2JS2A

Solution structure of first sh3 domain of adaptor nck
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
63
structure length
63
Chain Sequence
GSMAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specificity determinants of a novel Nck interaction with the juxtamembrane domain of the epidermal growth factor receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Cytoplasmic protein NCK1
total genus 7
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2js2A00
4HVUA 4RTYA 3THKA 2YSQA 1I0CA 1ZSGA 2FRYA 2BTTA 4A63B 1UE9A 4WCIA 2DYBA 2KXCA 2MCNA 4OMPA 4JJCA 3H41A 4RTUA 2DE0X 3EG0A 5FWBA 3I9QA 1RUWA 1E6HA 2EPDA 2J7IA 4LE9A 1N5ZA 2K6DA 2AK5A 1MUZA 2RQVA 2HEQA 4LN2A 1PNJA 1AD5A 1U3OA 2JM8A 2L3QA 3I5RA 2CUDA 2J6OA 2J06A 2QDLA 1GBQA 1PHTA 3VS6A 2O31A 1JO8A 4J9GA 2B86A 2DF6A 4JJBA 2D8JA 4KRTA 4JZ3A 3NHNA 2C0IA 1YP5A 2IIMA 1YCSB 3VS4A 1NEBA 1I07A 1MV0B 2A28A 1BBZA 3RBBB 2EGEA 1WXUA 5ECAA 2K9GA 4J9EA 2ROTA 2VWFA 3PVLA 4F14A 4J9DA 2EYWA 3TSZA 1OPLA 3ULRB 4OMLA 1UFFA 2J6KA 1S1NA 2HCKA 1T0HA 3QWYA 2G6FX 2V1QA 5IXBA 1SHFA 2GNCA 1ABQA 2O9SA 1SRMA 4CC3A 1HSQA 3O5ZA 1BK2A 3EG3A 3EG2A 2RQTA 1M30A 2LP5A 4AFSC 1AWXA 3U23A 1AZGB 4D8DA 1NYGA 4E6RA 2X3WD 1RLPC 3JV3A 1GBRA 2EQIA 1AZEA 4AG1C 1UDLA 2H8HA 2JMAA 2JT4A 2FRWA 4JZ4A 1UECA 2CT3A 2PTKA 4RUGA 2SRCA 2W0ZA 2CSIA 2ECZA 5EC7A 1SRLA 3M0TA 2LQWA 1KIKA 1AWOA 4X1VA 1VYTA 5IHKA 1SHGA 2JXBA 3ZL7C 1GCPA 1A0NB 3TSWA 2JMCA 2FO0A 1VYVA 1JXMA 3EHQA 2PNIA 2K7AA 2BZ8A 2K79A 1PRLC 1U06A 2KBTA 3NPFA 4FSSA 2JTEA 1GCQA 1BB9A 3H0IA 1GFDA 2DL5A 1GL5A 1OEBA 2K2MA 2GGRA 1I1JA 2DRKA 2L0AA 2PZ1A 1WLPB 4IIMA 4Z88A 3EHRA 1GRIA 1PKSA 4AFQC 1X27A 2RF0A 1AVZC 2D1XA 2AZSA 2EYYA 3TVTA 4ORZA 3VRYA 3I5SA 1RI9A 2FPFA 2ED1A 4J9HA 1QWEA 2M51A 2KYMA 2JM9A 2LJ3A 3QWXX 1W1FA 4AFUC 3NGPA 1ZUKA 1UJYA 3KFVA 4QT7A 1K76A 1ZBJA 1G2BA 1B3QA 2A37A 2CH4A 2KROA 1X2KA 3UF4A 2DVJA 1SPKA 1PKTA 2ABLA 4J9CA 1E6GA 1T3LA 2JW4A 2JS0A 5IH2A 1TUCA 2CT4A 2ESWA 4D8KA 1K4US 2LZ6B 2D8HA 3GBQA 2DBKA 1WX6A 1XOVA 2BZXA 2O88A 1NLPC 2K3BA 5HCKA 2HBWA 