  3VKG A;  1ZKE A;  5ABH A;  5IUX A;  4ZI3 D;  3AE1 A;  5ABG A;  2KWI B;  3KV5 A;  4BA9 A;  2JQ9 A;  1HNZ T;  4LFB T;  3Q2M A;  2CBJ A;  4YSY A;  3OTO T;  1IAP A;  2YDS A;  5HWY A;  2ACZ A;  2Y48 B;  3BK9 A;  1S94 A;  4KX6 A;  1B7T A;  2CA5 A;  2SPC A;  1IJ5 A;  5HEJ A;  1QUU A;  3F57 A;  2PG8 A;  2CXD A;  1VCT A;  2BZB A;  3AXJ B;  3C4X A;  3AA0 B;  3UQ4 A;  4HFD A;  2BG9 B;  3ZMZ B;  2XAF B;  4X64 T;  2V5C A;  3HKD E;  3IBP A;  2OLT A;  4TNW A;  4WW0 A;  1ZP0 A;  3CVR A;  4F8H A;  3HKE E;  2K48 A;  4IDP A;  2QA7 A;  3I0Q A;  5BR8 T;  4UF0 B;  4HEA A;  2K24 A;  5IYZ E;  2X0H A;  3IHR A;  2WDR A;  1O3X A; 
#chains in the Genus database with same CATH homology
 3N2G E;  5L3G B;  5CB4 E;  4ZHQ E;  3J7Y q;  1UCU A;  2DI4 A;  2XUE A;  2YEV C;  4E7Z A;  3ZC1 A;  3C4Z A;  3CWZ B;  3NRY A;  5FY1 A;  3ZN1 B;  1MIW A;  3H37 A;  2NW9 A;  1IJ6 A;  2CWY A;  3HKB E;  3MKD A;  4KUM B;  2YIN A;  3B57 A;  1LKX A;  4QWN B;  5CA0 E;  2ES0 A;  4KP3 C;  1VRB A;  4AXP A;  2ACX A;  4G63 A;  2WM9 A;  2MOZ A;  4FI5 A;  5LA6 E;  5J2T E;  1HX8 A;  4AKH A;  4L5G A;  4ZI3 C;  4L9I A;  5CA1 E;  1HG5 A;  3H3A A;  2VK9 A;  2L8K A;  3O9X A;  3EDV A;  4QXC B;  4PAG A;  3AA6 B;  3CQG B;  5L3D B;  3JC6 D;  2BDE A;  5DQV A;  4EZ4 A;  1G8X A;  3MK7 C;  3RYC E;  5JH7 E;  2KMF A;  4HE8 A;  3ZEF B;  5JRC A;  4OK0 A;  2V7I A;  3M65 A;  4I55 E;  3VKH A;  3ZMV B;  5BMV E;  3B13 A;  2YK0 A;  1VOM A;  2Z6E A;  3HA4 A;  4ILU A;  2LSG A;  4IE4 A;  5JR9 C;  3IF8 B;  3BQI A;  1U4Q A;  2CCQ A;  3MJX A;  4MHC A;  2IW5 B;  5HYA A;  2QGS A;  1BR1 A;  3U78 A;  4AQF A;  2C5K T;  3FB2 A;  1ZV4 X;  1FMW A;  3E0Z A;  5HXH A;  5LJM A;  3VU7 H;  2V7K A;  3V5S A;  1ZEE A;  2JPF A;  5FXZ A;  4TZ4 C;  1FEW A;  3RRC A;  2XAG B;  4QXH B;  3RYF E;  5F3J A;  3N9N A;  2X9H A;  3L3P A;  1AJ3 A;  3Q5W A;  1NAF A;  4YLH A;  3RPU A;  1IZN B;  3ZMU B;  2EHO C;  3C4W A;  1QSD A;  1U5P A;  2A72 A;  2XAH B;  2HPJ A;  4GYS A;  5JVD E;  2MYS A;  4NUU A;  3SS1 A;  3RKO A;  3FBL A;  2LSY A;  3WAJ A;  2JMK