2JS0A

Solution structure of second sh3 domain of adaptor nck
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
61
structure length
61
Chain Sequence
b'GSLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic protein NCK1
publication title Specificity determinants of a novel Nck interaction with the juxtamembrane domain of the epidermal growth factor receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 9
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2js0A00
1MUZA 1N5ZA 4F14A 1EFNA 2KBTA 4RUGA 1TG0A 2NUZA 1RLPC 3EGUA 1GBRA 2A36A 1M3BA 1VYUA 2BTTA 1M8MA 2CDTA 3M0SA 2HEQA 2EYZA 3UATA 1WX6A 4E6RA 1HJDA 1UG1A 1QKWA 2YUOA 2KR3A 2AK5A 1X2KA 2GGRA 4HCKA 2A08A 2L0AA 1T3LA 2LMJA 3H41A 2FEIA 2D8HA 2FRYA 2K3BA 2GTJA 1PWTA 1JXOA 2K2MA 4RTTA 3VS4A 2BZ8A 3EG3A 2JMAA 4OMPA 2YT6A 1M3CA 4R0KA 2KGTA 3NHNA 2O88A 1GRIA 2FPFA 5I22A 4GBQA 1UJ0A 2BZYA 2AZSA 4DEYA 2DRMA 2O9VA 1GFDA 1PKSA 1U5SA 4CC7A 1FMKA 1VYVA 4D8DA 3H0IA 2ESWA 2M0YA 3UF4A 5GJVB 4LUDA 3EG2A 4Z88A 1AWXA 4Z89A 1ZUKA 2RMOA 2CH4A 2W0ZA 2ABLA 2MOXA 1AWJA 2D8JA 2YSQA 4ORZA 2LP5A 1W70A 1UDLA 1AD5A 1VA7A 2KRMA 2E5KA 1WXTA 3EHQA 2DM1A 3NPFA 3QWYA 3M0PA 2F2XA 3I9QA 1CKAA 1ARKA 3CQTA 2KXCA 2DYBA 2DMOA 3PVLA 2ROTA 4Y92A 2PTKA 2VWFA 1JEGA 4EIKA 4JZ3A 1H92A 4KRTA 1HD3A 2F2WA 4IIOA 1WIEA 4OMMA 2KXDA 1QWEA 1ABOA 1ZLMA 1YWPA 4AFUC 3M0QA 1T3SA 5EC7A 4J9CA 2A28A 1CSKA 2JTEA 5IXFA 1VYTA 2J7IA 3RBBB 1UFFA 2CREA 3TVTA 1UE9A 3GBQA 1HSQA 2JS0A 4J9IA 1GCQC 4J9FA 2EYXA 1UHCA 3R6NA 1ZBJA 2RQVA 4Z8AA 1K1ZA 2JM9A 2L3SA 3A98A 2AKKA 3LH5A 3REBB 1Y0MA 1SHGA 2DA9A 2LZ6B 2AKLA 4J9GA 4AFZC 1QCFA 1JO8A 2CUBA 2J6FA 1YWOA 4CC4B 1B3QA 2XMFA 2F2VA 1QKXA 1UECA 2DILA 3NGPA 3VS2A 2DNUA 1YN8A 1WYXA 2SEMA 3VS6A 1AOJA 2RPNA 1PKTA 3KFVA 2MCNA 2V1QA 1JQQA 1AZGB 1PRMC 1GFCA 2A37A 1RLQC 2DLPA 2YUNA 1KJWA 2CSIA 1AEYA 4J9EA 1X6GA 2OAWA 4F17A 1Z9ZA 2I0NA 5IXBA 2DL8A 2K9GA 2KNBB 1WLPB 2EGAA 1BB9A 2IIMA 2KEAA 2SRCA 4RTZA 1GCPA 2QDLA 2RQUA 1S1NA 1T0JA 2LNHB 1UGVA 2V1RA 2AZVA 2MIOA 2RQWA 3EHRA 1T0HA 1K0XA 4RTYA 3VRYA 4JJCA 1WXUA 1U3OA 1M30A 1WI7A 3H0HA 4LE9A 1E6HA 2KYBA 2CSQA 2EVRA 4LN2A 5FWBA 4RTXA 2LJ0A 2GTOA 1OEBA 3U23A 3QWXX 1WFWA 2P4RA 2RF0A 2EPDA 2CT4A 1NYGA 2DL5A 2DBKA 1BK2A 2FRWA 4HXJA 4AFQC 3VS5A 1WA7A 2YDLA 1AWOA 5GJWB 4AG1C 4K11A 2EBPA 1X6BA 3M0UA 1H8KA 1NEGA 1RUWA 1OV3A 3PE0A 1KSWA 1M27C 4AG2C 2J05A 4AFSC 2L2PA 4CC3A 4J9DA 2NWMA 1JU5C 2RQTA 1UHFA 2FPDA 2RQRA 2YUPA 1YNZA 5I11A 3IQLA 2PNIA 1ABQA 1OPKA 1ZUUA 1K76A 2LCSA 2LQWA 2C0TA 4RTWA 1NG2A 1H3HA 1XOVA 2HCKA 2EKHA 4JJDA 1MV3A 3C0CA 2LQNA 2EYWA 2CT3A 1QLYA 4OMQA 2EGEA 5IHIA 1AWWA 1Z9QA 3VS7A 2K7AA 2JXBA 2C0OA 2DBMA 2O2OA 1WDXA 4LNPA 2BZXA 1PHTA 1BBZA 2VKNA 3SHWA 2CUDA 1K0SA 1UUEA 1AZEA 2ROLA 4A63B 1X2QA 3VRZA 4JJBA 2G6FX 2HDAA 2O9SA 1SRMA 2EQIA 3I5RA 2J6KA 1MV0B 2DL3A 1I07A 2X3WD 4JPBW 1I0CA 1NM7A 2VVKA 2J6OA 1E6GA 3EG0A 1G83A 2LX7A 2EW3A 4X1VA 1W6XA 2L3PA 2HBWA 3THKA 2KYMA 1A0NB 2L3QA 2DE0X 3REAB 1BU1A 2OJ2A 4OMOA 1X69A 4OMLA 1V1CA 2CH4W 4J9BA 1G2BA 1RI9A 2K6DA 2PZ1A 1X43A 4CC2A 1SRLA 1TUCA 1WXBA 2HSPA 2H8HA 5FW9A 3NMZC 2B86A 2D0NA 2LJ1A 2DL7A 1OPLA 2ED0A 1SHFA 1TUDA 3PVQA 2LJ3A 2ENMA 3H0FA 2GNCA 5IH2A 2GBQA 1B07A 3M0TA 1UTIA 3RNJA 4DEXA 2ED1A 5L23A 1NLPC 1X27A 2C0IA 4OMNA 2DF6A 2DVJA 2KT1A 3ULRB 1NLOC 3UA7A 4GLMA 3ZL7C 5IHKA 4HVWA 2DL4A 4RTUA 4F16A 2FO0A 1U06A 1GBQA 1K4US 1UJYA 3TSZA 2KRSA 3M0RA 2RN8A 5FWCA 2FG0A 5HCKA 4IIMA 3SEMA 1J3TA 3TSWA 4ESRA 2D1XA 3VS3A 4HVVA 1FYNA 1ZUYA 2OI3A 2KROA 2O31A 2FPEA 3EG1A 1SSHA 3O5ZA 2JM8A 1I1JA 1LCKA 1ZX6A 1SEMA 2YUQA 4M4ZA 2GQIA 1JXMA 1OOTA 4WCIA 1GL5A 4JZ4A 1AVZC 4ZNXA 2K79A 1M3AA 1QWFA 3I5SA 1PRLC 2DX1A 2W10A 5ECAA 2RNAA 1ZSGA 3JV3A 1NYFA 2M51A 1Y57A 1KIKA 1YP5A 4D8KA 2JMCA 2EGCA 2J06A 1SPKA 3UA6A 1YCSB 2JT4A 2JS2A 4HVUA 4J9HA 4LUEA 1KFZA 4FSSA 1E7OA 1IO6A 1NEBA 4QT7A 2ECZA 1K9AA 2JW4A 5IHNA 3VS0A 1PNJA 2KT8A 2KE9A 3I35A 4RTVA 2DJQA 2X3XD 3VS1A 3FJ5A 2KRNA 1GCQA 1W1FA 1CKBA 2DRKA 2EYYA
chains in the Genus database with same CATH superfamily
1N5ZA 4F14A 2ZZDA 1AHJB 1W4SA 3E1SA 3VV0A 2YXYA 2A36A 4O5VA 1M3BA 1VQ9A 1Q7YR 2EJ9A 3QDRB 3INZA 2OTLA 5CO7A 1UG1A 3CCEQ 2EIFA 2RJEA 3QUIA 1SG5A 2RI3A 2COZA 4PFOA 1Q7YC 5LJ3f 5KYWA 3JB9F 1HXDA 2RHZA 2FRYA 4PL6A 3JCMP 2OTJQ 5KCHA 2BE7D 5J3BA 5I21A 4E47A 2LTOA 3OYAA 1UGSB 3SDZA 2O88A 5I22A 3CCRA 1W2BA 2Y90A 5KYXB 3SD4A 3CCLQ 3HRUA 3M59A 2LQKA 2O9VA 3OW2A 5GAN7 3LGFA 3CPWS 4CC7A 3PGGA 3UF4A 4AT1B 1ZUKA 5FRMA 2W0ZA 1G5VA 2VASA 4F7UA 2D8JA 3A8HB 3QJ6A 1AD5A 3LYIA 1KC8R 2EWNA 1WZOA 2DM1A 3FDRA 3QWYA 3QJYA 2F2XA 3MP6A 4XU2A 4E7ZA 3PVLA 2DMOA 5KH6A 4RG8A 1HYOA 4M7AC 1VQ5T 4RCBA 1H92A 4JJNK 2F2WA 1WIEA 2X4XA 2DYIA 1QWEA 1VOMA 2RA2A 1ZLMA 3LW5E 3NTIA 5GAMf 3WXMB 5GMKh 4J9CA 4IURA 2DO3A 1KC8C 1FMWA 1VYTA 4Z02A 3GOXA 2CREA 1XTDA 3CXCA 2QA4Q 2JS0A 3R6NA 2EYXA 5FU6C 1JJ2S 2ZGWA 2AKKA 3LH5A 3REBB 1Y0MA 3A8LB 4FYYB 3M57A 2LCCA 2AKLA 1LNXA 1QCFA 4C92F 1I4K1 3SWNA 1VQ4T 5GANf 3JB9J 5D6WA 4BY6C 2EFIA 2DILA 3VS2A 5GAOq 2V8JA 2DPPB 5CAIA 1WYXA 4M78B 3FC3A 2AIRB 3D7SB 2DFUA 1WNLA 1SSFA 1VQ5A 2RD1A 4XTYA 1RLQC 3PMIA 5LJ5e 2CSIA 1AEYA 3JCMb 4B6MA 2WSFE 5IXBA 2DL8A 2K9GA 1WLPB 3ER0A 2SRCA 2NLUA 2QDLA 2RQUA 1T0JA 2P4TA 2AZVA 2MIOA 2RQWA 4M7DA 2XKOC 3HSBA 2DTOA 2CP6A 2QEXQ 4MDXA 4QVDA 2R5MA 3ZBDA 1M30A 3H0HA 1VQ7Q 2Y4XA 3MJXA 3BDLA 3V8KA 4DQ2A 1LOJA 3EGXB 1VQ4A 3L1AA 1K8AU 2RM4A 5GAN4 4NL2A 2RHYA 2GTOA 4F7UB 2E64A 1WFWA 3OYJA 2EPDA 3DKMA 2CT4A 3HFOA 7AT1B 1K9MU 3P8HA 5LJ5h 4EMKC 5GAOm 4PJNA 2YDLA 4EPCA 5GJWB 4AG1C 1YFNA 4E7KA 1TWBA 2EBPA 2NUPA 2YRVA 5EG2A 4FW2A 4C0GA 1QVGA 2XIDA 3R6OA 2MWPA 1NBEB 4ZGEB 5A0GA 5FROA 1JU5C 1UHFA 1VQ9Q 8AT1B 4JRKA 2QAZA 3IQLA 3C12A 3L2VA 1KQSS 5KYYB 1ABQA 1M1KU 2LT4A 1K76A 2LCSA 1RABB 2LQWA 3A8OB 3JCMJ 3CCJT 2C0TA 1NG2A 2RK1A 4R56A 3PFSA 2LQNA 2EYWA 4N4GA 4PJOE 2EGEA 2QGGA 1Q95G 2FVUA 2JXBA 1N6AA 4PJOF 2DBMA 1YJNT 1ZSZB 1HK9A 2BZXA 1PHTA 2VKNA 2CUDA 4DOVA 2GQVA 1X2QA 4X34A 3VRZA 4RKUE 1F1BB 1W2BS 2O9SA 3CCRQ 4L6V5 4ZTJA 2EQIA 3I5RA 5LJ3e 1QP3A 2ZPEB 2RJFA 1I07A 2EQUA 3H9NA 1NM7A 3HP9A 2VVKA 1C6VX 1E6GA 4ZN3A 3OBWA 1NPPA 4LD9K 4M75F 1N8RU 1VQPQ 1RAFB 2LX7A 