2JRKA

Nmr structure and epitope mapping of blo t 5
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
112
structure length
112
Chain Sequence
KKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mite allergen Blo t 5
publication title Nuclear magnetic resonance structure and IgE epitopes of Blo t 5, a major dust mite allergen
pubmed rcsb
source organism Blomia tropicalis
molecule tags Allergen
total genus 34
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2007-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.970 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2jrkA00
2JMHA 2JRKA 2LM9A
chains in the Genus database with same CATH superfamily
2WMOA 5LOVE 3EDUA 4PJJA 3IEEA 4X65T 5HEHA 4YJ2E 3AAAB 1HCIA 1XZYA 4IE0A 2XPKA 2V1DB 4DV5T 2VL8A 3VRBA 2VKDA 3B5MA 4G63A 3MZKB 4YSXA 4H9SE 5F5WA 5LMUT 4P1NA 1NWMX 5L47A 2IHR1 5HEOA 2IC9A 1XMQT 5AFUL 3HL6A 5L2LA 2EHOC 1KK7A 2UXDT 1U4QA 4KHPT 4YLHA 1J1JA 3PU8A 2CCQA 5L3DB 3CIRA 3RGLA 1GQEA 4F6RC 1LVFA 4CN4A 5HXHA 1ZP0A 2IMLA 2LT3A 3QB5K 3Q5DA 3RF1A 4LFCT 2Y48B 5ABFA 4AIUA 5CB4E 2QVAA 4YTPA 4X1YE 1UGOA 1HFAA 4CN6A 4YSZA 5HXSA 2YDSA 3ZMZB 2BDEA 3AXJB 4X20E 2X66A 2HN2A 3OBVE 2CRBA 2YU2A 3SFDA 2XQ3A 2ACXA 4O2BE 2CWOA 3NZPA 5JH7E 2VQFT 3AA1B 3PURA 4CXWA 3JADA 3UUBA 5AQPB 3ZYLA 4EZHA 4ILBA 3N9NA 2JQKA 1WR6A 4GKKT 1AJ3A 3QB5A 4DUZT 4JI5T 3P4WA 1V9DA 4IDPA 2XQ4A 2XAQB 3EHZA 4LF5T 4Z90A 4MHCA 3IBPA 3A7MA 2DHRA 3ZN0B 3NRYA 3SS1A 2M6IA 1ZHCA 4DVDA 3RQUA 3AVSA 4UVCB 4QWNB 3IA3A 5ABEA 3CVRA 2BKPA 2W61A 2LSJA 3RYFE 3RX6A 4IDOA 2YEVC 4WBOA 1HG2A 4TNWA 5EK2A 5C3JA 4QH4A 3RKGA 3KV5A 3KVBA 3CKDA 2OV9A 1BR4A 5AQJB 2IC6A 1MMGA 2WZIA 3CX6B 4TX5A 2WB5A 3FZHB 3NBXX 4U2YA 1HTJF 2JQHA 2C5IT 3FZLB 5EK4A 2LSGA 2V7IA 2QRXA 3PE0A 4CI1B 3UU8A 4ZS2A 3AXJA 4ZI3C 4IE5A 5FL0A 2E9XC 3ZT5A 3PTRB 4CI2B 5JVDE 2W2UA 3N9OA 3ZLIA 4E7ZA 2BG9C 4PNIA 4FI5A 3PV0F 1YQ3A 2W4XA 4AQGA 2PJQA 1I94T 3LK2B 2KINB 1UX4A 4X62T 4QKNA 3KV4A 5J1GA 3MKDA 3ZJ1A 4YY3T 1T98A 1JNZA 4ANJA 3CMLA 3GN5B 3H3AA 3FXEB 5LA6E 5L3GB 5L3FB 2NP9A 4NIQA 1Z0PA 2FJBA 1IZNB 2NWBA 4JI8T 2V5DA 2X68A 2VKHA 3FXDB 3F31A 5J2TE 4WNKA 3AB3B 5FY0A 2N9DA 4X66T 4JI0T 4H63V 4UF0B 1B7TA 3PJAA 4DV1T 2X9HA 5FY7A 2VB6A 3ANWB 4P0AA 3P7IA 5AQVB 3N9PA 3DP7A 2K9AA 2WM9A 4ISTA 5L4EA 3U78A 4IT4A 3OTOT 3PUSA 3RHWA 1HF8A 2CWYA 4CQIA 1N36T 3FHNA 4P0BA 2CBJA 2KMFA 3QNUA 4I0UA 5FVKA 4LF9T 3O1JA 4TN7B 3L09A 2LE8A 5AQNB 4KMCA 2HH7A 2X9WA 1O3XA 4UR9A 4IDNA 3SFEA 3ZMTB 4X64T 2MBGA 2KZ7B 2ZM8A 5FXVA 3RYHE 5AQRB 3FB2A 2J4GA 2CXFA 5DJQC 2DNXA 3L3PA 4DV4T 2H88A 5L3EB 2XQ6A 2I59A 2IUBA 3Q5EA 3NVOA 2MTQA 3CWZB 3PJAJ 4PJLA 5GONE 2C0SA 1MIVA 3OJAA 3KV6A 2FJEA 2CHOA 2DCFA 4DV7T 1UUSA 2UXXB 2X67A 3K3NA 3HKEE 5LHGB 1MMDA 1MMNA 1ZEEA 3T1HT 5JQGE 4IDQA 3RLFF 5L3CB 3Q2MA 4YJ3E 3Q5XA 4CXXA 1W09A 4DMWA 5HXEA 3OVUA 2UUAT 3UU5A 1KNRA 4DR4T 3QUJA 2KT9A 2XSBA 4NUUA 4UXNB 4AKLA 1U5PA 2X51A 1UX5A 4IREA 4OFZA 5AQUB 5LNKA 4DV3T 4YSYA 3HKCE 4UF0A 2VKJA 4C91A 3N2GE 4A56A 2UXNB 3O9XA 4F8HA 4DR7T 3ZPOA 2LM2A 4UV9B 5LYJE 4YT0A 4QX7B 1MIWA 2BVMA 1JNRA 2YKSA 3RYIE 5AQSB 3EDVA 2VVSA 5FP3A 4QXCB 2A3DA 3N9LA 2HN1A 2E5LT 4PFPA 5LJNA 2WQYA 2XJ7A 3C98B 3D0TA 1MMAA 4JEUB 3JC6D 3UU6A 3AEAA 5JDMA 4ZXLA 3A5XA 3JAEA 2VURA 5LJMA 2CPTA 4IE4A 1NEKA 3ZYMA 3RIUA 4FJOA 3AE4A 2WCAA 3FZMB 3ZC1A 2K3WA 3DJBA 2W67A 2IIUA 2NTXA 3LBXB 5JDHA 4TV8E 2UXBT 1J5ET 3ABVA 2W66A 2WZHA 4H9PC 1E1HB 2KLQA 3P4PA 4PFOA 2KWHA 4EYUA 2D9DA 3VR8A 4UVAB 5LGUB 3JCFA 1BR1A 2ODVA 3N5LA 5DQWA 3LFMA 4GK0E 3RRWA 2QYWA 3FBZA 3RPUA 4XBFB 5ABGA 3ZKRA 3ZJ2A 4YHJA 5JRCA 4YHHT 3X1DA 2DL1A 2OA5A 5HEUA 2I6HA 5LB7B 4IGUA 3J7Yq 5HXCA 3KVAA 2LSIA 4HFBA 4JUYA 2LHNA 2BBHA 2C5KT 3B57A 4JYAT 5C2TA 4I50E 4KHZF 3LK42 2V8SV 1MNEA 4LF6T 4PJNA 4DR1T 4K0KT 5E0OA 2E5VA 2JPFA 4ZI7E 3CQXC 1LKXA 2MPKA 1S35A 5CJ5A 3MACA 4HWHA 5HEJA 2XZEA 4EV6A 2DWKA 3EUHA 4X5TA 4H9NC 4EYYR 3NZQA 4AKHA 4PAGA 1QSDA 2Y6XA 2YU1A 3E08A 2ZMAA 2H7OA 3LBXA 3TLWA 4COFA 2MAWA 3K1SA 2D2SA 4ZEYA 2XASB 1LRZA 2WSSV 1YKHB 4A98A 4WZXA 4AQFA 2AE9A 2NW7A 4GIWA 4MLKA 1X79A 4O4HE 3EAMA 2X9XA 4ZZBA 4GOUA 4AI6A 1T72A 2CA5A 1WYBA 3HKDE 4IHJE 4DNDA 3ESLA 2NW9A 3OYXA 4WYVA 3UUMA 2W0GA 3AE3A 1OWAA 1UURA 3PUZF 3KV9A 5BMVE 2BKOA 5KMGP 5LBMA 3PDYA 3C64A 3QOFA 1FMWA 4U31A 5LBQB 2IDOB 