A;  3N9Q A;  3PUR A;  5HWX A;  4BAY B;  5LGT B;  4OYJ A;  2V1D B;  3SOL A;  2WMO A;  3T8O A;  4P0B A;  4V1A v;  2Q9Q C;  1S35 A;  4ISS A;  3UUX B;  4DMW A;  4F6R C;  2ODU A;  4N78 D;  4YHJ A;  4DVD A;  3N5L A;  4MLK A;  5LBQ B;  4M1P A;  3ANW A;  5J2U E;  5JDF A;  4GYR A;  1BR4 A;  4JEU B;  2X9Y A;  2V7J A;  4A56 A;  5FXV A;  2P9B A;  3BQK A;  2XHE B;  4XAX B;  3LG7 A;  4UVB B;  3NZP A;  3ZMS B;  3ZMT B;  3F2E A;  3PUA A;  3MAC A;  5KX5 E;  4DBQ A;  5HXC A;  2B1E A;  4ZI2 C;  2XAQ B;  5HXE A;  3KBT A;  2CEA A;  5LGN B;  3K3Q C;  3PU3 A;  2NW7 A;  5JDH A;  1D1B A;  3GN5 A;  3AA1 B;  4GOU A;  5E0O A;  4ERR A;  3KV6 A;  5AFU L;  2IC6 A;  2XTL A;  2ZLY A;  2V7M A;  3CQC B;  1H7C A;  3HI2 A;  2L3L A;  2Q9Q B;  1MND A;  3K8P C;  3C50 A;  4FJO A;  2KZ7 B;  5LGU B;  2A3D A;  3F31 A;  2JQQ A;  2NW8 A;  1KNZ A;  4ADZ A;  4PJL A;  4EYU A;  3E08 A;  2W0G A;  5DQW A;  4EOZ B;  2E9X C;  4YJ2 E;  2X66 A;  3KBU A;  4O4I E;  4QX7 B;  2LEH A;  3ZPO A;  4K0U A;  1FMV A;  2I59 A;  2Y6X A;  4WBN E;  3CX7 B;  5IHY A;  5JR9 A;  1G73 A;  2KT9 A;  3GMI A;  4O8S A;  2ZM0 A;  4KMC A;  1WR6 A;  2H3R A;  2BVM A;  4GK0 E;  3P8C D;  1BR0 A;  4YFS A;  2PFV A;  4TX5 A;  2V26 A;  2N2N A;  1X79 A;  2RP4 A;  4OFZ A;  1KK7 A;  2WSS V;  4H9Q C;  2VKD A;  3I0O A;  4DND A;  4AQG A;  4DMV A;  3Q9D A;  3OBV E;  3D0T A;  2W62 A;  3AAI A;  3K3N A;  3NRX A;  3N2K E;  5FXW A;  2JRK A;  3LBX A;  2LHR A;  2DWK A;  2J1D G;  2PBI A;  2WAU A;  3LFM A;  3QC9 A;  5FXX A;  3AVR A;  3N9P A;  5LJN A;  2G0U A;  2K5B B;  2MTQ A;  2ZM8 A;  5FYM A;  2N1G A;  5KDM C;  4WNK A;  1UX5 A;  3PU8 A;  5HAX A;  5JDL A;  2EHO D;  4MBQ A;  4CZZ B;  2RA1 A;  4YJ3 E;  4UEM A;  1V9D A;  3R6N A;  5J1G A;  5LXT E;  5JDQ A;  4XBF B;  2NP9 A;  2NOX A;  3HL6 A;  4IE6 A;  4HFV A;  5LOV E;  5L3F B;  4EIW A;  4L0R A;  3N9L A;  1MMA A;  2X67 A;  3PUS A;  3L09 A;  5LP6 E;  4CI1 B;  1YKH B;  4PK6 A;  3TKL B;  4GIW A;  4IE5 A;  4TUY E;  2CMR A;  2CXL A;  2K9A A;  4O4H E;  4TV9 E;  2V7L A;  2LSJ A;  1UX4 A;  