3M9QA 4GY5A 4ZGJB 3HKSA 3C95A 3DB3A 3MCAB 3CEYA 2HBWA 3QO3A 3THKA 3I55Q 3REAB 3CCJA 1KK7A 4OGCA 4ZN1A 3G4ST 2RB6A 1RI9A 2RJCA 3EFRA 1X43A 2K3YA 3MPUB 3QDFA 4HA8A 1WXBA 3RKWA 3RMSA 2HSPA 4E7IA 3V8JA 1KHCA 2ED0A 1M90R 1YIJT 1TUDA 3OSVA 2LJ3A 1QCOA 1YJNA 4XTXA 4DEXA 1XQHA 2ED1A 4II1A 1NLPC 5LJ3h 5L23A 4OMNA 4Y91A 3X25B 2DF6A 4XQ3A 3BE3A 4OB1B 1NLOC 5GAN5 2XDBA 1M90C 1WHJA 3GLXA 1D3BB 3QZ5B 2DL4A 2DIQA 4RTUA 3LWHA 2RK2A 2DTHA 2RH2A 1GBQA 1K4US 4PJOD 2KRSA 1QP2A 5GAOl 2FG0A 3GF5A 2MWOA 3TSWA 1RAAB 3VS3A 3UPUA 1G3TA 2RO0A 2O31A 3C94A 4KGVB 3G4SA 2M9UA 1I1JA 1PD0A 1ZX6A 1SEMA 4XTWA 5GMKi 3OS1A 4OVAA 1N8RR 2YHTA 1VQ5Q 1GL5A 3S3NA 4KULA 2DXTA 4JZ4A 4Y28E 1YIJA 1Q81U 5GANe 4ZNXA 1QVPA 1M3AA 4O6JA 2DX1A 3VUZA 3OYCA 2EQMA 4PJOG 3CCUQ 1IHWA 1PD1A 2LQ8A 2M51A 1N8RC 2FB7A 1PCXA 2J06A 1OQKA 4HKEA 3E19A 1YCSB 3EFOB 2OX7A 1I8FA 2MYSA 4HVUA 4FSSA 3LLRA 1E7OA 3OYNA 4C8QA 1IO6A 3CCMT 4LDXA 4DOWA 2JW4A 1M2OA 1BIBA 1VQ4Q 3I35A 1GCQA 1W1FA 1CKBA 4M78C 4JLGA 1EFNA 2KBTA 1UGRB 1I5LA 1RLPC 4C92A 3EGUA 5GANh 3CBMA 3JAME 4M7DE 2JN0A 4Q5WA 1NJIU 3FRNA 3M0SA 2CDTA 1WX6A 4M7DF 2FHDA 5D6XA 9ATCB 2JTMA 1QVGS 2CP0A 2KR3A 3QPHA 1H641 1X2KA 5CQYA 3GNFB 4KGZB 2JUFA 4MZMA 2A08A 2LMJA 3CC4T 2FEIA 5A0LA 2D8HA 2XI9A 3O8VA 3RERA 2K3BA 4F7UG 2K2MA 4RTTA 1TSFA 1OZ3A 3OS0A 3VS4A 2BZ8A 1PC0A 2YT6A 5LJ5f 3CCMA 1M9SA 2ATCB 2A3LA 4BI8B 4BE0A 2DRMA 4FT2A 1GFDA 1PKSA 4M77A 2DIGA 2VGMA 2QTXA 2ESWA 2VUBA 2XG8D 2M0YA 5GJVB 1C0MA 3EG2A 3KXTA 4Z88A 4EMGA 5C0MA 4Z89A 3CD6Q 2CH4A 5GAN6 3OMCA 2FZCB 2D0QB 3TU4K 2XK0A 2YSQA 4ORZA 1W70A 1VA7A 2VV5A 2CZ6B 1IGQA 5GMKm 2DK3A 3JCMc 1VQLT 3NPFA 3M0PA 2K5LA 3I9QA 3CQTA 2KXCA 2PTKA 2VWFA 4R55A 2QDYB 4JZ3A 1KHIA 4KRTA 1HD3A 3CC4A 4X9DA 1ABOA 2BIVA 1YWPA 4AFUC 3CCJQ 4OGEA 4M7AF 4M7DD 2JTEA 2XU8A 3JCMW 2J7IA 3OS2A 1RL2A 1B34B 2HL5C 1NJIC 1BKBA 2XICA 4J9FA 2EKOA 2L8DA 3SWNC 3FLGA 4J5YA 1ZSZC 4QKUA 5I2MA 4PLIA 1K1ZA 1YJNQ 3VUBA 2DA9A 1M4ZA 2LZ6B 2K5FA 1BI2A 4AFZC 5GAMg 4OB2B 2J6FA 4CC4B 1B3QA 2VXFA 2M1HA 2DXCA 2XMFA 3V8LA 5GAMj 3HPWA 1VQKQ 3OS5A 1UECA 4M7DG 5HK0A 3OMGA 1D0ZA 1YN8A 5CKFA 1WQ7A 1VQLA 2GF7A 3KFVA 2FL7A 3OYFA 3JCMg 3DLLA 3M56A 1JQQA 1AZGB 1PRMC 4HT9A 1GFCA 5FU7B 2VB6A 1BCOA 4RCCA 3CPWP 1S72T 4M75A 3QYHB 5HKCA 1Q86U 1Z9ZA 2I0NA 4A54A 3G4SQ 2DZ9A 2IIMA 4RTZA 4EMHA 3OYGA 3OYYA 2LNHB 1UGVA 3RMQA 3J81E 5CR2A 1YIJQ 1T0HA 2DAQA 3VRYA 1WXUA 2HNIA 3GNGA 2GFUA 5GMKe 3FEOA 3S3OA 3VYHB 1WHHA 2X35A 4RTXA 3ZFJA 2HBPA 1TS9A 1M2VB 4FW1A 2RF0A 1U8RA 1NYGA 4DBRA 2E3IA 1BK2A 2FRWA 2EYYA 2DETA 2DZCA 3OBYA 3HTRA 1AWOA 2DEUA 3M4YA 2A0FB 2DJZA 1H8KA 1NEGA 2J05A 1S72A 2MF2A 2L2PA 4PNOA 4E7SA 4CC3A 2MK5A 5CK9A 3T9NA 3JCMQ 2Z0WA 2WACA 3EGDA 2CP5A 2KSSA 3M53A 4MMLA 4C8QE 2OAUA 1X75C 3M55A 1LJOA 3CMET 2E1HA 1Q86R 4C8QF 2EKHA 1MV3A 3C0CA 5IHIA 1Z9QA 1WJQA 3JCMX 2K7AA 3JB9D 1VQOT 2C0OA 1MHNA 1B7TA 4PJOB 1PSFA 4C92E 4WF2A 4LNPA 4X9CA 2CZ7B 1Q86C 1K0SA 2COYA 1AZEA 4A63B 3CCMQ 3RKXA 4FT4A 4PJMA 2HDAA 4XU3A 4AMCA 3PTAA 3OA6A 1SRMA 4KH1B 2X51A 1I0CA 3RESA 3OYMA 4HT8A 2NYSA 2VYTA 4N4HA 5KYUA 1VUBA 5KYWB 3JB9G 1VQ6T 2KYMA 1A0NB 2OJ2A 4OMOA 2O4XA 2ZAEA 3HHTB 1V1CA 1G2BA 3CMEA 2E10A 2K6DA 1V76A 3PMTA 4V2SA 1RI0A 1QMCA 2H8HA 4M77E 5FW9A 4C0ZA 2XHCA 1MMDA 2LJ1A 4FIBA 3CCQT 3CC4Q 1VQOA 5CKHA 1WJRA 2DVEA 4JS4A 4M77F 1WQWA 5IH2A 3M0TA 1UTIA 5GAOp 3RKYA 2CZ0B 1AT1B 3HRSA 4MDWA 1TOVA 4L59A 2KT1A 1KQSP 3UA7A 2QQ9A 3HFNA 3MP8A 4HVWA 1M5Q1 3AT1B 4F16A 3OYLA 2FO0A 4JS5A 1U06A 1D1BA 1FWZA 1UJYA 3TSZA 3M0RA 1RAHB 3JB9H 4QVZA 5FWCA 5HCKA 3WVDB 4IIMA 1J3TA 1K73U 4ESRA 2ZPFB 2D1XA 3L2ZA 3OYHA 4XTZA 4C92D 1FYNA 1ZUYA 3QHSA 1VQ6A 3EG1A 2X4JA 3C4SA 4C0DB 3X24B 3JB9I 1VQLQ 3OYDA 1W2BP 2OTLQ 2MAMA 4KGXB 4FYWB 5HY6A 4RMOA 3CCQA 4ME7A 2E65A 3I56T 1QWFA 5ECAA 2RNAA 1ZSGA 3CC2T 2K57A 4XU0A 2V8KA 1YBYA 2MPXC 1R0BG 1YITT 1TUGB 1MGQA 1VIEA 1YJWT 1C1AA 4BUGA 2HMAA 3SWNB 4C92G 1N9SA 3MEWA 5CQXA 3G7ZA 1YP5A 4D8KA 2EQJA 3V7SA 4M7AA 1KQ1A 2EGCA 1QVFA 1Y7XA 3UA6A 2JJ9A 4PFZA 1IB8A 4FL6A 2P0KA 4M77D 4NOYA 1NEBA 4C92C 1K8AR 2YWWA 3OW2S 4M75E 1PNJA 4RTVA 2DJQA 2X3XD 2G3RA 3M58A 4FSXA 1K9MR 1TG0A 3J80E 2QQAA 1RAIB 3LGLA 1N27A 4M78F 1OYXA 1VYUA 2BTTA 2A7YA 5FU7C 2HEQA 1K8AC 2LX9A 4M7DB 2VGNA 3L2UA 4GLKA 1QKWA 4QVCA 3PIPA 1S72Q 1K9MC 2AK5A 3I56A 2LRQA 3X28B 3JCMd 3LX7A 3CC2A 3A8GB 2PVDB 3N5BB 5A2QE 1EZZB 1YITA 1M1KR 2COWA 2ZCFB 2R57A 1YJWA 3MHXA 2XD0A 4FYXB 3EG9A 1TU0B 2DXUA 2E41A 3GIBA 4N0AA 1BIAA 3EG3A 3CXCS 4OMPA 1M3CA 1Y71A 2CP3A 3CBPA 4R0KA 3CBOA 1M1KC 1M1GA 3NHNA 2QQRA 4C5HA 2V8IA 2IPOB 2BZYA 1BI1A 2ZPGB 1WGSA 2NUPB 2AZSA 4DEYA 4A4HA 2CZ1B 2K2VA 2KAFA 3RIRA 3CCLT 1U5SA 1VYVA 2K4YA 3H0IA 4D8DA 3VKIA 4LUDA 2RHIA 2ZPBB 4J7IA 2ABLA 2MOXA 1AWJA 5KE2A 5LJ5g 4IUTA 5LJ5j 1UDLA 2KRMA 3CC7T 3EHQA 1NZ9A 4DBQA 2JTFA 1CKAA 4M75D 1ARKA 4E7LA 3GPLA 2L3RA 3ME9A 2KXDA 1N9RA 1Y96A 4CRIA 4YTLA 4J83A 3ASKA 5EC7A 2A28A 1CSKA 3CMEQ 5IXFA 4J6WA 3RBBB 1UFFA 1UE9A 3GBQA 1HSQA 2ZPIB 1QVGP 4PJOC 1UHCA 2PUOB 2F5TX 3V7RA 2RQVA 2LNVA 4Z8AA 2JM9A 2L3SA 3CCLA 1MNDA 2BE9B 1VIFA 4M75G 4J9GA 3CPWA 1JO8A 1YWOA 4VUBA 2F2VA 3TEEA 4KUDK 2VC8A 1OU9A 2NUTA 2DNUA 3CC7A 4M75C 4LDVA 2QASA 1D09B 1AOJA 2RPNA 2QK0A 3JCMh 4MZPA 3JCMV 3HRTA 2LCLA 3TQ7P 2A37A 3UWNA 2DLPA 1KJWA 1M8VA 1X6GA 2OAWA 4F17A 2QGFB 4RG2A 2KNBB 5GAOn 1V29B 1GCPA 5KE3A 5DY9A 1S1NA 5KYNA 1YJ9T 1Q81R 1WHKA 2RJDA 2V1RA 3OQ5A 3EHRA 3CCQQ 1OX8A 1K0XA 1TH7A 2HSEB 1WHLA 4XAXB 1G3SA 2YLCA 1BI3A 1RADB 1MMGA 2DXBA 2JVVA 2O01E 2LT1A 3G6ET 1Q81C 5LJ3g 2HD0A 2CSQA 2EVRA 2F1LA 3HL8A 4LN2A 5LJ3j 1QVFS 2RI5A 3Q1JA 2BKDN 1NE8A 1OEBA 5CCAA 2HQEA 2PQWA 2EAYA 4FU6A 4MMKA 4HXJA 1I5OB 3CMAT 1WA7A 1FMVA 5KYXA 3J7AF 3M0UA 1X6BA 1OULA 4A4GA 3F70A 4XK8E 1KSWA 1M27C 4C0DC 4AFSC 4LDUA 4XU1A 1M1FA 1Y96B 3L42A 1NJIR 4J9DA 4A4EA 4M7AE 4HCCA 1JB0E 1TTHB 2RQTA 2RQRA 2AT1B 2YUPA 1YNZA 3RDVA 5I11A 5CKDA 1YJ9A 1NPRA 1BCMA 3L2QA 1BI0A 2HL3A 4RTWA 3I56Q 1SF9A 4ZGDB 3NTHA 3CC2Q 4C8QB 4JJDA 5CKEA 2CT3A 1QLYA 4OMQA 3G6EA 1ACMB 3QSUA 2O2OA 5CIUA 2D6FA 3M5AA 1PSEA 1WDXA 5J26A 2IVWA 1BBZA 4C92B 3E2UA 2ROLA 3RR6A 3CMAA 5KCOA 2HAXA 2X3WD 3CCVT 1I81A 2FZGB 4BI4A 3P8BB 2WSCE 3L2WA 1G83A 3FB9A 4KBMB 5HK3A 4M7DC 