2L3PA 3REBB 1W70A 1LCKA 3M0RA 3H0FA 1UUEA 1HD3A 1WDXA 4RTTA 2YUOA 2JS2A 2ENMA 2KRMA 5IXFA 3R6NA 3UA7A 3VS7A 2GTJA 1JEGA 1K0SA 2P4RA 1H8KA 2LJ1A 2LCSA 1GCQC 2A08A 2CDTA 4HVWA 1U5SA 3VS3A 2X3XD 1B07A 2J05A 4J9FA 2ROLA 4ESRA 3UATA 1SSHA 1WXBA 4IIOA 4DEYA 2LQNA 2VKNA 4CC7A 2RNAA 1FYNA 1EFNA 4RTWA 2EBPA 1SEMA 1CSKA 1TUDA 2V1RA 2KGTA 2C0TA 2W10A 4R0KA 1W6XA 2RN8A 4AG2C 1H92A 1Y57A 2F2VA 2F2XA 2VVKA 2GBQA 1QKXA 5IHNA 4ZNXA 3PVQA 1ZUUA 2OAWA 4CC2A 1UGVA 5L23A 1AWJA 2OI3A 3A98A 2EYXA 4HVVA 2EVRA 4OMMA 1NM7A 2DMOA 2DJQA 1K1ZA 2O9VA 1E7OA 2KRNA 2YT6A 3H0HA 3VRZA 4DEXA 1QLYA 2RQUA 4LUDA 4RTXA 2DL4A 2YUPA 1KSWA 4AFZC 2L2PA 1ZUYA 1WYXA 5I11A 2EGAA 1WXTA 2CUBA 3IQLA 2BZYA 2DX1A 4M4ZA 1Y0MA 4Z89A 1J3TA 1Z9ZA 1QKWA 1IO6A 1X69A 1M3BA 1KJWA 1MV3A 2RQWA 3VS5A 4J9BA 3EGUA 2DA9A 3I35A 3RNJA 2KYBA 2HSPA 2OJ2A 1FMKA 5GJWB 3EG1A 2RQRA 2M0YA 2J6FA 2KEAA 4Y92A 2KT8A 2LX7A 2DILA 2EKHA 1M3CA 4K11A 2D0NA 3UA6A 1VYUA 3FJ5A 2AZVA 1GFCA 1T3SA 2LJ0A 1WI7A 2EW3A 1G83A 2LNHB 5FW9A 1WIEA 1AWWA 1HJDA 2KXDA 2NUZA 1YWPA 2DBMA 4CC4B 1ZX6A 3SHWA 1UTIA 1M8MA 1ABOA 1UHCA 1WA7A 4J9IA 2FEIA 1UHFA 2DL7A 2E5KA 2C0OA 4F16A 1H3HA 4HCKA 2GTOA 2CSQA 2NWMA 4GBQA 3M0QA 2FPEA 3C0CA 1YWOA 4RTZA 2KNBB 1CKAA 1ZLMA 1X6GA 2FPDA 1V1CA 1NYFA 1T0JA 2AKKA 3REAB 2KE9A 4GLMA 2DRMA 1TG0A 1M3AA 1X6BA 1CKBA 1NLOC 3SEMA 1K9AA 2YUNA 2HDAA 1X43A 2EGCA 2SEMA 1YNZA 1NG2A 2XMFA 3LH5A 5GJVB 4EIKA 4JJDA 4HXJA 1YN8A 4F17A 4LNPA 2O2OA 5FWCA 1AOJA 3VS2A 4RTVA 1NEGA 2YUQA 3M0PA 1KFZA 1K0XA 2AKLA 2DNUA 1UG1A 1ARKA 3M0UA 1WFWA 2YDLA 2L3SA 2DL8A 1OPKA 4OMQA 2KRSA 1RLQC 4OMOA 2EYZA 1Z9QA 2CH4W 2KT1A 2A36A 1OV3A 3M0SA 4JPBW 2GQIA 3NMZC 3PE0A 4OMNA 2LMJA 1VA7A 5I22A 2I0NA 2CREA 2ED0A 1AEYA 1M27C 1JU5C 4Z8AA 3VS0A 1PRMC 1X2QA 3CQTA 1UJ0A 2FG0A 2MOXA 2RMOA 1JXOA 4LUEA 2DM1A 1QCFA 1PWTA 2F2WA 3VS1A 2DL3A 5IHIA 1BU1A 2RPNA 2DLPA 2KR3A 2MIOA 1JQQA 1OOTA 1QWFA
chains in the Genus database with same CATH superfamily