2EHOA 2H7VC 2A72A 1SE7A 3ZT7A 3M3ZB 2LEHA 5FYMA 3AE1A 4JI4T 1T7SA 3RIAA 3ZYKA 3AVRA 4H63H 1OXZA 2CLYC 3AEGA 4YTMA 5CA1E 2BKNA 2E9XB 4UELA 4AISA 3V5SA 2WDRA 3JAFA 2A9UA 3HI2A 3P50A 2XUEA 2D5UA 3ZMVB 2BG9B 3PUGA 2WBLA 2V26A 3WAKA 2N1GA 4U72A 4TV9E 3KBTA 1WCRA 2LKHA 2ZM0A 4IIJE 1HNZT 2Q9QB 2L9QA 4IL4A 4B6XA 5LMNT 3ZSSA 4C90A 2BVLA 5LHIB 2LOSA 5LCYA 1ZKEA 4XZCA 5FMNA 4LMLA 1N34T 3ETUA 4HFEA 4B3TT 2ZM2A 3IHRA 2QA7A 3N9QA 4BAYB 2F4VT 2XHEB 1I6ZA 4AXPA 3ZEFB 1N33T 3L8RA 4JI6T 2EHOD 2I0MA 4LF8T 1HNXT 1VOMA 1FEWA 4IDZA 4DUYT 3RKOA 3AECA 1W9RA 3UUXB 4U7YA 2Q9QC 4WBNE 4EOZB 4HFVA 5HYAA 1HX8A 4QH5A 4TUYE 4OYJA 3O4XE 3N9MA 5IUXA 3U3IA 5LXTE 2E2AA 4LF7T 3UUNA 3ONXA 2LKGA 4HFHA 3KINB 4B3MT 4EB6E 1DU2A 4JI3T 2WWVA 3JC6C 3P4SA 5L3BB 3NKZA 4ZS3A 4BJNA 1MIYA 2FJAA 4UV8B 2DLRA 3MJXA 2E9XA 2BG9E 3CX7B 4A5XA 3KDSE 3ZT6A 2BG9A 5FNVE 5LP6E 1EZ3A 4DIDB 2XQ7A 3C51A 1OEDC 2CEAA 3RC8A 3UQ7A 1KNPA 3CK6A 3QC9A 5JTGA 3M65A 5HEGA 2HPJA 4B3ST 3LDQB 4ILCA 3AEFA 2CHNA 3BQLA 5M4YA 1IJ6A 3R84B 5IHYA 2BS4A 1UK5A 5HAXA 4HWDA 2JMKA 3MK7C 5HWXA 3UULA 4L0RA 2K48A 1VCTA 3AAIA 3J9X1 5FXWA 5LG4A 3AE5A 3ZMSB 2SPCA 4MALA 2XM2A 2G0UA 4LFAT 1ZOYA 3RQWA 1T8BA 3UFGA 3GN5A 2LHRA 4EEDA 3VKGA 2QGSA 3ZCIA 3LSVA 1BR2A 2V6YB 4HE8A 5HCMA 1M7KA 4ZI3D 4TNVA 1WFDA 4AQYT 3QK6A 2NW8A 4M1PA 3BQIA 1YD8G 4GYRA 1HNWT 3AEDA 5JDFA 2L8KA 4LMKA 3BK9A 5LHHB 5L4HA 2LOPA 3ANWA 2P9BA 4TZ4C 4O4IE 3RC3A 2NR4A 3WI3A 5FL1A 3UTKA 3N2OA 4QHOA 2OLTA 3GMIA 4YTNA 3E22E 3PUYF 2V7JA 2MYSA 3F57A 4NPPA 2WU2A 3TKLB 5AQLB 4LMJA 3LG7A 2VK9A 1Y01A 4OYKA 2L3LA 2HPLA 2YINA 3N2KE 5CFBA 4KI0F 2XAGB 4DMVA 4OHFA 4YXDA 4DV6T 1YQ4A 3PUVF 3ZN1B 3HR0A 2XAJB 2BZBA 2V7LA 2ZM6T 3TLSA 4HFIA 4DBRA 3HA4A 3P4QA 3ZMUB 4IE6A 1FMVA 4AKIA 3RIFA 3ONLC 4I4TE 4HN9A 2X0YA 2M6BA 5JR9C 3MXZA 5AQQB 4AKGA 2LRLA 2J62A 4GKJT 3RRCA 4O4LE 4E7SA 4HTEA 3UU4A 3TLTA 2ES0A 2BBJA 2V6YA 2VASA 4ZI2D 3P4RA 4DR3T 4I55E 2V6XA 4XAXB 3LK3B 2UUBT 4IL9A 2WY2A 4TWDA 5C8YE 1XDPA 3R6NA 1KF6A 2IW5B 4CZZB 4NXNT 5FKYA 4MFRA 2WAUA 2A2FX 2LSYA 1WYCA 2YDQA 1R8IA 2LLYA 4YFSA 4UEMA 3CPZA 5A1LA 3KBUA 3LJCA 2LJLA 2PTFA 4DBQA 3AE9A 3I9WA 3ZC0A 1WLXA 3AE2A 3PUXF 1HR0T 2VVNA 1LVKA 4ZHQE 3EI0A 4Q25A 1IBKT 1WR0A 4AKRB 1D0XA 1SUMB 2XTLA 5JDQA 5DABA 2RA1A 2B1EA 4WW0A 3H37A 4PK4A 2N2NA 4NUVA 3DTOA 1SHZC 3AE7A 2J47A 3GA8A 1IBMT 4UVBB 2B76A 1Y64B 1ZV4X 3VU7H 4L9IA 2YOEA 3VRAA 3I0OA 2WMNA 3GWHA 5F8PA 5HCJA 3NWIA 3C4ZA 4JLEA 4HEAA 2XQ5A 4EXTA 2IAKA 2WDQA 3RH3A 5F3JA 4ILAA 4BJMA 2CLYB 3P8CD 1Z8UA 3B13A 1HX1B 4J2CA 4EAHA 3FZKB 3TLVA 1E7PA 3I9YA 2ACZA 3ZCJA 2DWGA 1IAPA 3UT5E 3BQKA 2CXLA 3VHLA 3WAJA 2KNDA 2D0UA 3T8OA 2XQAA 2NTYA 3O1IA 5AQGB 2MOZA 3UU3A 3E0ZA 2XQ8A 3ZSTA 4HFDA 2RP4A 3AA0B 4PK6A 2VQET 2M67A 2Y8DA 4GK5E 4JI1T 5LG3A 2CMRA 3RI5A 1CHUA 2Z6EA 2JRKA 2JQ9A 4U3CA 4HWIB 1KNZA 4DV2T 5LGTB 2XAHB 3K3OA 3I1AA 1X9BA 1SA0E 3UQ4A 2LSKA 3CQGB 4IE7A 1FJGT 3VKHA 3MA9A 5J2UE 4LFBT 2V5CA 5CA0E 1CUNA 5FY1A 1NAFA 5BR8T 4HFCA 5AQKB 5AQHB 2W62A 3SOLA 4L5GA 2BS3A 5AQFB 3I0QA 5AQTB 2R6GF 5IYZE 4HGAA 4O2AE 4U74A 2FBWA 4CXYA 1OEDB 4ISSA 5H6RB 1IJ5A 1MNDA 4ADZA 2ODUA 1XMOT 3OKQA 3HKBE 5KDMC 4HKAA 5KXJA 2XQYA 3OPCA 3AEEA 4V1Av 1FIOA 2XQ9A 3OYZA 1H7CA 3AAEB 2FUPA 4TWHA 1D1BA 1W0BA 2CBIA 2PBIA 3SRZA 4NXMT 3AA6B 4KX6A 2XM1A 2C5JA 4JEHB 4CN1A 3K3QC 5ADXL 3C4WA 1W0AA 4CI3B 5DQVA 3PUWF 4K0UA 2DI4A 2H3RA 2AXDS 2Q9QA 3PU3A 2HHHT 4U7IA 1XDOA 3PUQA 1J5WA 5JDNA 4DO0A 4B3RT 1WRDA 5H6QB 4ILUA 5J0ZA 4U2ZA 3K8PC 3EABA 3SWHA 1E2AA 4PW8A 3CX8B 1S94A 4N78D 2ZLYA 5IWAT 5FVLA 4QXHB 4ZI2C 4PK5A 3C50A 5AQOB 5JDLA 2JIWA 3S4UA 3F2EA 1YXRA 2CE7A 3H3MA 1KEYA 4DV0T 4LF4T 3O1HA 2BS2A 1HG5A 4X1KE 5KX5E 5FXXA 4DR2T 1OEDE 4H9QC 4JI7T 3L39A 3Q5WA 4O4JE 4JV5T 2V7KA 5AQMB 1XNQT 2NOXA 1OEDA 5EK3A 5TAOA 4ZOLE 5FXZA 2CM0A 4EIWA 1D0ZA 4OK0A 2UU9T 3Q9DA 3NRXA 2E9XD 3C4XA 1YW0A 4MBQA 3RIUC 4BA9A 2VWAA 3AA7B 4QX8B 4A97A 5JRCB 1D1AA 5CGMA 2GK9A 3ONJA 3ETVA 2D0TA 2WDVA 3KFWX 4JBWF 4H9RC 2PFVA 2FJDA 2JJ9A 2Q9QD 2XAFB 2KSRA 2VL0A 1N32T 4I43B 5JR9B 1XNRT 1UCUA 2K24A 2W63A 4P09A 2UXCT 3TLUA 4U33A 1D1CA 1G8XA 5LGNB 5EZYE 1D0YA 4G2AA 3AE6A 4TWFA 4HWCA 2WS3A 3G06A 2H89A 5AQIB 4QXBB 4X1IE 4UIGA 3EVYA 2VKOA 4EGWA 3RYCE 3IF8B 4Z91A 2LM9A 2W00A 1XWMA 3T1YT 3FZFB 3V5UA 3AE8A 5ABHA 1QLBA 2UUCT 4KP3C 3AEBA 3PUAA 2JQQA 3FBLA 2WU5A 1YKEB 2E8IA 4PJMA 2YN6A 4ZZCA 2J1DG 1BR0A 1KFYA 2RPAA 5ABFB 4ASKA 4O8SA 4DR5T 4H9OC 2WP9A 1HS7A 2PG8A 4JI2T 3W15B 2XY8B 5JREA 1IBLT 4DR6T 1US7B 2CXDA 3A8YC 2KXPB 1M62A 2YK0A 1VRBA 2KWIB 2X0LB 5HWYA 2WWUA 3VR9A 2V7MA 4KBMB 5ETWA 2X9YA 2YDRA 4QH1A 2K5BB 4AQFC 3UFEA 4GYSA 4ERRA 2LRKA 4OX9T 5JDGA 4KUMB 2XSAA 1VCSA 3CQCB 1QUUA 2X0HA 1G73A 4Z8XA 5JR9A 1NENA 4EEBA 4HWFA 2EHOB 4EZ4A 1L0VA 2JMHA 5HXRA