4X1VA 1VQPT 4BI3A 5GANg 2AHJB 4A4KA 5M9OA 5GANj 2R5AA 4OMLA 2RI2A 1KQSA 2CH4W 1H3ZA 3I55T 4J9BA 4M78A 1UEBA 4CC2A 1TUCA 4J8OA 1XJWB 4FYVB 2B86A 2D0NA 2CYZB 1SHFA 4XTVA 3TCJA 3WVEB 1ZA1B 2L5QA 4JRIA 4M77B 1VQMT 1QQJA 1MMNA 2GBQA 1B07A 3X26B 4M7AD 3A8MB 1X27A 3META 2C0IA 4E7HA 2DVJA 3LH0A 1YI2T 2JZ2A 5LL6S 1EIFA 5IHKA 4OB3B 1SKUB 4KUIA 3CCVA 2RN8A 3H8ZA 5CKBA 4MZTA 3ZEHA 4NS5A 2GFAA 1JJ2P 5GMKl 5CVIA 3FIFA 3EGXA 2OI3A 1VQPA 2FPEA 4L5GA 2HQXA 1Y07A 2WSEE 4C5EA 4M7AG 3CC7Q 4ANJA 3I55A 2JM8A 1LCKA 2YUQA 3PIOA 4M4ZA 5LJ5d 1U1SA 1JXMA 3MEAA 2XDDA 4PKCC 1MMAA 2P0PA 4KH0B 1KQ2A 2M0OA 1AVZC 4B9WA 5FRNA 2PVGB 2CP2A 3I5SA 1VQMA 1VQ8T 2F5KA 4OB0B 8ATCB 3CCUT 1YI2A 5KYYA 2JMCA 4F04B 4QQDA 2MI6A 2JT4A 1WPYA 2JS2A 4J9HA 5IT9E 3CCST 1KFZA 5L8RE 4ZTFA 4PJLA 3JCMf 5GAN8 4IKFA 1D0YA 4BE1A 1RACB 3BFMA 3VS1A 1PM3A 1MNEA 4OF1A 4M75B 4PFPA 2DRKA 4QW2A 3MEUA 1ZSZA 1MUZA 1YCYA 4J6XA 1FXXA 4RUGA 2NUZA 4OMFB 1GBRA 2QI2A 3OYEA 4LXCA 3QBYA 4JRQA 1M8MA 2EYZA 3UATA 1G3WA 3BW1A 4E6RA 4LD6A 4A4FA 1HJDA 2LVMA 2YUOA 2QYZA 3PNWC 2E6ZA 5DM7R 1VQ8A 2KMTA 4N0AC 1ZQ1A 3SB2A 1KD1U 2GGRA 2L89A 4HCKA 2KQWA 4P5NA 1EX4A 2L0AA 1T3LA 1YJ9Q 4C5IA 3CCUA 1O9SA 3H41A 2XDPA 1RAGB 2GTJA 1R8OB 1PWTA 1JXOA 2ZPHB 3UDCA 2KY9A 3G71T 1DJ7B 2DD5A 3CCSA 2JMAA 4C8QD 2KGTA 4PJJA 4KT0E 1GRIA 2FPFA 3G6EQ 4GBQA 1UJ0A 2H3EB 2CP7A 3VJPA 3GP8A 1Q82U 3URGA 5DLQE 1WHMA 1FMKA 4HCBA 1LVKA 2QG9B 3OSSC 5LJ3d 4JRPA 5DLOA 1AWXA 4BB7A 2RMOA 3EGDB 3CMAQ 2MMPA 3E9FA 5D6YA 1G3YA 3OYIA 4CI0C 4IUUA 1D3BA 2LP5A 3CD6T 2M16A 2F69A 3QG1A 2E5KA 1WXTA 4ELZC 1IREB 4C8QG 1FX7A 3G1JA 1QCNA 3OW2P 2DYBA 2ROTA 4Y92A 1YHQT 3QKJA 2JNGA 1JEGA 1XNIA 4EIKA 4N4IA 4DBHA 5J39A 3OY9A 4IIOA 4OMMA 2DEQA 3M0QA 1T3SA 1M90U 1VQNT 1KG1A 4DA4A 4PK4A 4C8QC 3G71A 1IXDA 3RUXA 5GMKj 3JRZA 5C6SA 3LWIA 1KD1R 3OYKA 5A0DA 3TVTA 2RHUA 1UGQB 4J9IA 1GCQC 3X20B 1ZBJA 2KI7A 3A98A 2HQHA 1SHGA 2FYKA 4IUPA 2X9HA 1OI1A 4D6WA 1KD1C 5KYUB 1GXIE 2CUBA 4DBFA 2EJGA 4M78E 5GAMd 3S3MA 3CD6A 1Q82R 1QKXA 2O4XB 1X01A 2BUDA 3CCVQ 3NGPA 3EFOA 3CXCP 1VQKT 2SEMA 3VS6A 3KUFA 1K73R 2LDMA 1PKTA 2EYQA 2MCNA 1LPLA 1YHQA 2V1QA 1JBMA 3QIIA 4PLLA 5GAN2 2YUNA 3CCET 4M77G 1ZHIA 4J9EA 3V7CA 1Q82C 4IUVA 1VQNA 6AT1B 1K73C 2EGAA 1BB9A 2KEAA 2K3XA 3A1PA 3CPFA 5GANd 2QTVA 2EJFA 3UT1A 2HZYA 4JUVA 2PU9B 4M77C 5AT1B 2VXEA 1P92A 2OTJT 1U1TA 3BDUA 4RTYA 1VQMQ 4JJCA 2R58A 1U3OA 2Y4YA 4BDYA 1WI7A 4LE9A 4EDUA 1E6HA 1RAEB 2E6NA 4F7UE 1YI2Q 4JDSA 2KYBA 4OP0A 1G8XA 5FWBA 1D0XA 2DD4A 3M54A 3MO8A 4F7UF 5GAN3 1BYMA 2LJ0A 2HKNA 3U23A 3QWXX 2P4RA 1VQKA 2DTIA 2QQBA 2DL5A 2DBKA 3QYGB 1WJSA 4AFQC 3VS5A 5GAMe 3DB4A 1R77A 1UB4A 4K11A 3CCEA 1RUWA 1OV3A 3PE0A 4AG2C 3PT9A 1IHVA 4EMKA 3L2RA 3MP1A 3NTKA 2NWMA 2YRCA 2DERA 3QXEB 4M78D 2FPDA 3JCMe 2PNIA 1OPKA 4BACA 4M7AB 2K5IA 1ZUUA 3EAEA 4HCZA 4FCYA 2OTJA 2RHXA 1H3HA 1XOVA 2V26A 1VQ8Q 3AHUA 1D1CA 2HCKA 4UC4A 3MEVA 1VQOQ 1AWWA 2QA4T 3VS7A 3EFSA 2IG0A 5FU6B 1OU8A 5GAMh 5IN1A 3SHWA 2E4HA 5FLXE 3CCSQ 1UUEA 1B34A 3EH2A 4JJBA 4M78G 5IAYA 2G6FX 2M02A 1OZ2A 5I2SA 2LC4A 4TVRA 2J6KA 1MV0B 5GAOr 1IGUA 2DL3A 2D9TA 3JSCA 1JRIA 2X4WA 4JPBW 2B8AA 2J6OA 4BY6B 3EG0A 4ELYC 1VQ6Q 2EW3A 1PG5B 3S6WA 1W6XA 2L3PA 4XTUA 3NFCA 2H3JA 1QVFP 2EQKA 2DE0X 2L3QA 3EG9B 1BU1A 4J6YA 1X69A 4WTOB 1IZ6A 2CS7A 4A53A 4LDYA 2PZ1A 4BDZA 3OB9A 2GCXA 3KBGA 1SRLA 2YRDA 2X4YA 3VU3C 3A5ZB 3H6ZA 2QA4A 3SFMA 2DL7A 1OPLA 2E5QA 3PVQA 4FM4B 2ENMA 2C06A 3H0FA 1JJ2A 2GNCA 2QEXT 1OX9A 3G71Q 4J7FA 3RNJA 2KK4A 1VQ7T 2PUKB 2QXFA 2QQSA 2PVOB 4C0FA 2DKGA 4C5GA 4QQ6A 1D1AA 3ULRB 2I2LA 2JOYA 3FJPA 3P8DA 4GLMA 2P0QA 3ZL7C 3DLMA 2P84A 4B9XA 3OYBA 2YLBA 1R0CB 2CGHA 2KVQG 4BD3A 3SEMA 3EH1A 1TXQA 1Q7YU 4EMKB 2KDSA 2E70A 3VYGA 1ZA2B 4HVVA 4E2FB 3MKDA 2KROA 1SSHA 5D7UA 2FZKB 3O5ZA 1M2VA 2GQIA 1OOTA 4NL3A 1VQ9T 1YHQQ 4WCIA 3TREA 2OTLT 1UGPB 3E9GA 2K79A 4JLIA 3M4GA 3BY7A 1YITQ 1PRLC 2QEXA 1VQNQ 2HKQB 2W10A 1YJWQ 2CKKA 3JV3A 1VQ7A 1NYFA 2E12A 4ATOA 1Y57A 1KIKA 1IRXA 1QW1A 5AYFA 1ZBXA 1O75A 4IUQA 4BE2A 4LDWA 1SPKA 2NUTB 2E3HA 4LUEA 4E7JA 3QZ9B 1WHGA 4QT7A 2ECZA 1K9AA 5IHNA 3VS0A 3CCRT 2KT8A 2KE9A 3FJ5A 2KRNA 1X6OA 4PJOA 4QQGA 1KC8U 3NMZC
chains in the Genus database with same CATH topology
1MUZA 1N5ZA 4F14A 1EFNA 2KBTA 4RUGA 1TG0A 2NUZA 1RLPC 3EGUA 1GBRA 2A36A 1M3BA 1VYUA 2BTTA 1M8MA 2CDTA 3M0SA 2HEQA 2EYZA 3UATA 1WX6A 4E6RA 1HJDA 1UG1A 1QKWA 2YUOA 2KR3A 2AK5A 1X2KA 2GGRA 4HCKA 2A08A 2L0AA 1T3LA 2LMJA 3H41A 2FEIA 2D8HA 2FRYA 2K3BA 2GTJA 1PWTA 1JXOA 2K2MA 4RTTA 3VS4A 2BZ8A 3EG3A 2JMAA 4OMPA 2YT6A 1M3CA 4R0KA 2KGTA 3NHNA 2O88A 1GRIA 2FPFA 5I22A 4GBQA 1UJ0A 2BZYA 2AZSA 4DEYA 2DRMA 2O9VA 1GFDA 1PKSA 1U5SA 4CC7A 1FMKA 1VYVA 4D8DA 3H0IA 2ESWA 2M0YA 3UF4A 5GJVB 4LUDA 3EG2A 4Z88A 1AWXA 4Z89A 1ZUKA 2RMOA 2CH4A 2W0ZA 2ABLA 2MOXA 1AWJA 2D8JA 2YSQA 4ORZA 2LP5A 1W70A 1UDLA 1AD5A 1VA7A 2KRMA 2E5KA 1WXTA 3EHQA 2DM1A 3NPFA 3QWYA 3M0PA 2F2XA 3I9QA 1CKAA 1ARKA 3CQTA 2KXCA 2DYBA 2DMOA 3PVLA 2ROTA 4Y92A 2PTKA 2VWFA 1JEGA 4EIKA 4JZ3A 1H92A 4KRTA 1HD3A 2F2WA 4IIOA 1WIEA 4OMMA 2KXDA 1QWEA 1ABOA 1ZLMA 1YWPA 4AFUC 3M0QA 1T3SA 5EC7A 4J9CA 2A28A 1CSKA 2JTEA 5IXFA 1VYTA 2J7IA 3RBBB 1UFFA 2CREA 3TVTA 1UE9A 3GBQA 1HSQA 2JS0A 4J9IA 1GCQC 4J9FA 2EYXA 1UHCA 3R6NA 1ZBJA 2RQVA 4Z8AA 1K1ZA 2JM9A 2L3SA 3A98A 2AKKA 3LH5A 3REBB 1Y0MA 1SHGA 2DA9A 2LZ6B 2AKLA 4J9GA 4AFZC 1QCFA 1JO8A 2CUBA 2J6FA 1YWOA 4CC4B 1B3QA 2XMFA 2F2VA 1QKXA 1UECA 2DILA 3NGPA 3VS2A 2DNUA 1YN8A 1WYXA 2SEMA 3VS6A 1AOJA 2RPNA 1PKTA 3KFVA 2MCNA 2V1QA 1JQQA 1AZGB 1PRMC 1GFCA 2A37A 1RLQC 2DLPA 2YUNA 1KJWA 2CSIA 1AEYA 4J9EA 1X6GA 2OAWA 4F17A 1Z9ZA 2I0NA 5IXBA 2DL8A 2K9GA 2KNBB 1WLPB 2EGAA 1BB9A 2IIMA 2KEAA 2SRCA 4RTZA 1GCPA 2QDLA 2RQUA 1S1NA 1T0JA 2LNHB 1UGVA 2V1RA 2AZVA 2MIOA 2RQWA 3EHRA 1T0HA 1K0XA 4RTYA 3VRYA 4JJCA 1WXUA 1U3OA 1M30A 1WI7A 3H0HA 4LE9A 1E6HA 2KYBA 2CSQA 2EVRA 4LN2A 5FWBA 4RTXA 2LJ0A 2GTOA 1OEBA 3U23A 3QWXX 1WFWA 2P4RA 2RF0A 2EPDA 2CT4A 1NYGA 2DL5A 2DBKA 1BK2A 2FRWA 4HXJA 4AFQC 3VS5A 1WA7A 2YDLA 1AWOA 5GJWB 4AG1C 4K11A 2EBPA 1X6BA 3M0UA 1H8KA 1NEGA 1RUWA 1OV3A 3PE0A 1KSWA 1M27C 4AG2C 2J05A 4AFSC 2L2PA 4CC3A 4J9DA 2NWMA 1JU5C 2RQTA 1UHFA 2FPDA 2RQRA 2YUPA 1YNZA 