2RI2A 3DKMA 1ZSGA 2FRYA 9ATCB 1UE9A 4N0AA 3JCMe 3BFMA 2DYBA 2RHXA 4OB3B 3H41A 2IG0A 5FROA 3ASKA 1FXXA 1RUWA 4HT8A 5KCHA 1JJ2S 4M7AE 3A8MB 4LE9A 5KYNA 3OYHA 2HEQA 4LN2A 3UT1A 2CUDA 4N4IA 2J06A 3CC7A 4M7AG 5HK0A 3VS6A 2FZGB 2O31A 1JO8A 2B86A 1RAHB 4XTUA 1Q7YC 3NHNA 4M75G 2C0IA 1YP5A 2IIMA 1YCSB 2JJ9A 1HXDA 3OSSC 1MV0B 4FYVB 3JB9I 2X51A 2X4YA 2DK3A 1YIJQ 1LPLA 3URGA 4OGCA 3V8JA 1I5LA 1VQ8T 1H641 3DB4A 1D0YA 2YRDA 1S1NA 4BDZA 3QWYA 2XICA 3QZ9B 2P4TA 4C8QF 2F5TX 2GNCA 4FYXB 5FRNA 1ABQA 3RERA 1HSQA 3CCQQ 2FL7A 1YJNQ 2XDDA 1WQWA 4M77E 1RAIB 4J8OA 1GBRA 3E19A 5CKBA 4JZ4A 2PTKA 1Q86R 2ECZA 3EGXB 3M0TA 2K4YA 4XK8E 4J6XA 1VQ7T 4X1VA 2RO0A 1VYTA 5IHKA 3M4GA 5GAN7 5CAIA 3CEYA 3WXMB 1A0NB 1D1AA 1QCNA 1Q95G 2LRQA 4KH1B 2K79A 3RMSA 1U06A 2JTEA 1QVGS 1BB9A 3A8LB 4J83A 1XQHA 2DO3A 2DZ9A 2DIGA 2KVQG 4PJOB 4LDYA 1I1JA 1LOJA 1PKSA 5FU6B 5GAMe 1XNIA 1TSFA 2JTMA 1KHCA 5CCAA 3EG9A 4J9HA 3QBYA 2ZPBB 2HKQB 2F5KA 5EG2A 4DA4A 4QT7A 2LCCA 1K76A 3N5BB 4DOWA 2CP0A 3QO3A 1G2BA 2CH4A 4PJOE 2KROA 1X2KA 1TU0B 1KG1A 1SPKA 5GAN8 3RKWA 3NTHA 4J9CA 5KYWA 3R6OA 1WJSA 2JUFA 3CD6T 2JS0A 2YRVA 1QVFA 1TUCA 5LJ3d 4D8KA 1K4US 5I2MA 1M4ZA 3ZFJA 2DEUA 4Y91A 1XOVA 5GANf 1NLPC 3CCJA 4ANJA 3CCMQ 2CZ0B 3LH0A 5FU7C 3DLMA 3QZ5B 1I8FA 5CKFA 1WDXA 2FZKB 4MZMA 1YIJT 2JS2A 2M9UA 4KGZB 3JCMX 2QEXA 2FYKA 3MP6A 4MZPA 3VU3C 2H3JA 1NJIC 2RI5A 3VS7A 2IVWA 3LGLA 3M53A 1JEGA 1K0SA 1IGUA 4C92B 3V8KA 5LJ3h 2RI3A 4HVWA 1MNDA 1VQ7A 5DY9A 2JN0A 1BCOA 1B07A 3CCSA 2K3XA 2ROLA 4ESRA 2HBPA 3EH1A 3CMAT 2RJDA 4IIOA 4DEYA 1G3YA 2HMAA 5GAMj 4RTWA 4EMGA 3JAME 2VGNA 1TUDA 5GAMf 1KC8U 1K73R 3CXCA 1N8RU 2O4XA 3MEAA 4C92E 1H92A 3V7SA 2EQUA 2GBQA 1QQJA 4PLIA 1WHMA 1Q81C 3EH2A 4XU2A 1VQPQ 1QMCA 2LQ8A 3PVQA 2OAWA 1XTDA 1VQOA 1K8AC 2CZ6B 2OI3A 2GQVA 4HVVA 1U8RA 4EMKA 5GAMg 3A8HB 1C1AA 1X6OA 4QVZA 1K1ZA 2R5MA 4XAXB 2LC4A 2LQKA 2X9HA 3H0HA 3VRZA 3OYJA 4ELZC 1OULA 3M55A 2DL4A 2YUPA 4C8QA 2L3RA 1F1BB 5D7UA 1WXTA 3IQLA 1YFNA 2A0FB 2BZYA 2V8JA 2Y4XA 1M3BA 1KJWA 2RQWA 2YXYA 1M2VA 4J9BA 3VS5A 3L2WA 3EGDA 2XDPA 3CXCP 4E47A 2KYBA 3PTAA 1B7TA 1FMKA 2ZPIB 1WJRA 5GJWB 2EAYA 3MEVA 4BY6B 1Y07A 4PJOD 4M7DG 3JRZA 4B9XA 4HT9A 3BDLA 2KEAA 1VQ9A 