chains in the Genus database with same CATH topology
2WMOA 3WAJA 4ZS3A 5LOVE 4BJNA 3EDUA 1MIYA 4PJJA 4UV9B 5LYJE 4QX7B 4UV8B 1MIWA 2BVMA 2DLRA 3IEEA 2E9XA 3MJXA 2KNDA 2D0UA 4YJ2E 3RYIE 3CX7B 3KDSE 3EDVA 3T8OA 5FP3A 3AAAB 4QXCB 2A3DA 3N9LA 1HCIA 2NTYA 4PFPA 5LJNA 3O1IA 4IE0A 3C98B 3D0TA 2V1DB 5FNVE 5LP6E 2MOZA 1EZ3A 1MMAA 2VL8A 2VKDA 3E0ZA 4JEUB 3JC6D 4G63A 5JDMA 3C51A 3MZKB 3A5XA 2CEAA 4H9SE 5LJMA 3RC8A 3QC9A 4IE4A 1NWMX 2RP4A 3M65A 2HPJA 3AA0B 4PK6A 3ZYMA 4FJOA 2M67A 2Y8DA 4GK5E 2IC9A 3BQLA 5M4YA 1IJ6A 2CMRA 3R84B 3ZC1A 5IHYA 5AFUL 3HL6A 3DJBA 5L2LA 2EHOC 2Z6EA 1KK7A 5HAXA 2JRKA 1U4QA 4YLHA 3PU8A 2NTXA 2JMKA 2CCQA 3LBXB 5L3DB 5JDHA 4TV8E 1KNZA 4F6RC 3MK7C 1LVFA 5HWXA 3UULA 5HXHA 2XAHB 5LGTB 3K3OA 4L0RA 2LT3A 2K48A 3I1AA 4H9PC 3AAIA 1SA0E 1E1HB 3J9X1 5FXWA 5LG4A 2LSKA 3CQGB 2KLQA 4PFOA 3ZMSB 2KWHA 2Y48B 4IE7A 3VKHA 3MA9A 5CB4E 2SPCA 4MALA 4EYUA 5J2UE 5CA0E 4X1YE 1CUNA 4UVAB 5FY1A 1HFAA 1NAFA 5LGUB 2G0UA 5HXSA 1BR1A 2ODVA 3ZMZB 2BDEA 3N5LA 5DQWA 3LFMA 4X20E 2W62A 2X66A 3GN5A 4GK0E 3SOLA 3RRWA 4L5GA 2LHRA 3OBVE 2YU2A 3I0QA 3FBZA 4XBFB 3RPUA 3VKGA 2QGSA 3ZCIA 1BR2A 3ZJ2A 4YHJA 4HE8A 5JRCA 2ACXA 5IYZE 4O2BE 4HGAA 2CWOA 2OA5A 4O2AE 3NZPA 4U74A 5JH7E 4CXYA 4ISSA 5H6RB 4IGUA 4ZI3D 1IJ5A 3J7Yq 3QK6A 2NW8A 4M1PA 5HXCA 1MNDA 3BQIA 3ZPOA 3AA1B 3PURA 3KVAA 4CXWA 4ADZA 2ODUA 1YD8G 4GYRA 2LSIA 3ZYLA 3OKQA 3HKBE 4JUYA 5JDFA 4EZHA 2L8KA 4HKAA 5KDMC 3N9NA 2XQYA 2LHNA 1WR6A 2C5KT 3BK9A 3B57A 1AJ3A 4I50E 4V1Av 3LK42 1V9DA 5LHHB 1MNEA 2LOPA 3ANWA 2P9BA 1FIOA 4TZ4C 4O4IE 4PJNA 3OYZA 1H7CA 3AAEB 2XAQB 5E0OA 3RC3A 2JPFA 4MHCA 4ZI7E 3CQXC 3WI3A 1D1BA 1LKXA 3IBPA 2PBIA 3UTKA 2DHRA 3N2OA 3NRYA 3SRZA 3ZN0B 4QHOA 3GMIA 1S35A 3AA6B 3E22E 3SS1A 2V7JA 2C5JA 2MYSA 1ZHCA 3F57A 4JEHB 4DVDA 5ADXL 3K3QC 3C4WA 3MACA 3TKLB 4CI3B 3AVSA 5DQVA 4K0UA 2DWKA 3EUHA 4UVCB 3LG7A 4QWNB 2DI4A 4H9NC 2VK9A 4EYYR 2H3RA 4OYKA 2L3LA 2Q9QA 2HPLA 2YINA 3NZQA 3PU3A 4AKHA 3CVRA 2W61A 4PAGA 1QSDA 2LSJA 3PUQA 3RYFE 2Y6XA 2YU1A 3RX6A 3E08A 3N2KE 5JDNA 2YEVC 4WBOA 1HG2A 4DO0A 2ZMAA 2H7OA 2XAGB 5EK2A 4DMVA 3LBXA 4OHFA 1WRDA 3KV5A 3KVBA 3CKDA 2D2SA 5H6QB 2XASB 4ILUA 3ZN1B 1LRZA 1BR4A 2WSSV 1YKHB 3HR0A 2XAJB 2BZBA 3K8PC 2IC6A 2V7LA 3SWHA 4AQFA 1MMGA 3CX6B 4PW8A 3CX8B 4TX5A 2NW7A 4DBRA 3HA4A 3ZMUB 1S94A 4GIWA 4N78D 3NBXX 4IE6A 1FMVA 2ZLYA 1HTJF 4MLKA 1X79A 4QXHB 4O4HE 4ZI2C 2X9XA 2C5IT 4AKIA 4PK5A 3C50A 5JDLA 4GOUA 5EK4A 2LSGA 4I4TE 4HN9A 2V7IA 3S4UA 5JR9C 4AI6A 3F2EA 3MXZA 3PE0A 2CE7A 4AKGA 4CI1B 4ZS2A 4ZI3C 2CA5A 1WYBA 3HKDE 4IHJE 3O1HA 4DNDA 3RRCA 4IE5A 1HG5A 4O4LE 4X1KE 3ESLA 2E9XC 4HTEA 4E7SA 5KX5E 3PTRB 4CI2B 5FXXA 2ES0A 2NW9A 3OYXA 4H9QC 3Q5WA 4O4JE 5JVDE 3UUMA 3N9OA 2VASA 2W0GA 2V7KA 4ZI2D 3ZLIA 1OWAA 4E7ZA 4PNIA 4FI5A 3KV9A 5BMVE 2NOXA 5EK3A 5TAOA 4ZOLE 5KMGP 4AQGA 5FXZA 5LBMA 2PJQA 2CM0A 3PDYA 4EIWA 3LK2B 2KINB 3C64A 1UX4A 4I55E 4QKNA 1FMWA 3KV4A 4XAXB 3LK3B 1D0ZA 5J1GA 3MKDA 4OK0A 3ZJ1A 3Q9DA 5LBQB 5C8YE 3NRXA 2E9XD 1T98A 4ANJA 3CMLA 3C4XA 3R6NA 3GN5B 2IW5B 3H3AA 4CZZB 1YW0A 4MBQA 3FXEB 5LA6E 2EHOA 4MFRA 2H7VC 5L3GB 5L3FB 2WAUA 2NP9A 4BA9A 2VWAA 2A2FX 2LSYA 2A72A 3AA7B 4QX8B 1Z0PA 1WYCA 5JRCB 1IZNB 2LEHA 2NWBA 1D1AA 2X68A 2GK9A 2VKHA 3FXDB 3ETVA 3F31A 2D0TA 5FYMA 4YFSA 4UEMA 5J2TE 4WNKA 3KFWX 4H9RC 3AB3B 5FY0A 2PFVA 3CPZA 5A1LA 2JJ9A 2Q9QD 2XAFB 3KBUA 3LJCA 2N9DA 2LJLA 3ZYKA 4DBQA 3I9WA 3AVRA 4H63V 1WLXA 4UF0B 4H63H 3ZC0A 4I43B 1B7TA 1OXZA 2CLYC 2X9HA 5FY7A 5JR9B 2VB6A 1UCUA 2K24A 3ANWB 1LVKA 4P0AA 2W63A 3P7IA 4P09A 4ZHQE 3N9PA 3DP7A 5CA1E 1D1CA 1G8XA 2K9AA 2WM9A 4AKRB 5LGNB 1D0XA 4ISTA 2E9XB 4UELA 5EZYE 1D0YA 3U78A 4G2AA 3PUSA 2XTLA 5JDQA 5DABA 3V5SA 2RA1A 1HF8A 2B1EA 2CWYA 4WW0A 3H37A 3HI2A 4PK4A 4CQIA 2XUEA 2D5UA 2N2NA 3ZMVB 4NUVA 3PUGA 3FHNA 4P0BA 3DTOA 4QXBB 4X1IE 4UIGA 1SHZC 3EVYA 2KMFA 3GA8A 2WBLA 2V26A 2VKOA 4UVBB 3RYCE 3WAKA 