5I11A 3IQLA 2PNIA 1ABQA 1OPKA 1ZUUA 1K76A 2LCSA 2LQWA 2C0TA 4RTWA 1NG2A 1H3HA 1XOVA 2HCKA 2EKHA 4JJDA 1MV3A 3C0CA 2LQNA 2EYWA 2CT3A 1QLYA 4OMQA 2EGEA 5IHIA 1AWWA 1Z9QA 3VS7A 2K7AA 2JXBA 2C0OA 2DBMA 2O2OA 1WDXA 4LNPA 2BZXA 1PHTA 1BBZA 2VKNA 3SHWA 2CUDA 1K0SA 1UUEA 1AZEA 2ROLA 4A63B 1X2QA 3VRZA 4JJBA 2G6FX 2HDAA 2O9SA 1SRMA 2EQIA 3I5RA 2J6KA 1MV0B 2DL3A 1I07A 2X3WD 4JPBW 1I0CA 1NM7A 2VVKA 2J6OA 1E6GA 3EG0A 1G83A 2LX7A 2EW3A 4X1VA 1W6XA 2L3PA 2HBWA 3THKA 2KYMA 1A0NB 2L3QA 2DE0X 3REAB 1BU1A 2OJ2A 4OMOA 1X69A 4OMLA 1V1CA 2CH4W 4J9BA 1G2BA 1RI9A 2K6DA 2PZ1A 1X43A 4CC2A 1SRLA 1TUCA 1WXBA 2HSPA 2H8HA 5FW9A 3NMZC 2B86A 2D0NA 2LJ1A 2DL7A 1OPLA 2ED0A 1SHFA 1TUDA 3PVQA 2LJ3A 2ENMA 3H0FA 2GNCA 5IH2A 2GBQA 1B07A 3M0TA 1UTIA 3RNJA 4DEXA 2ED1A 5L23A 1NLPC 1X27A 2C0IA 4OMNA 2DF6A 2DVJA 2KT1A 3ULRB 1NLOC 3UA7A 4GLMA 3ZL7C 5IHKA 4HVWA 2DL4A 4RTUA 4F16A 2FO0A 1U06A 1GBQA 1K4US 1UJYA 3TSZA 2KRSA 3M0RA 2RN8A 5FWCA 2FG0A 5HCKA 4IIMA 3SEMA 1J3TA 3TSWA 4ESRA 2D1XA 3VS3A 4HVVA 1FYNA 1ZUYA 2OI3A 2KROA 2O31A 2FPEA 3EG1A 1SSHA 3O5ZA 2JM8A 1I1JA 1LCKA 1ZX6A 1SEMA 2YUQA 4M4ZA 2GQIA 1JXMA 1OOTA 4WCIA 1GL5A 4JZ4A 1AVZC 4ZNXA 2K79A 1M3AA 1QWFA 3I5SA 1PRLC 2DX1A 2W10A 5ECAA 2RNAA 1ZSGA 3JV3A 1NYFA 2M51A 1Y57A 1KIKA 1YP5A 4D8KA 2JMCA 2EGCA 2J06A 1SPKA 3UA6A 1YCSB 2JT4A 2JS2A 4HVUA 4J9HA 4LUEA 1KFZA 4FSSA 1E7OA 1IO6A 1NEBA 4QT7A 2ECZA 1K9AA 2JW4A 5IHNA 3VS0A 1PNJA 2KT8A 2KE9A 3I35A 4RTVA 2DJQA 2X3XD 3VS1A 3FJ5A 2KRNA 1GCQA 1W1FA 1CKBA 2DRKA 2EYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MUZ A;  1N5Z A;  4F14 A;  1EFN A;  2KBT A;  4RUG A;  1TG0 A;  2NUZ A;  1RLP C;  3EGU A;  1GBR A;  2A36 A;  1M3B A;  1VYU A;  2BTT A;  1M8M A;  2CDT A;  3M0S A;  2HEQ A;  2EYZ A;  3UAT A;  1WX6 A;  4E6R A;  1HJD A;  1UG1 A;  1QKW A;  2YUO A;  2KR3 A;  2AK5 A;  1X2K A;  2GGR A;  4HCK A;  2A08 A;  2L0A A;  1T3L A;  2LMJ A;  3H41 A;  2FEI A;  2D8H A;  2FRY A;  2K3B A;  2GTJ A;  1PWT A;  1JXO A;  2K2M A;  4RTT A;  3VS4 A;  2BZ8 A;  3EG3 A;  2JMA A;  4OMP A;  2YT6 A;  1M3C A;  4R0K A;  2KGT A;  3NHN A;  2O88 A;  1GRI A;  2FPF A;  5I22 A;  4GBQ A;  1UJ0 A;  2BZY A;  2AZS A;  4DEY A;  2DRM A;  2O9V A;  1GFD A;  1PKS A;  1U5S A;  4CC7 A;  1FMK A;  1VYV A;  4D8D A;  3H0I A;  2ESW A;  2M0Y A;  3UF4 A;  5GJV B;  4LUD A;  3EG2 A;  4Z88 A;  1AWX A;  4Z89 A;  1ZUK A;  2RMO A;  2CH4 A;  2W0Z A;  2ABL A;  2MOX A;  1AWJ A;  2D8J A;  2YSQ A;  4ORZ A;  2LP5 A;  1W70 A;  1UDL A;  1AD5 A;  1VA7 A;  2KRM A;  2E5K A;  1WXT A;  3EHQ A;  2DM1 A;  3NPF A;  3QWY A;  3M0P A;  2F2X A;  3I9Q A;  1CKA A;  1ARK A;  3CQT A;  2KXC A;  2DYB A;  2DMO A;  3PVL A;  2ROT A;  4Y92 A;  2PTK A;  2VWF A;  1JEG A;  4EIK A;  4JZ3 A;  1H92 A;  4KRT A;  1HD3 A;  2F2W A;  4IIO A;  1WIE A;  4OMM A;  2KXD A;  1QWE A;  1ABO A;  1ZLM A;  1YWP A;  4AFU C;  3M0Q A;  1T3S A;  5EC7 A;  4J9C A;  2A28 A;  1CSK A;  2JTE A;  5IXF A;  1VYT A;  2J7I A;  3RBB B;  1UFF A;  2CRE A;  3TVT A;  1UE9 A;  3GBQ A;  1HSQ A;  2JS0 A;  4J9I A;  1GCQ C;  4J9F A;  2EYX A;  1UHC A;  3R6N A;  1ZBJ A;  2RQV A;  4Z8A A;  1K1Z A;  2JM9 A;  2L3S A;  3A98 A;  2AKK A;  3LH5 A;  3REB B;  1Y0M A;  1SHG A;  2DA9 A;  2LZ6 B;  2AKL A;  4J9G A;  4AFZ C;  1QCF A;  1JO8 A;  2CUB A;  2J6F A;  1YWO A;  4CC4 B;  1B3Q A;  2XMF A;  2F2V A;  1QKX A;  1UEC A;  2DIL A;  3NGP A;  3VS2 A;  2DNU A;  1YN8 A;  1WYX A;  2SEM A;  3VS6 A;  1AOJ A;  2RPN A;  1PKT A;  3KFV A;  2MCN A;  2V1Q A;  1JQQ A;  1AZG B;  1PRM C;  1GFC A;  2A37 A;  1RLQ C;  2DLP A;  2YUN A;  1KJW A;  2CSI A;  1AEY A;  4J9E A;  1X6G A;  2OAW A;  4F17 A;  1Z9Z A;  2I0N A;  5IXB A;  2DL8 A;  2K9G A;  2KNB B;  1WLP B;  2EGA A;  1BB9 A;  2IIM A;  2KEA A;  2SRC A;  4RTZ A;  1GCP A;  2QDL A;  2RQU A;  1S1N A;  1T0J A;  2LNH B;  1UGV A;  2V1R A;  2AZV A;  2MIO A;  2RQW A;  3EHR A;  1T0H A;  1K0X A;  4RTY A;  3VRY A;  4JJC A;  1WXU A;  1U3O A;  1M30 A;  1WI7 A;  3H0H A;  4LE9 A;  1E6H A;  2KYB A;  2CSQ A;  2EVR A;  4LN2 A;  5FWB A;  4RTX A;  2LJ0 A;  2GTO A;  1OEB A;  3U23 A;  3QWX X;  1WFW A;  2P4R A;  2RF0 A;  2EPD A;  2CT4 A;  1NYG A;  2DL5 A;  2DBK A;  1BK2 A;  2FRW A;  4HXJ A;  4AFQ C;  3VS5 A;  1WA7 A;  2YDL A;  1AWO A;  5GJW B;  4AG1 C;  4K11 A;  2EBP A;  1X6B A;  3M0U A;  1H8K A;  1NEG A;  1RUW A;  1OV3 A;  3PE0 A;  1KSW A;  1M27 C;  4AG2 C;  2J05 A;  4AFS C;  2L2P A;  4CC3 A;  4J9D A;  2NWM A;  1JU5 C;  2RQT A;  1UHF A;  2FPD A;  2RQR A;  2YUP A;  1YNZ A;  5I11 A;  3IQL A;  2PNI A;  1ABQ A;  1OPK A;  1ZUU A;  1K76 A;  2LCS A;  2LQW A;  2C0T A;  4RTW A;  1NG2 A;  1H3H A;  1XOV A;  2HCK A;  2EKH A;  4JJD A;  1MV3 A;  3C0C A;  2LQN A;  2EYW A;  2CT3 A;  1QLY A;  4OMQ A;  2EGE A;  5IHI A;  1AWW A;  1Z9Q A;  3VS7 A;  2K7A A;  2JXB A;  2C0O A;  2DBM A;  2O2O A;  1WDX A;  4LNP A;  2BZX A;  1PHT A;  1BBZ A;  2VKN A;  3SHW A;  2CUD A;  1K0S A;  1UUE A;  1AZE A;  2ROL A;  4A63 B;  1X2Q A;  3VRZ A;  4JJB A;  2G6F X;  2HDA A;  2O9S A;  1SRM A;  2EQI A;  3I5R A;  2J6K A;  1MV0 B;  2DL3 A;  1I07 A;  2X3W D;  4JPB W;  1I0C A;  1NM7 A;  2VVK A;  2J6O A;  1E6G A;  3EG0 A;  1G83 A;  2LX7 A;  2EW3 A;  4X1V A;  1W6X A;  2L3P A;  2HBW A;  3THK A;  2KYM A;  1A0N B;  2L3Q A;  2DE0 X;  3REA B;  1BU1 A;  2OJ2 A;  4OMO A;  1X69 A;  4OML A;  1V1C A;  2CH4 W;  4J9B A;  1G2B A;  1RI9 A;  2K6D A;  2PZ1 A;  1X43 A;  4CC2 A;  1SRL A;  1TUC A;  1WXB A;  2HSP A;  2H8H A;  5FW9 A;  3NMZ C;  2B86 A;  2D0N A;  2LJ1 A;  2DL7 A;  1OPL A;  2ED0 A;  1SHF A;  1TUD A;  3PVQ A;  2LJ3 A;  2ENM A;  3H0F A;  2GNC A;  5IH2 A;  2GBQ A;  1B07 A;  3M0T A;  1UTI A;  3RNJ A;  4DEX A;  2ED1 A;  5L23 A;  1NLP C;  1X27 A;  2C0I A;  4OMN A;  2DF6 A;  2DVJ A;  2KT1 A;  3ULR B;  1NLO C;  3UA7 A;  4GLM A;  3ZL7 C;  5IHK A;  4HVW A;  2DL4 A;  4RTU A;  4F16 A;  2FO0 A;  1U06 A;  1GBQ A;  1K4U S;  1UJY A;  3TSZ A;  2KRS A;  3M0R A;  2RN8 A;  5FWC A;  2FG0 A;  5HCK A;  4IIM A;  3SEM A;  1J3T A;  3TSW A;  4ESR A;  2D1X A;  3VS3 A;  4HVV A;  1FYN A;  1ZUY A;  2OI3 A;  2KRO A;  2O31 A;  2FPE A;  3EG1 A;  1SSH A;  3O5Z A;  2JM8 A;  1I1J A;  1LCK A;  1ZX6 A;  1SEM A;  2YUQ A;  4M4Z A;  2GQI A;  1JXM A;  1OOT A;  4WCI A;  1GL5 A;  4JZ4 A;  1AVZ C;  4ZNX A;  2K79 A;  1M3A A;  1QWF A;  3I5S A;  1PRL C;  2DX1 A;  2W10 A;  5ECA A;  2RNA A;  1ZSG A;  3JV3 A;  1NYF A;  2M51 A;  1Y57 A;  1KIK A;  1YP5 A;  4D8K A;  2JMC A;  2EGC A;  2J06 A;  1SPK A;  3UA6 A;  1YCS B;  2JT4 A;  2JS2 A;  4HVU A;  4J9H A;  4LUE A;  1KFZ A;  4FSS A;  1E7O A;  1IO6 A;  1NEB A;  4QT7 A;  2ECZ A;  1K9A A;  2JW4 A;  5IHN A;  3VS0 A;  1PNJ A;  2KT8 A;  2KE9 A;  3I35 A;  4RTV A;  2DJQ A;  2X3X D;  3VS1 A;  3FJ5 A;  2KRN A;  1GCQ A;  1W1F A;  1CKB A;  2DRK A;  2EYY A; 