3WI3 A;  5JDM A;  2ZMA A;  4OHF A;  3PUG A;  3I9W A;  2X68 A;  4I43 B;  2LJL A;  3MXZ A;  3UFE A;  4PK5 A;  5FNV E;  4BJM A;  4X1Y E;  5LBM A;  5M4Y A;  4UV9 B;  5EZY E;  4UVA B;  1LRZ A;  5EK4 A;  4AI6 A;  5JQG E;  3RRW A;  2Q9Q D;  2W61 A;  3AB3 B;  4IE0 A;  3V5U A;  3VHL A;  1D0Z A;  1FIO A;  4QHO A;  3UUM A;  3KV9 A;  2X51 A;  3I1A A;  1EZ3 A;  3C51 A;  4H63 V;  2E9X A;  4EB6 E;  3AAA B;  4PJJ A;  1Y64 B;  3LK3 B;  4C90 A;  1HTJ F;  3EDU A;  4X1K E;  3CQX C;  3SRZ A;  5L3B B;  5FMN A;  2DHR A;  3DTO A;  1HF8 A;  3JC6 C;  2H7V C;  2WMN A;  4PFO A;  2CM0 A;  5FY7 A;  2M67 A;  3FBZ A;  1MMD A;  3EUH A;  4IE7 A;  3LJC A;  3ZLI A;  2D0T A;  3EVY A;  2A2F X;  3DP7 A;  4UIG A;  2C5J A;  4HTE A;  4O4J E;  3CML A;  4KBM B;  2VL8 A;  3ETV A;  2HPL A;  3MA9 A;  3QK6 A;  2VAS A;  2UXX B;  2CE7 A;  2DLR A;  2LHN A;  2Q9Q A;  2LE8 A;  3LBX B;  4U74 A;  3LK2 B;  4P0A A;  1OXZ A;  4UV8 B;  4AKR B;  2LOS A;  2E9X D;  3ZCJ A;  3PDY A;  4ZS2 A;  2KIN B;  1D0Y A;  3CX8 B;  3FHN A;  2MBG A;  3PTR B;  3ZYM A;  5LYJ E;  4C91 A;  4EAH A;  3ZCI A;  5L2L A;  3HKC E;  5C8Y E;  2NTX A;  5FP3 A;  2CLY B;  2W63 A;  2C0S A;  3O1I A;  2GK9 A;  5TAO A;  4EYY R;  1SHZ C;  3W15 B;  4G2A A;  1US7 B;  3OKQ A;  4HN9 A;  5JR9 B;  3OYX A;  1MIV A;  3K3O A;  2VKH A;  2N9D A;  2NTY A;  4MAL A;  4XZC A;  4ZI7 E;  3N9M A;  4AKG A;  2KND A;  2LOP A;  2XAJ B;  3ANW B;  1D1A A;  3KFW X;  3N2O A;  3ETU A;  2LSI A;  3C98 B;  3NBX X;  3FXE B;  3ONX A;  2KXP B;  2WBL A;  1HCI A;  5JRE A;  4UVC B;  3AA7 B;  4CI2 B;  4H9P C;  3GA8 A;  4UF0 A;  4PK4 A;  5KMG P;  3MZK B;  3P7I A;  2CLY C;  1T98 A;  2JJ9 A;  4CXW A;  3LK4 2;  4U72 A;  4H9S E;  3CPZ A;  4IST A;  1YW0 A;  4CI3 B;  4AKI A;  2DCF A;  5EK3 A;  3U3I A;  4NUV A;  4AKL A;  3QUJ A;  1D1C A;  4ZS3 A;  1LVK A;  2VWA A;  3SWH A;  2LM9 A;  3ZYK A;  4IIJ E;  1YKE B;  2CXF A;  4AQF C;  1MIY A;  1LVF A;  3AAE B;  1OWA A;  3RX6 A;  3BQL A;  1NWM X;  3PUQ A;  5FY0 A;  3AVS A;  2VB6 A;  3RYH E;  5LHI B;  4PNI A;  3IEE A;  4QX8 B;  