3IF8B 1Y64B 1ZV4X 2N1GA 3VU7H 4U72A 3O1JA 3KBTA 4TN7B 4TV9E 2ZM0A 3L09A 2LE8A 4L9IA 4IIJE 2LM9A 2W00A 2Q9QB 2L9QA 3I0OA 2WMNA 4B6XA 4KMCA 2HH7A 2X9WA 4C90A 1O3XA 2BVLA 5LHIB 3GWHA 3ZMTB 3V5UA 2LOSA 5LCYA 2MBGA 2KZ7B 2ZM8A 1ZKEA 5F8PA 5FXVA 3RYHE 4XZCA 3FB2A 2CXFA 5DJQC 2DNXA 3L3PA 5FMNA 3C4ZA 3ETUA 4JLEA 5L3EB 2ZM2A 4KP3C 2I59A 4HEAA 3IHRA 3PUAA 2JQQA 2QA7A 3FBLA 3N9QA 2MTQA 3CWZB 3VHLA 2IAKA 5GONE 4PJLA 4BAYB 4EXTA 1YKEB 2C0SA 1MIVA 2E8IA 2XHEB 3OJAA 4AXPA 3KV6A 3ZEFB 4PJMA 3RH3A 5F3JA 2DCFA 2J1DG 1BR0A 2EHOD 4BJMA 2CLYB 4ASKA 1VOMA 2UXXB 2X67A 4O8SA 4H9OC 1FEWA 3K3NA 3P8CD 3HKEE 4IDZA 5LHGB 1MMDA 3B13A 1MMNA 1ZEEA 1HS7A 3RKOA 2PG8A 3W15B 5JREA 5JQGE 4J2CA 4EAHA 1US7B 3UUXB 2CXDA 2Q9QC 5L3CB 4WBNE 3Q2MA 4EOZB 4HFVA 2KXPB 5HYAA 4YJ3E 3Q5XA 4CXXA 1HX8A 4DMWA 2YK0A 1VRBA 3I9YA 4TUYE 4OYJA 2KWIB 2X0LB 5HXEA 3O4XE 5HWYA 2WWUA 3N9MA 2V7MA 3ZCJA 4KBMB 3U3IA 5ETWA 3QUJA 2KT9A 2X9YA 4NUUA 4UXNB 4AKLA 5LXTE 1U5PA 2X51A 1UX5A 4OFZA 2K5BB 2DWGA 4AQFC 3UFEA 3UUNA 1IAPA 4GYSA 5LNKA 3ONXA 4ERRA 3KINB 3HKCE 5JDGA 4KUMB 4UF0A 2VKJA 4EB6E 3CQCB 1QUUA 5JR9A 1G73A 4Z8XA 4C91A 3N2GE 4A56A 2EHOB 2UXNB 3JC6C 3UT5E 3O9XA 3BQKA 4EZ4A 5L3BB 2JMHA 2CXLA 5HXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMH A;  2JRK A;  2LM9 A; 
#chains in the Genus database with same CATH topology
 2WMO A;  5LOV E;  3EDU A;  4PJJ A;  3IEE A;  4X65 T;  5HEH A;  4YJ2 E;  3AAA B;  1HCI A;  1XZY A;  4IE0 A;  2XPK A;  2V1D B;  4DV5 T;  2VL8 A;  3VRB A;  2VKD A;  3B5M A;  4G63 A;  3MZK B;  4YSX A;  4H9S E;  5F5W A;  5LMU T;  4P1N A;  1NWM X;  5L47 A;  2IHR 1;  5HEO A;  2IC9 A;  1XMQ T;  5AFU L;  3HL6 A;  5L2L A;  2EHO C;  1KK7 A;  2UXD T;  1U4Q A;  4KHP T;  4YLH A;  1J1J A;  3PU8 A;  2CCQ A;  5L3D B;  3CIR A;  3RGL A;  1GQE A;  4F6R C;  1LVF A;  4CN4 A;  5HXH A;  1ZP0 A;  2IML A;  2LT3 A;  3QB5 K;  3Q5D A;  3RF1 A;  4LFC T;  2Y48 B;  5ABF A;  4AIU A;  5CB4 E;  2QVA A;  4YTP A;  4X1Y E;  1UGO A;  1HFA A;  4CN6 A;  4YSZ A;  5HXS A;  2YDS A;  3ZMZ B;  2BDE A;  3AXJ B;  4X20 E;  2X66 A;  2HN2 A;  3OBV E;  2CRB A;  2YU2 A;  3SFD A;  2XQ3 A;  2ACX A;  4O2B E;  2CWO A;  3NZP A;  5JH7 E;  2VQF T;  3AA1 B;  3PUR A;  4CXW A;  3JAD A;  3UUB A;  5AQP B;  3ZYL A;  4EZH A;  4ILB A;  3N9N A;  2JQK A;  1WR6 A;  4GKK T;  1AJ3 A;  3QB5 A;  4DUZ T;  4JI5 T;  3P4W A;  1V9D A;  4IDP A;  2XQ4 A;  2XAQ B;  3EHZ A;  4LF5 T;  4Z90 A;  4MHC A;  3IBP A;  3A7M A;  2DHR A;  3ZN0 B;  3NRY A;  3SS1 A;  2M6I A;  1ZHC A;  4DVD A;  3RQU A;  3AVS A;  4UVC B;  4QWN B;  3IA3 A;  5ABE A;  3CVR A;  2BKP A;  2W61 A;  2LSJ A;  3RYF E;  3RX6 A;  4IDO A;  2YEV C;  4WBO A;  1HG2 A;  4TNW A;  5EK2 A;  5C3J A;  4QH4 A;  3RKG A;  3KV5 A;  3KVB A;  3CKD A;  2OV9 A;  1BR4 A;  5AQJ B;  2IC6 A;  1MMG A;  2WZI A;  3CX6 B;  4TX5 A;  2WB5 A;  3FZH B;  3NBX X;  4U2Y A;  1HTJ F;  2JQH A;  2C5I T;  3FZL B;  5EK4 A;  2LSG A;  2V7I A;  2QRX A;  3PE0 A;  4CI1 B;  3UU8 A;  4ZS2 A;  3AXJ A;  4ZI3 C;  4IE5 A;  5FL0 A;  2E9X C;  3ZT5 A;  3PTR B;  4CI2 B;  5JVD E;  2W2U A;  3N9O A;  3ZLI A;  4E7Z A;  2BG9 C;  4PNI A;  4FI5 A;  3PV0 F;  1YQ3 A;  2W4X A;  4AQG A;  2PJQ A;  1I94 T;  3LK2 B;  2KIN B;  1UX4 A;  4X62 T;  4QKN A;  3KV4 A;  5J1G A;  3MKD A;  3ZJ1 A;  4YY3 T;  1T98 A;  1JNZ A;  4ANJ A;  3CML A;  3GN5 B;  3H3A A;  3FXE B;  5LA6 E;  5L3G B;  5L3F B;  2NP9 A;  4NIQ A;  1Z0P A;  2FJB A;  1IZN B;  2NWB A;  4JI8 T;  2V5D A;  2X68 A;  2VKH A;  3FXD B;  3F31 A;  5J2T E;  4WNK A;  3AB3 B;  5FY0 A;  2N9D A;  4X66 T;  4JI0 T;  4H63 V;  4UF0 B;  1B7T A;  3PJA A;  4DV1 T;  2X9H A;  5FY7 A;  2VB6 A;  3ANW B;  4P0A A;  3P7I A;  5AQV B;  3N9P A;  3DP7 A;  2K9A A;  2WM9 A;  4IST A;  5L4E A;  3U78 A;  4IT4 A;  3OTO T;  3PUS A;  3RHW A;  1HF8 A;  2CWY A;  4CQI A;  1N36 T;  3FHN A;  4P0B A;  2CBJ A;  2KMF A;  3QNU A;  4I0U A;  5FVK A;  4LF9 T;  3O1J A;  4TN7 B;  3L09 A;  2LE8 A;  5AQN B;  4KMC A;  2HH7 A;  2X9W A;  1O3X A;  4UR9 A;  4IDN A;  3SFE A;  3ZMT B;  4X64 T;  2MBG A;  2KZ7 B;  2ZM8 A;  5FXV A;  3RYH E;  5AQR B;  3FB2 A;  2J4G A;  2CXF A;  5DJQ C;  2DNX A;  3L3P A;  4DV4 T;  2H88 A;  5L3E B;  2XQ6 A;  2I59 A;  2IUB A;  3Q5E A;  3NVO A;  2MTQ A;  3CWZ B;  3PJA J;  4PJL A;  5GON E;  2C0S A;  1MIV