1IREB 2M0OA 3BW1A 5HY6A 1Q82U 1WZOA 1M3CA 4EMHA 3FJ5A 2ZZDA 2RJCA 1T3SA 5GAMh 1BIAA 4A54A 3SWNA 1G83A 4PNOA 3CCLA 4M7DA 2LNHB 2QGGA 3A5ZB 5FW9A 1AWWA 2NUZA 3CPWS 4E7KA 4WF2A 1ZX6A 3PMTA 1FX7A 1ABOA 1UHCA 3NTIA 4IUPA 3CCUQ 2NUPB 1YHQT 5CKDA 3OYEA 5GAN5 2E5KA 4M78E 5KYYA 1BIBA 1BCMA 2CSQA 2NWMA 3M0QA 2FPEA 3MCAB 2RH2A 1LJOA 5LL6S 3HRSA 2PUOB 2MWOA 1VQ5Q 1VQLA 4A4HA 1VOMA 2FPDA 1MMAA 2E64A 2K5LA 3EGXA 1X6BA 1K9AA 3FEOA 5CVIA 4M75B 4M75F 3VJPA 3SDZA 4YTLA 4RCCA 4M78B 3L2UA 2SEMA 1X43A 5GAOr 3INZA 1NG2A 3LH5A 1R8OB 4GY5A 4N4GA 4RMOA 1M8VA 3G7ZA 3CCVQ 4M77A 4C92D 5C0MA 4E7IA 3CCRQ 4RTVA 4JJNK 2AKLA 1ARKA 3OYGA 2EFIA 3OYLA 8ATCB 4OMQA 2QA4A 2KSSA 4F04B 4OMOA 5KH6A 1Q86C 1C0MA 2CH4W 4J7IA 2KT1A 1YHQA 2EQKA 1OV3A 4JPBW 5GMKl 1VQKA 5I22A 4BE0A 1ZSZA 2I0NA 2LX9A 1AEYA 3VUBA 1Q7YU 2OTLQ 3E9FA 1M1GA 4XTXA 3HRTA 2E6NA 5GMKj 3L2RA 2FG0A 2DM1A 1QCFA 1K9MC 1PWTA 2E3HA 2V26A 1IB8A 2F2WA 1BU1A 4QVDA 1IRXA 4X34A 2C06A 4M7DB 1OOTA 1VQ4A 4RTYA 3CCJT 2YSQA 3TEEA 2YRCA 5AYFA 4C8QB 5C6SA 1VUBA 4WCIA 2MCNA 3CCVA 3CD6A 2DAQA 4JJCA 2DERA 4RTUA 3HTRA 3PT9A 1E6HA 2EPDA 2GCXA 1D3BB 1LVKA 1N5ZA 2RQVA 2JM8A 4DOVA 2QDLA 1GBQA 4M7DE 1C6VX 4J9GA 1UEBA 1UGSB 2E65A 3PNWC 4C8QE 5IT9E 2X4JA 1VQNQ 2DPPB 3VS4A 1I07A 2A28A 3OYKA 1NJIU 3MEWA 4M7AB 2QQRA 1WXUA 4PJLA 4M78D 4F14A 1MHNA 2RB6A 3PVLA 1D0ZA 2BIVA 2P0PA 2RJFA 2EJFA 1VQMA 3ULRB 1M1FA 1U1SA 2Z0WA 3CCET 2RK2A 3QYGB 2GFAA 3ME9A 1SHFA 1YIJA 4WTOB 3L42A 2O9SA 4CC3A 2QASA 3EG2A 2RQTA 1KD1U 4KH0B 2RJEA 4PLLA 2V8IA 3QG1A 4D8DA 1NYGA 2X3WD 4DBRA 1AZEA 4JRIA 2JMAA 2JT4A 2FRWA 2W0ZA 5EC7A 1SRLA 5CQXA 3J81E 1VQ9Q 4FYYB 1WPYA 4XQ3A 3ZL7C 8AT1B 4DQ2A 4C92F 3M58A 3TSWA 5A0GA 3CCRT 2FO0A 3EHQA 3RESA 4M77F 2RHYA 4M77B 2CZ1B 3NPFA 3X20B 5KYUB 1TWBA 1YCYA 1QVFP 3HRUA 1G3TA 1D3BA 3FIFA 4A4FA 4R55A 2GGRA 2PZ1A 1OZ3A 3JB9G 3OYIA 4IIMA 2CYZB 4Z88A 2VYTA 1X27A 3S3NA 1AT1B 2D1XA 3OBYA 2AZSA 1ZSZB 3G6ET 1QVPA 4ORZA 3M5AA 2FPFA 3MPUB 2ED1A 1O75A 1SF9A 3CC7Q 3SD4A 2KYMA 2LJ3A 3RR6A 1W1FA 2BKDN 4AFUC 3MEUA 3OS2A 1UJYA 1ZBJA 5CKEA 1D0XA 4AMCA 