#chains in the Genus database with same CATH topology
 1N5Z A;  4F14 A;  2ZZD A;  1AHJ B;  1W4S A;  3E1S A;  3VV0 A;  2YXY A;  2A36 A;  4O5V A;  1M3B A;  1VQ9 A;  1Q7Y R;  2EJ9 A;  3QDR B;  3INZ A;  2OTL A;  5CO7 A;  1UG1 A;  3CCE Q;  2EIF A;  2RJE A;  3QUI A;  1SG5 A;  2RI3 A;  2COZ A;  4PFO A;  1Q7Y C;  5LJ3 f;  5KYW A;  3JB9 F;  1HXD A;  2RHZ A;  2FRY A;  4PL6 A;  3JCM P;  2OTJ Q;  5KCH A;  2BE7 D;  5J3B A;  5I21 A;  4E47 A;  2LTO A;  3OYA A;  1UGS B;  3SDZ A;  2O88 A;  5I22 A;  3CCR A;  1W2B A;  2Y90 A;  5KYX B;  3SD4 A;  3CCL Q;  3HRU A;  3M59 A;  2LQK A;  2O9V A;  3OW2 A;  5GAN 7;  3LGF A;  3CPW S;  4CC7 A;  3PGG A;  3UF4 A;  4AT1 B;  1ZUK A;  5FRM A;  2W0Z A;  1G5V A;  2VAS A;  4F7U A;  2D8J A;  3A8H B;  3QJ6 A;  1AD5 A;  3LYI A;  1KC8 R;  2EWN A;  1WZO A;  2DM1 A;  3FDR A;  3QWY A;  3QJY A;  2F2X A;  3MP6 A;  4XU2 A;  4E7Z A;  3PVL A;  2DMO A;  5KH6 A;  4RG8 A;  1HYO A;  4M7A C;  1VQ5 T;  4RCB A;  1H92 A;  4JJN K;  2F2W A;  1WIE A;  2X4X A;  2DYI A;  1QWE A;  1VOM A;  2RA2 A;  1ZLM A;  3LW5 E;  3NTI A;  5GAM f;  3WXM B;  5GMK h;  4J9C A;  4IUR A;  2DO3 A;  1KC8 C;  1FMW A;  1VYT A;  4Z02 A;  3GOX A;  2CRE A;  1XTD A;  3CXC A;  2QA4 Q;  2JS0 A;  3R6N A;  2EYX A;  5FU6 C;  1JJ2 S;  2ZGW A;  2AKK A;  3LH5 A;  3REB B;  1Y0M A;  3A8L B;  4FYY B;  3M57 A;  2LCC A;  2AKL A;  1LNX A;  1QCF A;  4C92 F;  1I4K 1;  3SWN A;  1VQ4 T;  5GAN f;  3JB9 J;  5D6W A;  4BY6 C;  2EFI A;  2DIL A;  3VS2 A;  5GAO q;  2V8J A;  2DPP B;  5CAI A;  1WYX A;  4M78 B;  3FC3 A;  2AIR B;  3D7S B;  2DFU A;  1WNL A;  1SSF A;  1VQ5 A;  2RD1 A;  4XTY A;  1RLQ C;  3PMI A;  5LJ5 e;  2CSI A;  1AEY A;  3JCM b;  4B6M A;  2WSF E;  5IXB A;  2DL8 A;  2K9G A;  1WLP B;  3ER0 A;  2SRC A;  2NLU A;  2QDL A;  2RQU A;  1T0J A;  2P4T A;  2AZV A;  2MIO A;  2RQW A;  4M7D A;  2XKO C;  3HSB A;  2DTO A;  2CP6 A;  2QEX Q;  4MDX A;  4QVD A;  2R5M A;  3ZBD A;  1M30 A;  3H0H A;  1VQ7 Q;  2Y4X A;  3MJX A;  3BDL A;  3V8K A;  4DQ2 A;  1LOJ A;  3EGX B;  1VQ4 A;  3L1A A;  1K8A U;  2RM4 A;  5GAN 4;  4NL2 A;  2RHY A;  2GTO A;  4F7U B;  2E64 A;  1WFW A;  3OYJ A;  2EPD A;  3DKM A;  2CT4 A;  3HFO A;  7AT1 B;  1K9M U;  3P8H A;  5LJ5 h;  4EMK C;  5GAO m;  4PJN A;  2YDL A;  4EPC A;  5GJW B;  4AG1 C;  1YFN A;  4E7K A;  1TWB A;  2EBP A;  2NUP A;  2YRV A;  5EG2 A;  4FW2 A;  4C0G A;  1QVG A;  2XID A;  3R6O A;  2MWP A;  1NBE B;  4ZGE B;  5A0G A;  5FRO A;  1JU5 C;  1UHF A;  1VQ9 Q;  8AT1 B;  4JRK A;  2QAZ A;  3IQL A;  3C12 A;  3L2V A;  1KQS S;  5KYY B;  1ABQ A;  1M1K U;  2LT4 A;  1K76 A;  2LCS A;  1RAB B;  2LQW A;  3A8O B;  3JCM J;  3CCJ T;  2C0T A;  1NG2 A;  2RK1 A;  4R56 A;  3PFS A;  2LQN A;  2EYW A;  4N4G A;  4PJO E;  2EGE A;  2QGG A;  1Q95 G;  2FVU A;  2JXB A;  1N6A A;  4PJO F;  2DBM A;  1YJN T;  1ZSZ B;  1HK9 A;  2BZX A;  1PHT A;  2VKN A;  2CUD A;  4DOV A;  2GQV A;  1X2Q A;  4X34 A;  3VRZ A;  4RKU E;  1F1B B;  1W2B S;  2O9S A;  3CCR Q;  4L6V 5;  4ZTJ A;  2EQI A;  3I5R A;  5LJ3 e;  1QP3 A;  2ZPE B;  2RJF A;  1I07 A;  2EQU A;  3H9N A;  1NM7 A;  3HP9 A;  2VVK A;  1C6V X;  1E6G A;  4ZN3 A;  3OBW A;  1NPP A;  4LD9 K;  4M75 F;  1N8R U;  1VQP Q;  1RAF B;  2LX7 A;  3M9Q A;  4GY5 A;  4ZGJ B;  3HKS A;  3C95 A;  3DB3 A;  3MCA B;  3CEY A;  2HBW A;  3QO3 A;  3THK A;  3I55 Q;  3REA B;  3CCJ A;  1KK7 A;  4OGC A;  4ZN1 A;  3G4S T;  2RB6 A;  1RI9 A;  2RJC A;  3EFR A;  1X43 A;  2K3Y A;  3MPU B;  3QDF A;  4HA8 A;  1WXB A;  3RKW A;  3RMS A;  2HSP A;  4E7I A;  3V8J A;  1KHC A;  2ED0 A;  1M90 R;  1YIJ T;  1TUD A;  3OSV A;  2LJ3 A;  1QCO A;  1YJN A;  4XTX A;  4DEX A;  1XQH A;  2ED1 A;  4II1 A;  1NLP C;  5LJ3 h;  5L23 A;  4OMN A;  4Y91 A;  3X25 B;  2DF6 A;  4XQ3 A;  3BE3 A;  4OB1 B;  1NLO C;  5GAN 5;  2XDB A;  1M90 C;  1WHJ A;  3GLX A;  1D3B B;  3QZ5 B;  2DL4 A;  2DIQ A;  4RTU A;  3LWH A;  2RK2 A;  2DTH A;  2RH2 A;  1GBQ A;  1K4U S;  4PJO D;  2KRS A;  1QP2 A;  5GAO l;  2FG0 A;  3GF5 A;  2MWO A;  3TSW A;  1RAA B;  3VS3 A;  3UPU A;  1G3T A;  2RO0 A;  2O31 A;  3C94 A;  4KGV B;  3G4S A;  2M9U A;  1I1J A;  1PD0 A;  1ZX6 A;  1SEM A;  4XTW A;  5GMK i;  3OS1 A;  4OVA A;  1N8R R;  2YHT A;  1VQ5 Q;  1GL5 A;  3S3N A;  4KUL A;  2DXT A;  4JZ4 A;  4Y28 E;  1YIJ A;  1Q81 U;  5GAN e;  4ZNX A;  1QVP A;  1M3A A;  4O6J A;  2DX1 A;  3VUZ A;  3OYC A;  2EQM A;  4PJO G;  3CCU Q;  1IHW A;  1PD1 A;  2LQ8 A;  2M51 A;  1N8R C;  2FB7 A;  1PCX A;  2J06 A;  1OQK A;  4HKE A;  3E19 A;  1YCS B;  3EFO B;  2OX7 A;  1I8F A;  2MYS A;  4HVU A;  4FSS A;  3LLR A;  1E7O A;  3OYN A;  4C8Q A;  1IO6 A;  3CCM T;  4LDX A;  4DOW A;  2JW4 A;  1M2O A;  1BIB A;  1VQ4 Q;  3I35 A;  1GCQ A;  1W1F A;  1CKB A;  4M78 C;  4JLG A;  1EFN A;  2KBT A;  1UGR B;  1I5L A;  1RLP C;  4C92 A;  3EGU A;  5GAN h;  3CBM A;  3JAM E;  4M7D E;  2JN0 A;  4Q5W A;  1NJI U;  3FRN A;  3M0S A;  2CDT A;  1WX6 A;  4M7D F;  2FHD A;  5D6X A;  9ATC B;  2JTM A;  1QVG S;  2CP0 A;  2KR3 A;  3QPH A;  1H64 1;  1X2K A;  5CQY A;  3GNF B;  4KGZ B;  2JUF A;  4MZM A;  2A08 A;  2LMJ A;  3CC4 T;  2FEI A;  5A0L A;  2D8H A;  2XI9 A;  3O8V A;  3RER A;  2K3B A;  4F7U G;  2K2M A;  4RTT A;  1TSF A;  1OZ3 A;  3OS0 A;  3VS4 A;  2BZ8 A;  1PC0 A;  2YT6 A;  5LJ5 f;  3CCM A;  1M9S A;  2ATC B;  2A3L A;  4BI8 B;  4BE0 A;  2DRM A;  4FT2 A;  1GFD A;  1PKS A;  4M77 A;  2DIG A;  2VGM A;  2QTX A;  2ESW A;  2VUB A;  2XG8 D;  2M0Y A;  5GJV B;  1C0M A;  3EG2 A;  3KXT A;  4Z88 A;  4EMG A;  5C0M A;  4Z89 A;  3CD6 Q;  2CH4 A;  5GAN 