A;  3OJA A;  3KV6 A;  2FJE A;  2CHO A;  2DCF A;  4DV7 T;  1UUS A;  2UXX B;  2X67 A;  3K3N A;  3HKE E;  5LHG B;  1MMD A;  1MMN A;  1ZEE A;  3T1H T;  5JQG E;  4IDQ A;  3RLF F;  5L3C B;  3Q2M A;  4YJ3 E;  3Q5X A;  4CXX A;  1W09 A;  4DMW A;  5HXE A;  3OVU A;  2UUA T;  3UU5 A;  1KNR A;  4DR4 T;  3QUJ A;  2KT9 A;  2XSB A;  4NUU A;  4UXN B;  4AKL A;  1U5P A;  2X51 A;  1UX5 A;  4IRE A;  4OFZ A;  5AQU B;  5LNK A;  4DV3 T;  4YSY A;  3HKC E;  4UF0 A;  2VKJ A;  4C91 A;  3N2G E;  4A56 A;  2UXN B;  3O9X A;  4F8H A;  4DR7 T;  3ZPO A;  2LM2 A;  4UV9 B;  5LYJ E;  4YT0 A;  4QX7 B;  1MIW A;  2BVM A;  1JNR A;  2YKS A;  3RYI E;  5AQS B;  3EDV A;  2VVS A;  5FP3 A;  4QXC B;  2A3D A;  3N9L A;  2HN1 A;  2E5L T;  4PFP A;  5LJN A;  2WQY A;  2XJ7 A;  3C98 B;  3D0T A;  1MMA A;  4JEU B;  3JC6 D;  3UU6 A;  3AEA A;  5JDM A;  4ZXL A;  3A5X A;  3JAE A;  2VUR A;  5LJM A;  2CPT A;  4IE4 A;  1NEK A;  3ZYM A;  3RIU A;  4FJO A;  3AE4 A;  2WCA A;  3FZM B;  3ZC1 A;  2K3W A;  3DJB A;  2W67 A;  2IIU A;  2NTX A;  3LBX B;  5JDH A;  4TV8 E;  2UXB T;  1J5E T;  3ABV A;  2W66 A;  2WZH A;  4H9P C;  1E1H B;  2KLQ A;  3P4P A;  4PFO A;  2KWH A;  4EYU A;  2D9D A;  3VR8 A;  4UVA B;  5LGU B;  3JCF A;  1BR1 A;  2ODV A;  3N5L A;  5DQW A;  3LFM A;  4GK0 E;  3RRW A;  2QYW A;  3FBZ A;  3RPU A;  4XBF B;  5ABG A;  3ZKR A;  3ZJ2 A;  4YHJ A;  5JRC A;  4YHH T;  3X1D A;  2DL1 A;  2OA5 A;  5HEU A;  2I6H A;  5LB7 B;  4IGU A;  3J7Y q;  5HXC A;  3KVA A;  2LSI A;  4HFB A;  4JUY A;  2LHN A;  2BBH A;  2C5K T;  3B57 A;  4JYA T;  5C2T A;  4I50 E;  4KHZ F;  3LK4 2;  2V8S V;  1MNE A;  4LF6 T;  4PJN A;  4DR1 T;  4K0K T;  5E0O A;  2E5V A;  2JPF A;  4ZI7 E;  3CQX C;  1LKX A;  2MPK A;  1S35 A;  5CJ5 A;  3MAC A;  4HWH A;  5HEJ A;  2XZE A;  4EV6 A;  2DWK A;  3EUH A;  4X5T A;  4H9N C;  4EYY R;  3NZQ A;  4AKH A;  4PAG A;  1QSD A;  2Y6X A;  2YU1 A;  3E08 A;  2ZMA A;  2H7O A;  3LBX A;  3TLW A;  4COF A;  2MAW A;  3K1S A;  2D2S A;  4ZEY A;  2XAS B;  1LRZ A;  2WSS V;  1YKH B;  4A98 A;  4WZX A;  4AQF A;  2AE9 A;  2NW7 A;  4GIW A;  4MLK A;  1X79 A;  4O4H E;  3EAM A;  2X9X A;  4ZZB A;  4GOU A;  4AI6 A;  1T72 A;  2CA5 A;  1WYB A;  3HKD E;  4IHJ E;  4DND A;  3ESL A;  2NW9 A;  3OYX A;  4WYV A;  3UUM A;  2W0G A;  3AE3 A;  1OWA A;  1UUR A;  3PUZ F;  3KV9 A;  5BMV E;  2BKO A;  5KMG P;  5LBM A;  3PDY A;  3C64 A;  3QOF A;  1FMW A;  4U31 A;  5LBQ B;  2IDO B;  2EHO A;  2H7V C;  2A72 A;  1SE7 A;  3ZT7 A;  3M3Z B;  2LEH A;  5FYM A;  3AE1 A;  4JI4 T;  1T7S A;  3RIA A;  3ZYK A;  3AVR A;  4H63 H;  1OXZ A;  2CLY C;  3AEG A;  4YTM A;  5CA1 E;  2BKN A;  2E9X B;  4UEL A;  4AIS A;  3V5S A;  2WDR A;  3JAF A;  2A9U A;  3HI2 A;  3P50 A;  2XUE A;  2D5U A;  3ZMV B;  2BG9 B;  3PUG A;  2WBL A;  2V26 A;  3WAK A;  2N1G A;  4U72 A;  4TV9 E;  3KBT A;  1WCR A;  2LKH A;  2ZM0 A;  4IIJ E;  1HNZ T;  2Q9Q B;  2L9Q A;  4IL4 A;  4B6X A;  5LMN T;  3ZSS A;  4C90 A;  2BVL A;  5LHI B;  2LOS A;  5LCY A;  1ZKE A;  4XZC A;  5FMN A;  4LML A;  1N34 T;  3ETU A;  4HFE A;  4B3T T;  2ZM2 A;  3IHR A;  2QA7 A;  3N9Q A;  4BAY B;  2F4V T;  2XHE B;  1I6Z A;  4AXP A;  3ZEF B;  1N33 T;  3L8R A;  4JI6 T;  2EHO D;  2I0M A;  4LF8 T;  1HNX T;  1VOM A;  1FEW A;  4IDZ A;  4DUY T;  3RKO A;  3AEC A;  1W9R A;  3UUX B;  4U7Y A;  2Q9Q C;  4WBN E;  4EOZ B;  4HFV A;  5HYA A;  1HX8 A;  4QH5 A;  4TUY E;  4OYJ A;  3O4X E;  3N9M A;  5IUX A;  3U3I A;  5LXT E;  2E2A A;  4LF7 T;  3UUN A;  3ONX A;  2LKG A;  4HFH A;  3KIN B;  4B3M T;  4EB6 E;  1DU2 A;  4JI3 T;  2WWV A;  3JC6 C;  3P4S A;  5L3B B;  3NKZ A;  4ZS3 A;  4BJN A;  1MIY A;  2FJA A;  4UV8 B;  2DLR A;  3MJX A;  2E9X A;  2BG9 E;  3CX7 B;  4A5X A;  3KDS E;  3ZT6 A;  2BG9 A;  5FNV E;  5LP6 E;  1EZ3 A;  4DID B;  2XQ7 A;  3C51 A;  1OED C;  2CEA A;  3RC8 A;  3UQ7 A;  1KNP A;  3CK6 A;  3QC9 A;  5JTG A;  3M65 A;  5HEG A;  2HPJ A;  4B3S T;  3LDQ B;  4ILC A;  3AEF A;  2CHN A;  3BQL A;  5M4Y A;  1IJ6 A;  3R84 B;  5IHY A;  2BS4 A;  1UK5 A;  5HAX A;  4HWD A;  2JMK A;  3MK7 C;  5HWX A;  3UUL A;  4L0R A;  2K48 A;  1VCT A;  3AAI A;  3J9X 1;  5FXW A;  5LG4 A;  3AE5 A;  3ZMS B;  2SPC A;  4MAL A;  2XM2 A;  2G0U A;  4LFA T;  1ZOY A;  3RQW A;  1T8B A;  3UFG A;  3GN5 A;  2LHR A;  4EED A;  3VKG A;  2QGS A;  3ZCI A;  