4EMKB 2VV5A 1M1KU 2A3LA 2E70A 2JVVA 2DVJA 1WHGA 3LX7A 1IZ6A 2K2VA 4TVRA 1RACB 2K57A 2DTIA 3I55A 2EQMA 3I56Q 3CCSQ 2NUPA 3PFSA 2ESWA 1PC0A 1VQPT 2YLBA 2DBKA 1WX6A 4M77D 4FW1A 4C92A 5LJ3j 2DIQA 2BZXA 5LJ5f 2GFUA 2K3BA 2EQJA 4J5YA 2OTJQ 3MP1A 4JLIA 3OYFA 4JRKA 3GF5A 1PD0A 4PJOC 2VXFA 2L3PA 2HL5C 4PJOF 3CPWA 1W70A 1YJNA 2YWWA 1BKBA 2RK1A 1S72T 5IXFA 2H3EB 2QGFB 5KYXA 3GOXA 3R6NA 1KHIA 2E4HA 3TQ7P 4PL6A 2GTJA 1VQOQ 2ZPGB 4DBFA 2P4RA 3OMCA 4M78A 2JOYA 5D6XA 2LNVA 2ZPFB 2A08A 3SWNC 1MMGA 2VASA 1U5SA 4C0GA 2X3XD 1VQ8A 2J05A 3QYHB 4GLKA 3UATA 3GNGA 2LQNA 2VKNA 2DXBA 4CC7A 2RNAA 1QVFS 2EBPA 1K8AU 2QK0A 5M9OA 3PMIA 1I5OB 1PD1A 2W10A 2XI9A 3M59A 4R0KA 1Q82R 2ATCB 4AG2C 4F7UG 5KYYB 2MWPA 1Y57A 2LCLA 4FCYA 2F2VA 2F2XA 1RAFB 1QKXA 5IHNA 3F70A 2LT1A 4KGXB 3Q1JA 4CC2A 1UGVA 1Q82C 1AWJA 3X25B 4E7JA 3A98A 1PSEA 3HHTB 2DZCA 1QVGA 4PJOA 3EGDB 4DEXA 3CCEQ 3CC4Q 1K9MU 4OF1A 1OX8A 2RQUA 4C92C 4AFZC 1K8AR 4FSXA 4F7UF 3UWNA 3CCLQ 4ZN1A 3WVDB 2F1LA 1X01A 2QAZA 1IHVA 2NUTB 1FWZA 5GMKi 4Z89A 2JZ2A 4E7LA 5GMKe 3EGUA 3AHUA 4LDUA 1K73C 1OZ2A 2O01E 5CK9A 2COWA 2OJ2A 3L2ZA 2F69A 5KYWB 1RL2A 3EG1A 4E7SA 3H9NA 4EMKC 4RCBA 3JCMV 2EYQA 2CS7A 1TUGB 1RABB 2E10A 4PKCC 3FLGA 2KT8A 4N0AC 1IHWA 2E41A 3HKSA 1YJWA 1EZZB 2EKHA 4K11A 1QP3A 4C5IA 2AZVA 2LJ0A 3S3MA 3CBMA 2EW3A 3RIRA 2KI7A 4ATOA 1D1CA 1WIEA 4B6MA 2KXDA 2MYSA 2DJZA 2HAXA 4IURA 1KQ2A 2VGMA 3QIIA 2I2LA 2GF7A 2MAMA 4F16A 4HCKA 1ZBXA 4BE2A 1YHQQ 1YWOA 1SG5A 2KNBB 1M1KR 4OB2B 3CC2Q 3RKXA 1X6GA 1NYFA 2AKKA 2KE9A 5GAMd 4GLMA 2EJ9A 1R0BG 3JB9H 5J39A 3MJXA 1VQKT 3LW5E 3NTKA 3SEMA 1WHKA 5GAN3 2QQ9A 1YNZA 4M7AD 2QEXT 4EIKA 1W2BP 4LNPA 1MNEA 3VS2A 4RG8A 4ZGEB 3X28B 4E7ZA 3A1PA 3M0UA 1Y96A 4CRIA 2XG8D 2YDLA 1OU9A 3I55Q 3I56A 1NPPA 2KAFA 4ZTFA 1RLQC 4M78G 1VQ7Q 4X9CA 3DB3A 3NMZC 2RHUA 4OMNA 2LMJA 2VC8A 1SSFA 2CKKA 2RA2A 2CREA 4M75E 4BI4A 3JCMQ 4FYWB 1M27C 4KT0E 4ZGDB 3OW2S 4Z8AA 5GANd 1PRMC 3FRNA 1X2QA 1M90R 3V8LA 1UJ0A 2D0QB 4C8QC 4LUEA 3EFSA 1ZHIA 2XK0A 2WSCE 1VQKQ 5FRMA 5IHIA 2X4XA 1D1BA 2RPNA 2DLPA 4RKUE 1VQPA 2MIOA 1JQQA 