6;  3OMC A;  2FZC B;  2D0Q B;  3TU4 K;  2XK0 A;  2YSQ A;  4ORZ A;  1W70 A;  1VA7 A;  2VV5 A;  2CZ6 B;  1IGQ A;  5GMK m;  2DK3 A;  3JCM c;  1VQL T;  3NPF A;  3M0P A;  2K5L A;  3I9Q A;  3CQT A;  2KXC A;  2PTK A;  2VWF A;  4R55 A;  2QDY B;  4JZ3 A;  1KHI A;  4KRT A;  1HD3 A;  3CC4 A;  4X9D A;  1ABO A;  2BIV A;  1YWP A;  4AFU C;  3CCJ Q;  4OGE A;  4M7A F;  4M7D D;  2JTE A;  2XU8 A;  3JCM W;  2J7I A;  3OS2 A;  1RL2 A;  1B34 B;  2HL5 C;  1NJI C;  1BKB A;  2XIC A;  4J9F A;  2EKO A;  2L8D A;  3SWN C;  3FLG A;  4J5Y A;  1ZSZ C;  4QKU A;  5I2M A;  4PLI A;  1K1Z A;  1YJN Q;  3VUB A;  2DA9 A;  1M4Z A;  2LZ6 B;  2K5F A;  1BI2 A;  4AFZ C;  5GAM g;  4OB2 B;  2J6F A;  4CC4 B;  1B3Q A;  2VXF A;  2M1H A;  2DXC A;  2XMF A;  3V8L A;  5GAM j;  3HPW A;  1VQK Q;  3OS5 A;  1UEC A;  4M7D G;  5HK0 A;  3OMG A;  1D0Z A;  1YN8 A;  5CKF A;  1WQ7 A;  1VQL A;  2GF7 A;  3KFV A;  2FL7 A;  3OYF A;  3JCM g;  3DLL A;  3M56 A;  1JQQ A;  1AZG B;  1PRM C;  4HT9 A;  1GFC A;  5FU7 B;  2VB6 A;  1BCO A;  4RCC A;  3CPW P;  1S72 T;  4M75 A;  3QYH B;  5HKC A;  1Q86 U;  1Z9Z A;  2I0N A;  4A54 A;  3G4S Q;  2DZ9 A;  2IIM A;  4RTZ A;  4EMH A;  3OYG A;  3OYY A;  2LNH B;  1UGV A;  3RMQ A;  3J81 E;  5CR2 A;  1YIJ Q;  1T0H A;  2DAQ A;  3VRY A;  1WXU A;  2HNI A;  3GNG A;  2GFU A;  5GMK e;  3FEO A;  3S3O A;  3VYH B;  1WHH A;  2X35 A;  4RTX A;  3ZFJ A;  2HBP A;  1TS9 A;  1M2V B;  4FW1 A;  2RF0 A;  1U8R A;  1NYG A;  4DBR A;  2E3I A;  1BK2 A;  2FRW A;  2EYY A;  2DET A;  2DZC A;  3OBY A;  3HTR A;  1AWO A;  2DEU A;  3M4Y A;  2A0F B;  2DJZ A;  1H8K A;  1NEG A;  2J05 A;  1S72 A;  2MF2 A;  2L2P A;  4PNO A;  4E7S A;  4CC3 A;  2MK5 A;  5CK9 A;  3T9N A;  3JCM Q;  2Z0W A;  2WAC A;  3EGD A;  2CP5 A;  2KSS A;  3M53 A;  4MML A;  4C8Q E;  2OAU A;  1X75 C;  3M55 A;  1LJO A;  3CME T;  2E1H A;  1Q86 R;  4C8Q F;  2EKH A;  1MV3 A;  3C0C A;  5IHI A;  1Z9Q A;  1WJQ A;  3JCM X;  2K7A A;  3JB9 D;  1VQO T;  2C0O A;  1MHN A;  1B7T A;  4PJO B;  1PSF A;  4C92 E;  4WF2 A;  4LNP A;  4X9C A;  2CZ7 B;  1Q86 C;  1K0S A;  2COY A;  1AZE A;  4A63 B;  3CCM Q;  3RKX A;  4FT4 A;  4PJM A;  2HDA A;  4XU3 A;  4AMC A;  3PTA A;  3OA6 A;  1SRM A;  4KH1 B;  2X51 A;  1I0C A;  3RES A;  3OYM A;  4HT8 A;  2NYS A;  2VYT A;  4N4H A;  5KYU A;  1VUB A;  5KYW B;  3JB9 G;  1VQ6 T;  2KYM A;  1A0N B;  2OJ2 A;  4OMO A;  2O4X A;  2ZAE A;  3HHT B;  1V1C A;  1G2B A;  3CME A;  2E10 A;  2K6D A;  1V76 A;  3PMT A;  4V2S A;  1RI0 A;  1QMC A;  2H8H A;  4M77 E;  5FW9 A;  4C0Z A;  2XHC A;  1MMD A;  2LJ1 A;  4FIB A;  3CCQ T;  3CC4 Q;  1VQO A;  5CKH A;  1WJR A;  2DVE A;  4JS4 A;  4M77 F;  1WQW A;  5IH2 A;  3M0T A;  1UTI A;  5GAO p;  3RKY A;  2CZ0 B;  1AT1 B;  3HRS A;  4MDW A;  1TOV A;  4L59 A;  2KT1 A;  1KQS P;  3UA7 A;  2QQ9 A;  3HFN A;  3MP8 A;  4HVW A;  1M5Q 1;  3AT1 B;  4F16 A;  3OYL A;  2FO0 A;  4JS5 A;  1U06 A;  1D1B A;  1FWZ A;  1UJY A;  3TSZ A;  3M0R A;  1RAH B;  3JB9 H;  4QVZ A;  5FWC A;  5HCK A;  3WVD B;  4IIM A;  1J3T A;  1K73 U;  4ESR A;  2ZPF B;  2D1X A;  3L2Z A;  3OYH A;  4XTZ A;  4C92 D;  1FYN A;  1ZUY A;  3QHS A;  1VQ6 A;  3EG1 A;  2X4J A;  3C4S A;  4C0D B;  3X24 B;  3JB9 I;  1VQL Q;  3OYD A;  1W2B P;  2OTL Q;  2MAM A;  4KGX B;  4FYW B;  5HY6 A;  4RMO A;  3CCQ A;  4ME7 A;  2E65 A;  3I56 T;  1QWF A;  5ECA A;  2RNA A;  1ZSG A;  3CC2 T;  2K57 A;  4XU0 A;  2V8K A;  1YBY A;  2MPX C;  1R0B G;  1YIT T;  1TUG B;  1MGQ A;  1VIE A;  1YJW T;  1C1A A;  4BUG A;  2HMA A;  3SWN B;  4C92 G;  1N9S A;  3MEW A;  5CQX A;  3G7Z A;  1YP5 A;  4D8K A;  2EQJ A;  3V7S A;  4M7A A;  1KQ1 A;  2EGC A;  1QVF A;  1Y7X A;  3UA6 A;  2JJ9 A;  4PFZ A;  1IB8 A;  4FL6 A;  2P0K A;  4M77 D;  4NOY A;  1NEB A;  4C92 C;  1K8A R;  2YWW A;  3OW2 S;  4M75 E;  1PNJ A;  4RTV A;  2DJQ A;  2X3X D;  2G3R A;  3M58 A;  4FSX A;  1K9M R;  1TG0 A;  3J80 E;  2QQA A;  1RAI B;  3LGL A;  1N27 A;  4M78 F;  1OYX A;  1VYU A;  2BTT A;  2A7Y A;  5FU7 C;  2HEQ A;  1K8A C;  2LX9 A;  4M7D B;  2VGN A;  3L2U A;  4GLK A;  1QKW A;  4QVC A;  3PIP A;  1S72 Q;  1K9M C;  2AK5 A;  3I56 A;  2LRQ A;  3X28 B;  3JCM d;  3LX7 A;  3CC2 A;  3A8G B;  2PVD B;  3N5B B;  5A2Q E;  1EZZ B;  1YIT A;  1M1K R;  2COW A;  2ZCF B;  2R57 A;  1YJW A;  3MHX A;  2XD0 A;  4FYX B;  3EG9 A;  1TU0 B;  2DXU A;  2E41 A;  3GIB A;  4N0A A;  1BIA A;  3EG3 A;  3CXC S;  4OMP A;  1M3C A;  1Y71 A;  2CP3 A;  3CBP A;  4R0K A;  3CBO A;  1M1K C;  1M1G A;  3NHN A;  2QQR A;  4C5H A;  2V8I A;  2IPO B;  2BZY A;  1BI1 A;  2ZPG B;  1WGS A;  2NUP B;  2AZS A;  4DEY A;  4A4H A;  2CZ1 B;  2K2V A;  2KAF A;  3RIR A;  3CCL T;  1U5S A;  1VYV A;  2K4Y A;  3H0I A;  4D8D A;  3VKI A;  4LUD A;  2RHI A;  2ZPB B;  4J7I A;  2ABL A;  2MOX A;  1AWJ A;  5KE2 A;  5LJ5 g;  4IUT A;  5LJ5 j;  1UDL A;  2KRM A;  3CC7 T;  3EHQ A;  1NZ9 A;  4DBQ A;  2JTF A;  1CKA A;  4M75 D;  1ARK A;  4E7L A;  3GPL A;  2L3R A;  3ME9 A;  2KXD A;  1N9R A;  1Y96 A;  4CRI A;  4YTL A;  4J83 A;  3ASK A;  5EC7 A;  2A28 A;  1CSK A;  3CME Q;  5IXF A;  4J6W A;  3RBB B;  1UFF A;  1UE9 A;  3GBQ A;  1HSQ A;  2ZPI B;  1QVG P;  4PJO C;  1UHC A;  2PUO B;  2F5T X;  3V7R A;  2RQV A;  2LNV A;  4Z8A A;  2JM9 A;  2L3S A;  3CCL A;  1MND A;  2BE9 B;  1VIF A;  4M75 G;  4J9G A;  3CPW A;  1JO8 A;  1YWO A;  4VUB A;  2F2V A;  3TEE A;  4KUD K;  2VC8 A;  1OU9 A;  2NUT A;  2DNU A;  3CC7 A;  4M75 C;  4LDV A;  2QAS A;  1D09 B;  1AOJ A;  2RPN A;  2QK0 A;  3JCM h;  4MZP A;  3JCM V;  3HRT A;  2LCL A;  3TQ7 P;  2A37 A;  3UWN A;  2DLP A;  1KJW A;  1M8V A;  1X6G A;  2OAW A;  4F17 A;  2QGF B;  4RG2 A;  2KNB B;  5GAO n;  1V29 B;  1GCP A;  5KE3 A;  5DY9 A;  1S1N A;  5KYN A;  1YJ9 T;  1Q81 R;  1WHK A;  2RJD A;  2V1R A;  3OQ5 A;  3EHR A;  3CCQ Q;  1OX8 A;  1K0X A;  1TH7 A;  2HSE B;  1WHL A;  4XAX B;  1G3S A;  2YLC A;  1BI3 A;  1RAD B;  1MMG A;  2DXB A;  2JVV A;  2O01 E;  2LT1 A;  3G6E T;  1Q81 C;  5LJ3 g;  2HD0 A;  2CSQ A;  2EVR A;  2F1L A;  3HL8 A;  4LN2 A;  5LJ3 j;  1QVF S;  2RI5 A;  3Q1J A;  2BKD N;  1NE8 A;  1OEB A;  5CCA A;  2HQE A;  2PQW A;  2EAY A;  4FU6 A;  4MMK A;  4HXJ A;  1I5O B;  3CMA T;  1WA7 A;  1FMV A;  5KYX