3LSV A;  1BR2 A;  2V6Y B;  4HE8 A;  5HCM A;  1M7K A;  4ZI3 D;  4TNV A;  1WFD A;  4AQY T;  3QK6 A;  2NW8 A;  4M1P A;  3BQI A;  1YD8 G;  4GYR A;  1HNW T;  3AED A;  5JDF A;  2L8K A;  4LMK A;  3BK9 A;  5LHH B;  5L4H A;  2LOP A;  3ANW A;  2P9B A;  4TZ4 C;  4O4I E;  3RC3 A;  2NR4 A;  3WI3 A;  5FL1 A;  3UTK A;  3N2O A;  4QHO A;  2OLT A;  3GMI A;  4YTN A;  3E22 E;  3PUY F;  2V7J A;  2MYS A;  3F57 A;  4NPP A;  2WU2 A;  3TKL B;  5AQL B;  4LMJ A;  3LG7 A;  2VK9 A;  1Y01 A;  4OYK A;  2L3L A;  2HPL A;  2YIN A;  3N2K E;  5CFB A;  4KI0 F;  2XAG B;  4DMV A;  4OHF A;  4YXD A;  4DV6 T;  1YQ4 A;  3PUV F;  3ZN1 B;  3HR0 A;  2XAJ B;  2BZB A;  2V7L A;  2ZM6 T;  3TLS A;  4HFI A;  4DBR A;  3HA4 A;  3P4Q A;  3ZMU B;  4IE6 A;  1FMV A;  4AKI A;  3RIF A;  3ONL C;  4I4T E;  4HN9 A;  2X0Y A;  2M6B A;  5JR9 C;  3MXZ A;  5AQQ B;  4AKG A;  2LRL A;  2J62 A;  4GKJ T;  3RRC A;  4O4L E;  4E7S A;  4HTE A;  3UU4 A;  3TLT A;  2ES0 A;  2BBJ A;  2V6Y A;  2VAS A;  4ZI2 D;  3P4R A;  4DR3 T;  4I55 E;  2V6X A;  4XAX B;  3LK3 B;  2UUB T;  4IL9 A;  2WY2 A;  4TWD A;  5C8Y E;  1XDP A;  3R6N A;  1KF6 A;  2IW5 B;  4CZZ B;  4NXN T;  5FKY A;  4MFR A;  2WAU A;  2A2F X;  2LSY A;  1WYC A;  2YDQ A;  1R8I A;  2LLY A;  4YFS A;  4UEM A;  3CPZ A;  5A1L A;  3KBU A;  3LJC A;  2LJL A;  2PTF A;  4DBQ A;  3AE9 A;  3I9W A;  3ZC0 A;  1WLX A;  3AE2 A;  3PUX F;  1HR0 T;  2VVN A;  1LVK A;  4ZHQ E;  3EI0 A;  4Q25 A;  1IBK T;  1WR0 A;  4AKR B;  1D0X A;  1SUM B;  2XTL A;  5JDQ A;  5DAB A;  2RA1 A;  2B1E A;  4WW0 A;  3H37 A;  4PK4 A;  2N2N A;  4NUV A;  3DTO A;  1SHZ C;  3AE7 A;  2J47 A;  3GA8 A;  1IBM T;  4UVB B;  2B76 A;  1Y64 B;  1ZV4 X;  3VU7 H;  4L9I A;  2YOE A;  3VRA A;  3I0O A;  2WMN A;  3GWH A;  5F8P A;  5HCJ A;  3NWI A;  3C4Z A;  4JLE A;  4HEA A;  2XQ5 A;  4EXT A;  2IAK A;  2WDQ A;  3RH3 A;  5F3J A;  4ILA A;  4BJM A;  2CLY B;  3P8C D;  1Z8U A;  3B13 A;  1HX1 B;  4J2C A;  4EAH A;  3FZK B;  3TLV A;  1E7P A;  3I9Y A;  2ACZ A;  3ZCJ A;  2DWG A;  1IAP A;  3UT5 E;  3BQK A;  2CXL A;  3VHL A;  3WAJ A;  2KND A;  2D0U A;  3T8O A;  2XQA A;  2NTY A;  3O1I A;  5AQG B;  2MOZ A;  3UU3 A;  3E0Z A;  2XQ8 A;  3ZST A;  4HFD A;  2RP4 A;  3AA0 B;  4PK6 A;  2VQE T;  2M67 A;  2Y8D A;  4GK5 E;  4JI1 T;  5LG3 A;  2CMR A;  3RI5 A;  1CHU A;  2Z6E A;  2JRK A;  2JQ9 A;  4U3C A;  4HWI B;  1KNZ A;  4DV2 T;  5LGT B;  2XAH B;  3K3O A;  3I1A A;  1X9B A;  1SA0 E;  3UQ4 A;  2LSK A;  3CQG B;  4IE7 A;  1FJG T;  3VKH A;  3MA9 A;  5J2U E;  4LFB T;  2V5C A;  5CA0 E;  1CUN A;  5FY1 A;  1NAF A;  5BR8 T;  4HFC A;  5AQK B;  5AQH B;  2W62 A;  3SOL A;  4L5G A;  2BS3 A;  5AQF B;  3I0Q A;  5AQT B;  2R6G F;  5IYZ E;  4HGA A;  4O2A E;  4U74 A;  2FBW A;  4CXY A;  1OED B;  4ISS A;  5H6R B;  1IJ5 A;  1MND A;  4ADZ A;  2ODU A;  1XMO T;  3OKQ A;  3HKB E;  5KDM C;  4HKA A;  5KXJ A;  2XQY A;  3OPC A;  3AEE A;  4V1A v;  1FIO A;  2XQ9 A;  3OYZ A;  1H7C A;  3AAE B;  2FUP A;  4TWH A;  1D1B A;  1W0B A;  2CBI A;  2PBI A;  3SRZ A;  4NXM T;  3AA6 B;  4KX6 A;  2XM1 A;  2C5J A;  4JEH B;  4CN1 A;  3K3Q C;  5ADX L;  3C4W A;  1W0A A;  4CI3 B;  5DQV A;  3PUW F;  4K0U A;  2DI4 A;  2H3R A;  2AXD S;  2Q9Q A;  3PU3 A;  2HHH T;  4U7I A;  1XDO A;  3PUQ A;  1J5W A;  5JDN A;  4DO0 A;  4B3R T;  1WRD A;  5H6Q B;  4ILU A;  5J0Z A;  4U2Z A;  3K8P C;  3EAB A;  3SWH A;  1E2A A;  4PW8 A;  3CX8 B;  1S94 A;  4N78 D;  2ZLY A;  5IWA T;  5FVL A;  4QXH B;  4ZI2 C;  4PK5 A;  3C50 A;  5AQO B;  5JDL A;  2JIW A;  3S4U A;  3F2E A;  1YXR A;  2CE7 A;  3H3M A;  1KEY A;  4DV0 T;  4LF4 T;  3O1H A;  2BS2 A;  1HG5 A;  4X1K E;  5KX5 E;  5FXX A;  4DR2 T;  1OED E;  4H9Q C;  4JI7 T;  3L39 A;  3Q5W A;  4O4J E;  4JV5 T;  2V7K A;  5AQM B;  1XNQ T;  2NOX A;  1OED A;  5EK3 A;  5TAO A;  4ZOL E;  5FXZ A;  2CM0 A;  4EIW A;  1D0Z A;  4OK0 A;  2UU9 T;  3Q9D A;  3NRX A;  2E9X D;  3C4X A;  1YW0 A;  4MBQ A;  3RIU C;  4BA9 A;  2VWA A;  3AA7 B;  4QX8 B;  4A97 A;  5JRC B;  1D1A A;  5CGM A;  2GK9 A;  3ONJ A;  3ETV A;  2D0T A;  2WDV A;  3KFW X;  4JBW F;  4H9R C;  2PFV A;  2FJD A;  2JJ9 A;  2Q9Q D;  2XAF B;  2KSR A;  2VL0 A;  1N32 T;  4I43 B;  5JR9 B;  1XNR T;  1UCU A;  2K24 A;  2W63 A;  4P09 A;  2UXC T;  3TLU A;  4U33 A;  1D1C A;  1G8X A;  5LGN B;  5EZY E;  1D0Y A;  4G2A