3CC2T 2P84A 2DFUA 1QWFA 1TTHB 1I0CA 1V29B 1VQ8Q 4A63B 2CP3A 2MMPA 4JDSA 1M5Q1 3L1AA 4OMPA 3GPLA 2DE0X 3EG0A 4BI8B 3L2VA 5FWBA 1NJIR 3I5RA 1AD5A 2RHZA 2J6OA 2LT4A 2PVOB 1N8RC 1PHTA 4J6WA 1BI0A 2FZCB 2DETA 4M78F 4C0FA 4KRTA 3CBOA 4JZ3A 1EIFA 4QQDA 1NBEB 4F7UA 3VYGA 3VKIA 5KE3A 4OMFB 1BBZA 1G8XA 3EAEA 2ZCFB 5GANe 2EGEA 2JNGA 4J9EA 2ROTA 2VWFA 4J9DA 2EYWA 2K5IA 1W4SA 2QDYB 3O8VA 4M7DC 4OMLA 1UFFA 2D6FA 2J6KA 1T0HA 4M7DF 1N8RR 1B34A 1JBMA 2V1QA 3KXTA 1YITA 1K9MR 3CCLT 3H8ZA 5CR2A 2R5AA 2KQWA 1WHHA 3EG3A 1RADB 5LJ5e 3M54A 2LP5A 4KGVB 4AFSC 1AWXA 2QQBA 2FHDA 2K5FA 1W2BA 4E6RA 5GAOp 3JV3A 3HPWA 2EQIA 3LGFA 1FMWA 3CCQT 1UECA 4RUGA 1EX4A 4M75D 5KYXB 1UGQB 4M77C 4MMKA 4M78C 1YJ9Q 1VQMT 1OQKA 2MPXC 2B8AA 1N27A 3OW2A 1KIKA 1AWOA 1UGPB 5IAYA 2EJGA 1SHGA 2JXBA 1YJWQ 5CKHA 3QJYA 1GCPA 2LTOA 3JB9J 4C5HA 1R77A 1JXMA 2KMTA 2K7AA 1ACMB 1PRLC 1ZSZC 4FSSA 2BE9B 4XTWA 3PIPA 5GAN6 1KQSA 2DL5A 1Y96B 1GL5A 1OEBA 4ZN3A 2K2MA 2QEXQ 3KUFA 3OS1A 1RAAB 4AFQC 1AVZC 3UDCA 3RDVA 3TVTA 2XU8A 1M2OA 2YLCA 4FU6A 4MDWA 3I5SA 3JCMP 1RI9A 4PK4A 1QWEA 2M51A 2HQEA 2JM9A 3QWXX 3NGPA 2NLUA 1ZUKA 4C0DC 1VQOT 3CCQA 2PQWA 3G71A 2WSFE 3LLRA 3UPUA 1B3QA 4XTVA 3UF4A 2CGHA 2ABLA 4LDVA 1NE8A 2KDSA 5DLQE 1T3LA 2JW4A 2FB7A 1RI0A 5IH2A 1N9SA 1NPRA 3QDRB 4R56A 2LZ6B 2JTFA 2HSEB 1RAGB 4L59A 3A8GB 3VUZA 2OAUA 5HCKA 1JRIA 2HBWA 2E12A 4M7AA 3M4YA 1OX9A 3MHXA 2NYSA 3SWNB 1LCKA 3M0RA 3KBGA 5LJ3g 3CBPA 1UUEA 4IUTA 4ZTJA 4KUDK 3TREA 1FMVA 2KRMA 5CO7A 1KK7A 3UA7A 3OYAA 1HYOA 1N9RA 5GMKm 4DBHA 4XU0A 3JCMf 3ZEHA 4F7UB 1Y71A 2QQSA 5J26A 1UGRB 3SFMA 2KY9A 5HK3A 1VQ6Q 4O5VA 3VS3A 4NOYA 5GAN2 4B9WA 4PJJA 4L6V5 3M57A 2P0KA 3EFRA 2XHCA 1EFNA 3OYNA 4M77G 1SEMA 1I4K1 2V1RA 1B34B 4HCZA 4BDYA 1WHLA 3LWHA 3J7AF 3FJPA 7AT1B 1IXDA 4F7UE 4CI0C 4BI3A 2VVKA 3MP8A 5FLXE 2VUBA 4OVAA 1MMDA 1ZUUA 2NUTA 2E3IA 2EYXA 2DMOA 3OW2P 2QG9B 4A4KA 2O9VA 1E7OA 2KRNA 2YT6A 1VIEA 3V7CA 4LUDA 1TH7A 5LJ3e 5LJ5j 3OYDA 1KC8R 4NL2A 1UB4A 2L2PA 4XU1A 3BE3A 2R57A 3JCMW 1WYXA 3G6EQ 2EGAA 2CUBA 2DX1A 4A4EA 1J3TA 5A2QE 1QKWA 1D09B 3OS0A 4QQGA 