A;  3J7A F;  3M0U A;  1X6B A;  1OUL A;  4A4G A;  3F70 A;  4XK8 E;  1KSW A;  1M27 C;  4C0D C;  4AFS C;  4LDU A;  4XU1 A;  1M1F A;  1Y96 B;  3L42 A;  1NJI R;  4J9D A;  4A4E A;  4M7A E;  4HCC A;  1JB0 E;  1TTH B;  2RQT A;  2RQR A;  2AT1 B;  2YUP A;  1YNZ A;  3RDV A;  5I11 A;  5CKD A;  1YJ9 A;  1NPR A;  1BCM A;  3L2Q A;  1BI0 A;  2HL3 A;  4RTW A;  3I56 Q;  1SF9 A;  4ZGD B;  3NTH A;  3CC2 Q;  4C8Q B;  4JJD A;  5CKE A;  2CT3 A;  1QLY A;  4OMQ A;  3G6E A;  1ACM B;  3QSU A;  2O2O A;  5CIU A;  2D6F A;  3M5A A;  1PSE A;  1WDX A;  5J26 A;  2IVW A;  1BBZ A;  4C92 B;  3E2U A;  2ROL A;  3RR6 A;  3CMA A;  5KCO A;  2HAX A;  2X3W D;  3CCV T;  1I81 A;  2FZG B;  4BI4 A;  3P8B B;  2WSC E;  3L2W A;  1G83 A;  3FB9 A;  4KBM B;  5HK3 A;  4M7D C;  4X1V A;  1VQP T;  4BI3 A;  5GAN g;  2AHJ B;  4A4K A;  5M9O A;  5GAN j;  2R5A A;  4OML A;  2RI2 A;  1KQS A;  2CH4 W;  1H3Z A;  3I55 T;  4J9B A;  4M78 A;  1UEB A;  4CC2 A;  1TUC A;  4J8O A;  1XJW B;  4FYV B;  2B86 A;  2D0N A;  2CYZ B;  1SHF A;  4XTV A;  3TCJ A;  3WVE B;  1ZA1 B;  2L5Q A;  4JRI A;  4M77 B;  1VQM T;  1QQJ A;  1MMN A;  2GBQ A;  1B07 A;  3X26 B;  4M7A D;  3A8M B;  1X27 A;  3MET A;  2C0I A;  4E7H A;  2DVJ A;  3LH0 A;  1YI2 T;  2JZ2 A;  5LL6 S;  1EIF A;  5IHK A;  4OB3 B;  1SKU B;  4KUI A;  3CCV A;  2RN8 A;  3H8Z A;  5CKB A;  4MZT A;  3ZEH A;  4NS5 A;  2GFA A;  1JJ2 P;  5GMK l;  5CVI A;  3FIF A;  3EGX A;  2OI3 A;  1VQP A;  2FPE A;  4L5G A;  2HQX A;  1Y07 A;  2WSE E;  4C5E A;  4M7A G;  3CC7 Q;  4ANJ A;  3I55 A;  2JM8 A;  1LCK A;  2YUQ A;  3PIO A;  4M4Z A;  5LJ5 d;  1U1S A;  1JXM A;  3MEA A;  2XDD A;  4PKC C;  1MMA A;  2P0P A;  4KH0 B;  1KQ2 A;  2M0O A;  1AVZ C;  4B9W A;  5FRN A;  2PVG B;  2CP2 A;  3I5S A;  1VQM A;  1VQ8 T;  2F5K A;  4OB0 B;  8ATC B;  3CCU T;  1YI2 A;  5KYY A;  2JMC A;  4F04 B;  4QQD A;  2MI6 A;  2JT4 A;  1WPY A;  2JS2 A;  4J9H A;  5IT9 E;  3CCS T;  1KFZ A;  5L8R E;  4ZTF A;  4PJL A;  3JCM f;  5GAN 8;  4IKF A;  1D0Y A;  4BE1 A;  1RAC B;  3BFM A;  3VS1 A;  1PM3 A;  1MNE A;  4OF1 A;  4M75 B;  4PFP A;  2DRK A;  4QW2 A;  3MEU A;  1ZSZ A;  1MUZ A;  1YCY A;  4J6X A;  1FXX A;  4RUG A;  2NUZ A;  4OMF B;  1GBR A;  2QI2 A;  3OYE A;  4LXC A;  3QBY A;  4JRQ A;  1M8M A;  2EYZ A;  3UAT A;  1G3W A;  3BW1 A;  4E6R A;  4LD6 A;  4A4F A;  1HJD A;  2LVM A;  2YUO A;  2QYZ A;  3PNW C;  2E6Z A;  5DM7 R;  1VQ8 A;  2KMT A;  4N0A C;  1ZQ1 A;  3SB2 A;  1KD1 U;  2GGR A;  2L89 A;  4HCK A;  2KQW A;  4P5N A;  1EX4 A;  2L0A A;  1T3L A;  1YJ9 Q;  4C5I A;  3CCU A;  1O9S A;  3H41 A;  2XDP A;  1RAG B;  2GTJ A;  1R8O B;  1PWT A;  1JXO A;  2ZPH B;  3UDC A;  2KY9 A;  3G71 T;  1DJ7 B;  2DD5 A;  3CCS A;  2JMA A;  4C8Q D;  2KGT A;  4PJJ A;  4KT0 E;  1GRI A;  2FPF A;  3G6E Q;  4GBQ A;  1UJ0 A;  2H3E B;  2CP7 A;  3VJP A;  3GP8 A;  1Q82 U;  3URG A;  5DLQ E;  1WHM A;  1FMK A;  4HCB A;  1LVK A;  2QG9 B;  3OSS C;  5LJ3 d;  4JRP A;  5DLO A;  1AWX A;  4BB7 A;  2RMO A;  3EGD B;  3CMA Q;  2MMP A;  3E9F A;  5D6Y A;  1G3Y A;  3OYI A;  4CI0 C;  4IUU A;  1D3B A;  2LP5 A;  3CD6 T;  2M16 A;  2F69 A;  3QG1 A;  2E5K A;  1WXT A;  4ELZ C;  1IRE B;  4C8Q G;  1FX7 A;  3G1J A;  1QCN A;  3OW2 P;  2DYB A;  2ROT A;  4Y92 A;  1YHQ T;  3QKJ A;  2JNG A;  1JEG A;  1XNI A;  4EIK A;  4N4I A;  4DBH A;  5J39 A;  3OY9 A;  4IIO A;  4OMM A;  2DEQ A;  3M0Q A;  1T3S A;  1M90 U;  1VQN T;  1KG1 A;  4DA4 A;  4PK4 A;  4C8Q C;  3G71 A;  1IXD A;  3RUX A;  5GMK j;  3JRZ A;  5C6S A;  3LWI A;  1KD1 R;  3OYK A;  5A0D A;  3TVT A;  2RHU A;  1UGQ B;  4J9I A;  1GCQ C;  3X20 B;  1ZBJ A;  2KI7 A;  3A98 A;  2HQH A;  1SHG A;  2FYK A;  4IUP A;  2X9H A;  1OI1 A;  4D6W A;  1KD1 C;  5KYU B;  1GXI E;  2CUB A;  4DBF A;  2EJG A;  4M78 E;  5GAM d;  3S3M A;  3CD6 A;  1Q82 R;  1QKX A;  2O4X B;  1X01 A;  2BUD A;  3CCV Q;  3NGP A;  3EFO A;  3CXC P;  1VQK T;  2SEM A;  3VS6 A;  3KUF A;  1K73 R;  2LDM A;  1PKT A;  2EYQ A;  2MCN A;  1LPL A;  1YHQ A;  2V1Q A;  1JBM A;  3QII A;  4PLL A;  5GAN 2;  2YUN A;  3CCE T;  4M77 G;  1ZHI A;  4J9E A;  3V7C A;  1Q82 C;  4IUV A;  1VQN A;  6AT1 B;  1K73 C;  2EGA A;  1BB9 A;  2KEA A;  2K3X A;  3A1P A;  3CPF A;  5GAN d;  2QTV A;  2EJF A;  3UT1 A;  2HZY A;  4JUV A;  2PU9 B;  4M77 C;  5AT1 B;  2VXE A;  1P92 A;  2OTJ T;  1U1T A;  3BDU A;  4RTY A;  1VQM Q;  4JJC A;  2R58 A;  1U3O A;  2Y4Y A;  4BDY A;  1WI7 A;  4LE9 A;  4EDU A;  1E6H A;  1RAE B;  2E6N A;  4F7U E;  1YI2 Q;  4JDS A;  2KYB A;  4OP0 A;  1G8X A;  5FWB A;  1D0X A;  2DD4 A;  3M54 A;  3MO8 A;  4F7U F;  5GAN 3;  1BYM A;  2LJ0 A;  2HKN A;  3U23 A;  3QWX X;  2P4R A;  1VQK A;  2DTI A;  2QQB A;  2DL5 A;  2DBK A;  3QYG B;  1WJS A;  4AFQ C;  3VS5 A;  5GAM e;  3DB4 A;  1R77 A;  1UB4 A;  4K11 A;  3CCE A;  1RUW A;  1OV3 A;  3PE0 A;  4AG2 C;  3PT9 A;  1IHV A;  4EMK A;  3L2R A;  3MP1 A;  3NTK A;  2NWM A;  2YRC A;  2DER A;  3QXE B;  4M78 D;  2FPD A;  3JCM e;  2PNI A;  1OPK A;  4BAC A;  4M7A B;  2K5I A;  1ZUU A;  3EAE A;  4HCZ A;  4FCY A;  2OTJ A;  2RHX A;  1H3H A;  1XOV A;  2V26 A;  1VQ8 Q;  3AHU A;  1D1C A;  2HCK A;  4UC4 A;  3MEV A;  1VQO Q;  1AWW A;  2QA4 T;  3VS7 A;  3EFS A;  2IG0 A;  5FU6 B;  1OU8 A;  5GAM h;  5IN1 A;  3SHW A;  2E4H A;  5FLX E;  3CCS Q;  1UUE A;  1B34 A;  3EH2 A;  4JJB A;  4M78 G;  5IAY A;  2G6F X;  2M02 A;  1OZ2 A;  5I2S A;  2LC4 A;  4TVR A;  2J6K A;  1MV0 B;  5GAO r;  1IGU A;  2DL3 A;  2D9T A;  3JSC A;  1JRI A;  2X4W A;  4JPB W;  2B8A A;  2J6O A;  4BY6 B;  3EG0 A;  4ELY C;  1VQ6 Q;  2EW3 A;  1PG5 B;  3S6W A;  1W6X A;  2L3P A;  4XTU A;  3NFC A;  2H3J A;  1QVF P;  2EQK A;  2DE0 X;  2L3Q A;  3EG9 B;  1BU1 A;  4J6Y A;  1X69 A;  4WTO B;  1IZ6 A;  2CS7 A;  4A53 A;  4LDY A;  2PZ1 A;  4BDZ A;  3OB9 A;  2GCX A;  3KBG A;  1SRL A;  2YRD A;  2X4Y A;  3VU3 C;  3A5Z B;  3H6Z A;  2QA4 A;  3SFM A;  2DL7 A;  1OPL A;  2E5Q A;  3PVQ A;  4FM4 B;  2ENM A;  2C06 A;  3H0F A;  1JJ2 A;  2GNC A;  2QEX T;  1OX9 A;  3G71 Q;  4J7F A;  3RNJ A;  2KK4 A;  1VQ7 T;  2PUK B;  2QXF A;  2QQS A;  2PVO B;  4C0F A;  2DKG A;  4C5G A;  4QQ6 A;  1D1A A;  3ULR B;  2I2L A;  2JOY A;  3FJP A;  3P8D A;  4GLM A;  2P0Q A;  3ZL7 C;  3DLM A;  2P84 A;  4B9X A;  3OYB A;  2YLB A;  1R0C B;  2CGH A;  2KVQ G;  4BD3 A;  3SEM A;  3EH1 A;  1TXQ A;  1Q7Y U;  4EMK B;  2KDS A;  2E70 A;  3VYG A;  1ZA2 B;  4HVV A;  4E2F B;  3MKD A;  2KRO A;  1SSH A;  5D7U A;  2FZK B;  3O5Z A;  1M2V A;  2GQI A;  1OOT A;  4NL3 A;  1VQ9 T;  1YHQ Q;  4WCI A;  3TRE A;  2OTL T;  1UGP B;  3E9G A;  2K79 A;  4JLI A;  3M4G A;  3BY7 A;  1YIT Q;  1PRL C;  2QEX A;  1VQN Q;  2HKQ B;  2W10 A;  1YJW Q;  2CKK A;  3JV3 A;  1VQ7 A;  1NYF A;  2E12 A;  4ATO A;  1Y57 A;  1KIK A;  1IRX A;  1QW1 A;  5AYF A;  1ZBX A;  1O75 A;  4IUQ A;  4BE2 A;  4LDW A;  1SPK A;  2NUT B;  2E3H A;  4LUE A;  4E7J A;  3QZ9 B;  1WHG A;  4QT7 A;  2ECZ A;  1K9A A;  5IHN A;  3VS0 A;  3CCR T;  2KT8 A;  2KE9 A;  3FJ5 A;  2KRN A;  1X6O A;  4PJO A;  4QQG A;  1KC8 U;  3NMZ C; 