A;  3AE6 A;  4TWF A;  4HWC A;  2WS3 A;  3G06 A;  2H89 A;  5AQI B;  4QXB B;  4X1I E;  4UIG A;  3EVY A;  2VKO A;  4EGW A;  3RYC E;  3IF8 B;  4Z91 A;  2LM9 A;  2W00 A;  1XWM A;  3T1Y T;  3FZF B;  3V5U A;  3AE8 A;  5ABH A;  1QLB A;  2UUC T;  4KP3 C;  3AEB A;  3PUA A;  2JQQ A;  3FBL A;  2WU5 A;  1YKE B;  2E8I A;  4PJM A;  2YN6 A;  4ZZC A;  2J1D G;  1BR0 A;  1KFY A;  2RPA A;  5ABF B;  4ASK A;  4O8S A;  4DR5 T;  4H9O C;  2WP9 A;  1HS7 A;  2PG8 A;  4JI2 T;  3W15 B;  2XY8 B;  5JRE A;  1IBL T;  4DR6 T;  1US7 B;  2CXD A;  3A8Y C;  2KXP B;  1M62 A;  2YK0 A;  1VRB A;  2KWI B;  2X0L B;  5HWY A;  2WWU A;  3VR9 A;  2V7M A;  4KBM B;  5ETW A;  2X9Y A;  2YDR A;  4QH1 A;  2K5B B;  4AQF C;  3UFE A;  4GYS A;  4ERR A;  2LRK A;  4OX9 T;  5JDG A;  4KUM B;  2XSA A;  1VCS A;  3CQC B;  1QUU A;  2X0H A;  1G73 A;  4Z8X A;  5JR9 A;  1NEN A;  4EEB A;  4HWF A;  2EHO B;  4EZ4 A;  1L0V A;  2JMH A;  5HXR A; 
#chains in the Genus database with same CATH homology
 2WMO A;  3WAJ A;  4ZS3 A;  5LOV E;  4BJN A;  3EDU A;  1MIY A;  4PJJ A;  4UV9 B;  5LYJ E;  4QX7 B;  4UV8 B;  1MIW A;  2BVM A;  2DLR A;  3IEE A;  2E9X A;  3MJX A;  2KND A;  2D0U A;  4YJ2 E;  3RYI E;  3CX7 B;  3KDS E;  3EDV A;  3T8O A;  5FP3 A;  3AAA B;  4QXC B;  2A3D A;  3N9L A;  1HCI A;  2NTY A;  4PFP A;  5LJN A;  3O1I A;  4IE0 A;  3C98 B;  3D0T A;  2V1D B;  5FNV E;  5LP6 E;  2MOZ A;  1EZ3 A;  1MMA A;  2VL8 A;  2VKD A;  3E0Z A;  4JEU B;  3JC6 D;  4G63 A;  5JDM A;  3C51 A;  3MZK B;  3A5X A;  2CEA A;  4H9S E;  5LJM A;  3RC8 A;  3QC9 A;  4IE4 A;  1NWM X;  2RP4 A;  3M65 A;  2HPJ A;  3AA0 B;  4PK6 A;  3ZYM A;  4FJO A;  2M67 A;  2Y8D A;  4GK5 E;  2IC9 A;  3BQL A;  5M4Y A;  1IJ6 A;  2CMR A;  3R84 B;  3ZC1 A;  5IHY A;  5AFU L;  3HL6 A;  3DJB A;  5L2L A;  2EHO C;  2Z6E A;  1KK7 A;  5HAX A;  2JRK A;  1U4Q A;  4YLH A;  3PU8 A;  2NTX A;  2JMK A;  2CCQ A;  3LBX B;  5L3D B;  5JDH A;  4TV8 E;  1KNZ A;  4F6R C;  3MK7 C;  1LVF A;  5HWX A;  3UUL A;  5HXH A;  2XAH B;  5LGT B;  3K3O A;  4L0R A;  2LT3 A;  2K48 A;  3I1A A;  4H9P C;  3AAI A;  1SA0 E;  1E1H B;  3J9X 1;  5FXW A;  5LG4 A;  2LSK A;  3CQG B;  2KLQ A;  4PFO A;  3ZMS B;  2KWH A;  2Y48 B;  4IE7 A;  3VKH A;  3MA9 A;  5CB4 E;  2SPC A;  4MAL A;  4EYU A;  5J2U E;  5CA0 E;  4X1Y E;  1CUN A;  4UVA B;  5FY1 A;  1HFA A;  1NAF A;  5LGU B;  2G0U A;  5HXS A;  1BR1 A;  2ODV A;  3ZMZ B;  2BDE A;  3N5L A;  5DQW A;  3LFM A;  4X20 E;  2W62 A;  2X66 A;  3GN5 A;  4GK0 E;  3SOL A;  3RRW A;  4L5G A;  2LHR A;  3OBV E;  2YU2 A;  3I0Q A;  3FBZ A;  4XBF B;  3RPU A;  3VKG A;  2QGS A;  3ZCI A;  1BR2 A;  3ZJ2 A;  4YHJ A;  4HE8 A;  5JRC A;  2ACX A;  5IYZ E;  4O2B E;  4HGA A;  2CWO A;  2OA5 A;  4O2A E;  3NZP A;  4U74 A;  5JH7 E;  4CXY A;  4ISS A;  5H6R B;  4IGU A;  4ZI3 D;  1IJ5 A;  3J7Y q;  3QK6 A;  2NW8 A;  4M1P A;  5HXC A;  1MND A;  3BQI A;  3ZPO A;  3AA1 B;  3PUR A;  3KVA A;  4CXW A;  4ADZ A;  2ODU A;  1YD8 G;  4GYR A;  2LSI A;  3ZYL A;  3OKQ A;  3HKB E;  4JUY A;  5JDF A;  4EZH A;  2L8K A;  4HKA A;  5KDM C;  3N9N A;  2XQY A;  2LHN A;  1WR6 A;  2C5K T;  3BK9 A;  3B57 A;  1AJ3 A;  4I50 E;  4V1A v;  3LK4 2;  1V9D A;  5LHH B;  1MNE A;  2LOP A;  3ANW A;  2P9B A;  1FIO A;  4TZ4 C;  4O4I E;  4PJN A;  3OYZ A;  1H7C A;  3AAE B;  2XAQ B;  5E0O A;  3RC3 A;  2JPF A;  4MHC A;  4ZI7 E;  3CQX C;  3WI3 A;  1D1B A;  1LKX A;  3IBP A;  2PBI A;  3UTK A;  2DHR A;  3N2O A;  3NRY A;  3SRZ A;  3ZN0 B;  4QHO A;  3GMI A;  1S35 A;  3AA6 B;  3E22 E;  3SS1 A;  2V7J A;  2C5J A;  2MYS A;  1ZHC A;  3F57 A;  4JEH B;  4DVD A;  5ADX L;  3K3Q C;  3C4W A;  3MAC A;  3TKL B;  4CI3 B;  3AVS A;  5DQV A;  4K0U A;  2DWK A;  3EUH A;  4UVC B;  3LG7 A;  4QWN B;  2DI4 A;  4H9N C;  2VK9 A;  4EYY R;  2H3R A;  4OYK A;  2L3L A;  2Q9Q A;  2HPL A;  2YIN A;  3NZQ A;  3PU3 A;  4AKH A;  3CVR A;  2W61 A;  4PAG A;  1QSD A;  2LSJ A;  3PUQ A;  3RYF E;  2Y6X A;  2YU1 A;  3RX6 A;  3E08 A;  3N2K E;  5JDN A;  2YEV C;  4WBO A;  1HG2 A;  4DO0 A;  2ZMA A;  2H7O A;  2XAG B;  5EK2 A;  4DMV A;  3LBX A;  4OHF A;  1WRD A;  3KV5 A;  3KVB A;  3CKD A;  2D2S A;  5H6Q B;  2XAS B;  4ILU A;  3ZN1 B;  1LRZ A;  1BR4 A;  2WSS V;  1YKH B;  3HR0 A;  2XAJ B;  2BZB A;  3K8P C;  2IC6 A;  2V7L A;  3SWH A;  4AQF A;  1MMG A;  3CX6 B;  