2PJQ A;  3ZN0 B;  4MFR A;  3RC3 A;  2X9X A;  2XAS B;  4HGA A;  5GON E;  4PJM A;  5LHH B;  5JDG A;  2ODV A;  2DNX A;  3ZJ2 A;  5EK2 A;  4H9O C;  4GK5 E;  3KVB A;  4H9N C;  4UEL A;  4WBO A;  3ZYL A;  4EZH A;  3KDS E;  2W00 A;  2C5I T;  3GWH A;  3A5X A;  4X1I E;  1HFA A;  4HKA A;  1WLX A;  2KWH A;  3ESL A;  4ANJ A;  4JLE A;  5H6R B;  3R84 B;  3S4U A;  4JEH B;  1Z0P A;  2D5U A;  4Z8X A;  4CXY A;  1HS7 A;  2EHO B;  4TN7 B;  3GN5 B;  5HXR A;  4ZOL E;  4QKN A;  3OJA A;  2ZM2 A;  1HG2 A;  4DBR A;  2YU1 A;  2XQY A;  2Y8D A;  3RH3 A;  3Q5X A;  3ZJ1 A;  3O4X E;  4X20 E;  2L9Q A;  2UXN B;  3O1J A;  4EXT A;  3O1H A;  2E9X B;  2IC9 A;  3DJB A;  4TV8 E;  4CQI A;  5LG4 A;  1ZHC A;  4H63 H;  1MMN A;  2YU2 A;  3HR0 A;  3FXD B;  4IHJ E;  4O2A E;  5DAB A;  5HXS A;  2OA5 A;  5H6Q B;  4H9R C;  2LSK A;  4PW8 A;  4O2B E;  4PJN A;  1MNE A;  2VKO A;  3N9O A;  2BVL A;  2CWO A;  3CX6 B;  3NZQ A;  4P09 A;  1YD8 G;  5JDN A;  1CUN A;  3WAK A;  5L3C B;  4O4L E;  2LT3 A;  2KLQ A;  3KIN B;  5JRC B;  4J2C A;  5F8P A;  1BR2 A;  1D0X A;  4JUY A;  4BJN A;  4IDZ A;  3UUL A;  3ZC0 A;  5L3E B;  3E22 E;  4CXX A;  4QXB B;  4I50 E;  4E7S A;  5LNK A;  3UUN A;  2D0U A;  5LCY A;  4ASK A;  3OYZ A;  3J9X 1;  3RC8 A;  2NWB A;  3KV4 A;  2E8I A;  2JMH A;  3C64 A;  3PE0 A;  5ETW A;  4B6X A;  3UTK A;  2HH7 A;  2DWG A;  4OYK A;  1WYB A;  1WYC A;  5DJQ C;  2H7O A;  2VKJ A;  4PFP A;  3UT5 E;  3CKD A;  4IGU A;  1WRD A;  5A1L A;  1E1H B;  2D2S A;  3KVA A;  2X0L B;  4I4T E;  1SA0 E;  4ZI2 D;  3I9Y A;  4DO0 A;  5LHG B;  3RYI E;  1MMG A;  2IAK A;  4UXN B;  2EHO A;  2WWU A;  2X9W A;  5ADX L;  3VKG A;  1ZKE A;  4ZI3 D;  2KWI B;  3KV5 A;  4BA9 A;  3Q2M A;  1IAP A;  5HWY A;  2Y48 B;  3BK9 A;  1S94 A;  1B7T A;  2CA5 A;  2SPC A;  1IJ5 A;  1QUU A;  3F57 A;  2PG8 A;  2CXD A;  3C4X A;  2BZB A;  3ZMZ B;  3AA0 B;  2XAF B;  3HKD E;  3IBP A;  4WW0 A;  3CVR A;  3HKE E;  2K48 A;  2QA7 A;  3I0Q A;  4UF0 B;  4HEA A;  2K24 A;  5IYZ E;  3IHR A;  1O3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...