#chains in the Genus database with same CATH homology
 1MUZ A;  1N5Z A;  4F14 A;  1EFN A;  2KBT A;  4RUG A;  1TG0 A;  2NUZ A;  1RLP C;  3EGU A;  1GBR A;  2A36 A;  1M3B A;  1VYU A;  2BTT A;  1M8M A;  2CDT A;  3M0S A;  2HEQ A;  2EYZ A;  3UAT A;  1WX6 A;  4E6R A;  1HJD A;  1UG1 A;  1QKW A;  2YUO A;  2KR3 A;  2AK5 A;  1X2K A;  2GGR A;  4HCK A;  2A08 A;  2L0A A;  1T3L A;  2LMJ A;  3H41 A;  2FEI A;  2D8H A;  2FRY A;  2K3B A;  2GTJ A;  1PWT A;  1JXO A;  2K2M A;  4RTT A;  3VS4 A;  2BZ8 A;  3EG3 A;  2JMA A;  4OMP A;  2YT6 A;  1M3C A;  4R0K A;  2KGT A;  3NHN A;  2O88 A;  1GRI A;  2FPF A;  5I22 A;  4GBQ A;  1UJ0 A;  2BZY A;  2AZS A;  4DEY A;  2DRM A;  2O9V A;  1GFD A;  1PKS A;  1U5S A;  4CC7 A;  1FMK A;  1VYV A;  4D8D A;  3H0I A;  2ESW A;  2M0Y A;  3UF4 A;  5GJV B;  4LUD A;  3EG2 A;  4Z88 A;  1AWX A;  4Z89 A;  1ZUK A;  2RMO A;  2CH4 A;  2W0Z A;  2ABL A;  2MOX A;  1AWJ A;  2D8J A;  2YSQ A;  4ORZ A;  2LP5 A;  1W70 A;  1UDL A;  1AD5 A;  1VA7 A;  2KRM A;  2E5K A;  1WXT A;  3EHQ A;  2DM1 A;  3NPF A;  3QWY A;  3M0P A;  2F2X A;  3I9Q A;  1CKA A;  1ARK A;  3CQT A;  2KXC A;  2DYB A;  2DMO A;  3PVL A;  2ROT A;  4Y92 A;  2PTK A;  2VWF A;  1JEG A;  4EIK A;  4JZ3 A;  1H92 A;  4KRT A;  1HD3 A;  2F2W A;  4IIO A;  1WIE A;  4OMM A;  2KXD A;  1QWE A;  1ABO A;  1ZLM A;  1YWP A;  4AFU C;  3M0Q A;  1T3S A;  5EC7 A;  4J9C A;  2A28 A;  1CSK A;  2JTE A;  5IXF A;  1VYT A;  2J7I A;  3RBB B;  1UFF A;  2CRE A;  3TVT A;  1UE9 A;  3GBQ A;  1HSQ A;  2JS0 A;  4J9I A;  1GCQ C;  4J9F A;  2EYX A;  1UHC A;  3R6N A;  1ZBJ A;  2RQV A;  4Z8A A;  1K1Z A;  2JM9 A;  2L3S A;  3A98 A;  2AKK A;  3LH5 A;  3REB B;  1Y0M A;  1SHG A;  2DA9 A;  2LZ6 B;  2AKL A;  4J9G A;  4AFZ C;  1QCF A;  1JO8 A;  2CUB A;  2J6F A;  1YWO A;  4CC4 B;  1B3Q A;  2XMF A;  2F2V A;  1QKX A;  1UEC A;  2DIL A;  3NGP A;  3VS2 A;  2DNU A;  1YN8 A;  1WYX A;  2SEM A;  3VS6 A;  1AOJ A;  2RPN A;  1PKT A;  3KFV A;  2MCN A;  2V1Q A;  1JQQ A;  1AZG B;  1PRM C;  1GFC A;  2A37 A;  1RLQ C;  2DLP A;  2YUN A;  1KJW A;  2CSI A;  1AEY A;  4J9E A;  1X6G A;  2OAW A;  4F17 A;  1Z9Z A;  2I0N A;  5IXB A;  2DL8 A;  2K9G A;  2KNB B;  1WLP B;  2EGA A;  1BB9 A;  2IIM A;  2KEA A;  2SRC A;  4RTZ A;  1GCP A;  2QDL A;  2RQU A;  1S1N A;  1T0J A;  2LNH B;  1UGV A;  2V1R A;  2AZV A;  2MIO A;  2RQW A;  3EHR A;  1T0H A;  1K0X A;  4RTY A;  3VRY A;  4JJC A;  1WXU A;  1U3O A;  1M30 A;  1WI7 A;  3H0H A;  4LE9 A;  1E6H A;  2KYB A;  2CSQ A;  2EVR A;  4LN2 A;  5FWB A;  4RTX A;  2LJ0 A;  2GTO A;  1OEB A;  3U23 A;  3QWX X;  1WFW A;  2P4R A;  2RF0 A;  2EPD A;  2CT4 A;  1NYG A;  2DL5 A;  2DBK A;  1BK2 A;  2FRW A;  4HXJ A;  4AFQ C;  3VS5 A;  1WA7 A;  2YDL A;  1AWO A;  5GJW B;  4AG1 C;  4K11 A;  2EBP A;  1X6B A;  3M0U A;  1H8K A;  1NEG A;  1RUW A;  1OV3 A;  3PE0 A;  1KSW A;  1M27 C;  4AG2 C;  2J05 A;  4AFS C;  2L2P A;  4CC3 A;  4J9D A;  2NWM A;  1JU5 C;  2RQT A;  1UHF A;  2FPD A;  2RQR A;  2YUP A;  1YNZ A;  5I11 A;  3IQL A;  2PNI A;  1ABQ A;  1OPK A;  1ZUU A;  1K76 A;  2LCS A;  2LQW A;  2C0T A;  4RTW A;  1NG2 A;  1H3H A;  1XOV A;  2HCK A;  2EKH A;  4JJD A;  1MV3 A;  3C0C A;  2LQN A;  2EYW A;  2CT3 A;  1QLY A;  4OMQ A;  2EGE A;  5IHI A;  1AWW A;  1Z9Q A;  3VS7 A;  2K7A A;  2JXB A;  2C0O A;  2DBM A;  2O2O A;  1WDX A;  4LNP A;  2BZX A;  1PHT A;  1BBZ A;  2VKN A;  3SHW A;  2CUD A;  1K0S A;  1UUE A;  1AZE A;  2ROL A;  4A63 B;  1X2Q A;  3VRZ A;  4JJB A;  2G6F X;  2HDA A;  2O9S A;  1SRM A;  2EQI A;  3I5R A;  2J6K A;  1MV0 B;  2DL3 A;  1I07 A;  2X3W D;  4JPB W;  1I0C A;  1NM7 A;  2VVK A;  2J6O A;  1E6G A;  3EG0 A;  1G83 A;  2LX7 A;  2EW3 A;  4X1V A;  1W6X A;  2L3P A;  2HBW A;  3THK A;  2KYM A;  1A0N B;  2L3Q A;  2DE0 X;  3REA B;  1BU1 A;  2OJ2 A;  4OMO A;  1X69 A;  4OML A;  1V1C A;  2CH4 W;  4J9B A;  1G2B A;  1RI9 A;  2K6D A;  2PZ1 A;  1X43 A;  4CC2 A;  1SRL A;  1TUC A;  1WXB A;  2HSP A;  2H8H A;  5FW9 A;  3NMZ C;  2B86 A;  2D0N A;  2LJ1 A;  2DL7 A;  1OPL A;  2ED0 A;  1SHF A;  1TUD A;  3PVQ A;  2LJ3 A;  2ENM A;  3H0F A;  2GNC A;  5IH2 A;  2GBQ A;  1B07 A;  3M0T A;  1UTI A;  3RNJ A;  4DEX A;  2ED1 A;  5L23 A;  1NLP C;  1X27 A;  2C0I A;  4OMN A;  2DF6 A;  2DVJ A;  2KT1 A;  3ULR B;  1NLO C;  3UA7 A;  4GLM A;  3ZL7 C;  5IHK A;  4HVW A;  2DL4 A;  4RTU A;  4F16 A;  2FO0 A;  1U06 A;  1GBQ A;  1K4U S;  1UJY A;  3TSZ A;  2KRS A;  3M0R A;  2RN8 A;  5FWC A;  2FG0 A;  5HCK A;  4IIM A;  3SEM A;  1J3T A;  3TSW A;  4ESR A;  2D1X A;  3VS3 A;  4HVV A;  1FYN A;  1ZUY A;  2OI3 A;  2KRO A;  2O31 A;  2FPE A;  3EG1 A;  1SSH A;  3O5Z A;  2JM8 A;  1I1J A;  1LCK A;  1ZX6 A;  1SEM A;  2YUQ A;  4M4Z A;  2GQI A;  1JXM A;  1OOT A;  4WCI A;  1GL5 A;  4JZ4 A;  1AVZ C;  4ZNX A;  2K79 A;  1M3A A;  1QWF A;  3I5S A;  1PRL C;  2DX1 A;  2W10 A;  5ECA A;  2RNA A;  1ZSG A;  3JV3 A;  1NYF A;  2M51 A;  1Y57 A;  1KIK A;  1YP5 A;  4D8K A;  2JMC A;  2EGC A;  2J06 A;  1SPK A;  3UA6 A;  1YCS B;  2JT4 A;  2JS2 A;  4HVU A;  4J9H A;  4LUE A;  1KFZ A;  4FSS A;  1E7O A;  1IO6 A;  1NEB A;  4QT7 A;  2ECZ A;  1K9A A;  2JW4 A;  5IHN A;  3VS0 A;  1PNJ A;  2KT8 A;  2KE9 A;  3I35 A;  4RTV A;  2DJQ A;  2X3X D;  3VS1 A;  3FJ5 A;  2KRN A;  1GCQ A;  1W1F A;  1CKB A;  2DRK A;  2EYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...