4PW8 A;  3CX8 B;  4TX5 A;  2NW7 A;  4DBR A;  3HA4 A;  3ZMU B;  1S94 A;  4GIW A;  4N78 D;  3NBX X;  4IE6 A;  1FMV A;  2ZLY A;  1HTJ F;  4MLK A;  1X79 A;  4QXH B;  4O4H E;  4ZI2 C;  2X9X A;  2C5I T;  4AKI A;  4PK5 A;  3C50 A;  5JDL A;  4GOU A;  5EK4 A;  2LSG A;  4I4T E;  4HN9 A;  2V7I A;  3S4U A;  5JR9 C;  4AI6 A;  3F2E A;  3MXZ A;  3PE0 A;  2CE7 A;  4AKG A;  4CI1 B;  4ZS2 A;  4ZI3 C;  2CA5 A;  1WYB A;  3HKD E;  4IHJ E;  3O1H A;  4DND A;  3RRC A;  4IE5 A;  1HG5 A;  4O4L E;  4X1K E;  3ESL A;  2E9X C;  4HTE A;  4E7S A;  5KX5 E;  3PTR B;  4CI2 B;  5FXX A;  2ES0 A;  2NW9 A;  3OYX A;  4H9Q C;  3Q5W A;  4O4J E;  5JVD E;  3UUM A;  3N9O A;  2VAS A;  2W0G A;  2V7K A;  4ZI2 D;  3ZLI A;  1OWA A;  4E7Z A;  4PNI A;  4FI5 A;  3KV9 A;  5BMV E;  2NOX A;  5EK3 A;  5TAO A;  4ZOL E;  5KMG P;  4AQG A;  5FXZ A;  5LBM A;  2PJQ A;  2CM0 A;  3PDY A;  4EIW A;  3LK2 B;  2KIN B;  3C64 A;  1UX4 A;  4I55 E;  4QKN A;  1FMW A;  3KV4 A;  4XAX B;  3LK3 B;  1D0Z A;  5J1G A;  3MKD A;  4OK0 A;  3ZJ1 A;  3Q9D A;  5LBQ B;  5C8Y E;  3NRX A;  2E9X D;  1T98 A;  4ANJ A;  3CML A;  3C4X A;  3R6N A;  3GN5 B;  2IW5 B;  3H3A A;  4CZZ B;  1YW0 A;  4MBQ A;  3FXE B;  5LA6 E;  2EHO A;  4MFR A;  2H7V C;  5L3G B;  5L3F B;  2WAU A;  2NP9 A;  4BA9 A;  2VWA A;  2A2F X;  2LSY A;  2A72 A;  3AA7 B;  4QX8 B;  1Z0P A;  1WYC A;  5JRC B;  1IZN B;  2LEH A;  2NWB A;  1D1A A;  2X68 A;  2GK9 A;  2VKH A;  3FXD B;  3ETV A;  3F31 A;  2D0T A;  5FYM A;  4YFS A;  4UEM A;  5J2T E;  4WNK A;  3KFW X;  4H9R C;  3AB3 B;  5FY0 A;  2PFV A;  3CPZ A;  5A1L A;  2JJ9 A;  2Q9Q D;  2XAF B;  3KBU A;  3LJC A;  2N9D A;  2LJL A;  3ZYK A;  4DBQ A;  3I9W A;  3AVR A;  4H63 V;  1WLX A;  4UF0 B;  4H63 H;  3ZC0 A;  4I43 B;  1B7T A;  1OXZ A;  2CLY C;  2X9H A;  5FY7 A;  5JR9 B;  2VB6 A;  1UCU A;  2K24 A;  3ANW B;  1LVK A;  4P0A A;  2W63 A;  3P7I A;  4P09 A;  4ZHQ E;  3N9P A;  3DP7 A;  5CA1 E;  1D1C A;  1G8X A;  2K9A A;  2WM9 A;  4AKR B;  5LGN B;  1D0X A;  4IST A;  2E9X B;  4UEL A;  5EZY E;  1D0Y A;  3U78 A;  4G2A A;  3PUS A;  2XTL A;  5JDQ A;  5DAB A;  3V5S A;  2RA1 A;  1HF8 A;  2B1E A;  2CWY A;  4WW0 A;  3H37 A;  3HI2 A;  4PK4 A;  4CQI A;  2XUE A;  2D5U A;  2N2N A;  3ZMV B;  4NUV A;  3PUG A;  3FHN A;  4P0B A;  3DTO A;  4QXB B;  4X1I E;  4UIG A;  1SHZ C;  3EVY A;  2KMF A;  3GA8 A;  2WBL A;  2V26 A;  2VKO A;  4UVB B;  3RYC E;  3WAK A;  3IF8 B;  1Y64 B;  1ZV4 X;  2N1G A;  3VU7 H;  4U72 A;  3O1J A;  3KBT A;  4TN7 B;  4TV9 E;  2ZM0 A;  3L09 A;  2LE8 A;  4L9I A;  4IIJ E;  2LM9 A;  2W00 A;  2Q9Q B;  2L9Q A;  3I0O A;  2WMN A;  4B6X A;  4KMC A;  2HH7 A;  2X9W A;  4C90 A;  1O3X A;  2BVL A;  5LHI B;  3GWH A;  3ZMT B;  3V5U A;  2LOS A;  5LCY A;  2MBG A;  2KZ7 B;  2ZM8 A;  1ZKE A;  5F8P A;  5FXV A;  3RYH E;  4XZC A;  3FB2 A;  2CXF A;  5DJQ C;  2DNX A;  3L3P A;  5FMN A;  3C4Z A;  3ETU A;  4JLE A;  5L3E B;  2ZM2 A;  4KP3 C;  2I59 A;  4HEA A;  3IHR A;  3PUA A;  2JQQ A;  2QA7 A;  3FBL A;  3N9Q A;  2MTQ A;  3CWZ B;  3VHL A;  2IAK A;  5GON E;  4PJL A;  4BAY B;  4EXT A;  1YKE B;  2C0S A;  1MIV A;  2E8I A;  2XHE B;  3OJA A;  4AXP A;  3KV6 A;  3ZEF B;  4PJM A;  3RH3 A;  5F3J A;  2DCF A;  2J1D G;  1BR0 A;  2EHO D;  4BJM A;  2CLY B;  4ASK A;  1VOM A;  2UXX B;  2X67 A;  4O8S A;  4H9O C;  1FEW A;  3K3N A;  3P8C D;  3HKE E;  4IDZ A;  5LHG B;  1MMD A;  3B13 A;  1MMN A;  1ZEE A;  1HS7 A;  3RKO A;  2PG8 A;  3W15 B;  5JRE A;  5JQG E;  4J2C A;  4EAH A;  1US7 B;  3UUX B;  2CXD A;  2Q9Q C;  5L3C B;  4WBN E;  3Q2M A;  4EOZ B;  4HFV A;  2KXP B;  5HYA A;  4YJ3 E;  3Q5X A;  4CXX A;  1HX8 A;  4DMW A;  2YK0 A;  1VRB A;  3I9Y A;  4TUY E;  4OYJ A;  2KWI B;  2X0L B;  5HXE A;  3O4X E;  5HWY A;  2WWU A;  3N9M A;  2V7M A;  3ZCJ A;  4KBM B;  3U3I A;  5ETW A;  3QUJ A;  2KT9 A;  2X9Y A;  4NUU A;  4UXN B;  4AKL A;  5LXT E;  1U5P A;  2X51 A;  1UX5 A;  4OFZ A;  2K5B B;  2DWG A;  4AQF C;  3UFE A;  3UUN A;  1IAP A;  4GYS A;  5LNK A;  3ONX A;  4ERR A;  3KIN B;  3HKC E;  5JDG A;  4KUM B;  4UF0 A;  2VKJ A;  4EB6 E;  3CQC B;  1QUU A;  5JR9 A;  1G73 A;  4Z8X A;  4C91 A;  3N2G E;  4A56 A;  2EHO B;  2UXN B;  3JC6 C;  3UT5 E;  3O9X A;  3BQK A;  4EZ4 A;  5L3B B;  2JMH A;  2CXL A;  5HXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...