1Y7XA 2DA9A 3I35A 3RNJA 2OTJA 2QQAA 3E9GA 3OYBA 2COYA 2X35A 3P8DA 2RQRA 1M1KC 3QKJA 2DTOA 4O6JA 2M1HA 4MMLA 5LJ5d 2DILA 4PFOA 1S72Q 3JCMd 5GAOl 1KD1R 1Q7YR 1M2VB 2XD0A 1GFCA 4BY6C 5GANh 3JCMb 4HCCA 3OB9A 5DM7R 1BI3A 1YWPA 2DBMA 2XDBA 1PG5B 2RM4A 3SHWA 2OTLA 1WA7A 1WJQA 4QKUA 2FEIA 1XJWB 2V8KA 4C0DB 4C0ZA 1H3HA 3CMET 4GBQA 3C0CA 2DXTA 4M75C 4RTZA 3D7SB 1GXIE 3CD6Q 1YJNT 3QSUA 3TCJA 3QJ6A 1V1CA 1T0JA 5GANj 3CXCS 2DRMA 3CMAQ 5D6WA 1M3AA 1KQ1A 2AHJB 4LDWA 1NLOC 3G4ST 4OB1B 4EPCA 3PIOA 1OU8A 2EGCA 1S72A 4LDXA 4HXJA 1M90C 5D6YA 5A0LA 3DLLA 3ER0A 1NEGA 1KFZA 1K0XA 2DNUA 1UG1A 1G5VA 5GANg 1WFWA 2L3SA 2DL8A 1OPKA 1M9SA 3FDRA 2ZAEA 4C8QD 2A36A 4PJNA 2GQIA 1R0CB 3VV0A 4N4HA 3C4SA 2ED0A 5FU6C 3CCMT 2HQXA 1M90U 4IKFA 1VQ9T 3H6ZA 1VIFA 2MOXA 5KYUA 2RMOA 4JLGA 1MGQA 3OBWA 2KK4A 1QCOA 1TS9A 3G4SA 3JSCA 1ZA2B 2KR3A 2EIFA 4JUVA 4LD9K 1WQ7A 2MI6A 3JB9F 3BY7A 4HVUA 2WACA 3THKA 4QW2A 2PU9B 2WSEE 1PCXA 2BTTA 2OTLT 3JB9D 2KXCA 2DKGA 4QVCA 4C8QG 4A53A 3QXEB 4QQ6A 4D6WA 5J3BA 2DYIA 1VQLT 5I21A 3I9QA 4NS5A 2QA4T 2ZPHB 2J7IA 5KCOA 2K6DA 2AK5A 1MUZA 5CQYA 1PNJA 1U3OA 2L3QA 4JS5A 1VQNT 1H3ZA 4XTZA 4LD6A 3CC2A 4JRQA 2DF6A 4JJBA 2D8JA 3JCMh 4IUVA 3RUXA 3ZBDA 4FW2A 3META 1NEBA 3X24B 2CP2A 2QA4Q 3RBBB 1YI2A 4M7AF 5ECAA 1PSFA 2K9GA 3G4SQ 3LYIA 3TSZA 4AT1B 1OPLA 2DXUA 2HCKA 2G6FX 2L89A 2COZA 5IXBA 3OS5A 4FIBA 3CCMA 3OYMA 2PVGB 4VUBA 5I2SA 1VQ4Q 1SRMA 3O5ZA 4BD3A 1BK2A 2VXEA 4II1A 1SKUB 2G3RA 3P8HA 1HK9A 1M30A 2E5QA 3U23A 1AZGB 2CP7A 4RG2A 3CC4T 1RLPC 4AG1C 1UDLA 2H8HA 1O9SA 2CT3A 2QTVA 2SRCA 2CSIA 5GAOm 1BI1A 2LQWA 5DLOA 4EDUA 1MMNA 1WHJA 2O4XB 2P0QA 4DBQA 3G71Q 2AIRB 4PJOG 4M7DD 1N6AA 2IPOB 2CP5A 3S3OA 2JMCA 4KUIA 1VYVA 4PFZA 2PNIA 3TU4K 2BZ8A 2KBTA 2PUKB 2R58A 4X9DA 1GCQA 1VQ6T 3H0IA 1GFDA 3JCMc 4MDXA 4UC4A 2HL3A 2QTXA 2L0AA 2DRKA 2E1HA 1WLPB 3EHRA 1GRIA 2HQHA 1VQNA 1ZA1B 2HZYA 2RF0A 1VQMQ 2MF2A 2QYZA 4FT4A 2EYYA 3VRYA 4HKEA 1BI2A 2DD5A 2L5QA 3C95A 1VQ5T 3KFVA 5GMKh 2XIDA 2OX7A 3LWIA 3MKDA 4P5NA 5CIUA 2QI2A 2A37A 2DTHA 4A4GA 4Z02A 1PKTA 4KULA 3NFCA 1E6GA 2DEQA 1G3SA 2OTJT 2RHIA 5KE2A 3OQ5A 2CT4A 2D8HA 3GBQA 3CCEA 2O88A 3CCST 5GAN4 3V7RA 3GNFB 2EKOA 1YITQ 2HKNA 4C92G 1QW1A 3REBB 3EFOB 3H0FA 4PFPA 1HD3A 4RTTA 4BE1A 2YUOA 2ENMA 1I81A 1KQSP 1Q86U 4PJMA 3CCRA 4BB7A 1LNXA 2QXFA 1H8KA 2MK5A 2LJ1A 3E2UA 2LCSA 1GCQC 1DJ7B 2DVEA 1YJ9A 2CDTA 3RMQA 5FU7B 4JRPA 2YHTA 4J9FA 1SSHA 1WXBA 3CCUA 1YJWT 1TOVA 1FYNA 2D9TA 1NZ9A 2Y4YA 3CCJQ 3G6EA 1CSKA 3GP8A 2KGTA 4HCBA 1JJ2P 2C0TA 2HNIA 3OSVA 3P8BB 5HKCA 5GAOn 3OY9A 3HFOA 1W6XA 2RN8A 4M75A 4IUUA 3GLXA 3VYHB 3JCMg 1VQLQ 4FM4B 5L8RE 3EG9B 3M56A 3FB9A 4ZNXA 3CMEQ 3C12A 1RAEB 5A0DA 5L23A 5LJ3f 4Y28E 1VQ4T 1Q81U 2L8DA 4XTYA 2EVRA 4FL6A 1NM7A 4OMMA 2DJQA 4HA8A 4Q5WA 1G3WA 4NL3A 4J7FA 2LVMA 1V76A 3HSBA 1QLYA 4RTXA 1YI2Q 1KSWA 5GAOq 3I55T 2LDMA 1ZUYA 1AHJB 2DD4A 3AT1B 5I11A 2PVDB 4E2FB 3C94A 1Y0MA 4M4ZA 3CCVT 1Z9ZA 3X26B 1IO6A 3CPFA 1X69A 1MV3A 3PGGA 3QUIA 3E1SA 3HP9A 2HSPA 3QDFA 1U1TA 5AT1B 1ZQ1A 2M0YA 2J6FA 3OYCA 3OYYA 5LJ5g 3CMEA 1BYMA 4Y92A 4V2SA 1W2BS 4OP0A 3HL8A 3GIBA 2LX7A 6AT1B 1OI1A 3OA6A 4ZGJB 2D0NA 3UA6A 1VYUA 1IGQA 2M02A 1WGSA 2X4WA 1PM3A 4OB0B 1YJ9T 1YI2T 1WI7A 1JJ2A 3CCUT 3QHSA 4M7AC 2XKOC 3G71T 3JCMJ 3CPWP 1HJDA 2BE7D 4CC4B 3T9NA 3I56T 2A7YA 2E6ZA 1QP2A 1QVGP 1UTIA 1M8MA 2BUDA 3OMGA 4J9IA 2ZPEB 3M9QA 3CC4A 1UHFA 5IN1A 2DXCA 1KD1C 2DL7A 2C0OA 2GTOA 4FT2A 4KBMB 1CKAA 3SB2A 1ZLMA 4ME7A 3EFOA 4BUGA 3REAB 3S6WA 3MO8A 3RKYA 1TG0A 4C5EA 2ZGWA 1JB0E 1CKBA 3CC7T 2YUNA 5LJ5h 1YBYA 3L2QA 2HDAA 2XMFA 5GJVB 4JJDA 1YN8A 4F17A 3CMAA 4JS4A 2O2OA 5FWCA 1AOJA 2Y90A 3QPHA 3BDUA 1X75C 1KC8C 2YUQA 3M0PA 4J6YA 2AT1B 3J80E 2HD0A 3WVEB 2M16A 1K73U 2KRSA 4C5GA 2K3YA 1VQ6A 4MZTA 2EYZA 4IUQA 4ELYC 1Z9QA 3FC3A 4XU3A 3M0SA 4E7HA 3PE0A 1WNLA 1VA7A 1VQ5A 2VB6A 2FVUA 1JU5C 3VS0A 2RD1A 1YITT 1OYXA 4LXCA 1Q81R 3CQTA 1KQSS 3HFNA 1JXOA 2CP6A 3A8OB 4BACA 2EWNA 4OGEA 4L5GA 3VS1A 2DL3A 1P92A 2CZ7B 1TXQA 3G1JA
chains in the Genus database with same CATH topology
4HVUA 4RTYA 3THKA 2YSQA 1I0CA 1ZSGA 2FRYA 2BTTA 4A63B 1UE9A 4WCIA 2DYBA 2KXCA 2MCNA 4OMPA 4JJCA 3H41A 4RTUA 2DE0X 3EG0A 5FWBA 3I9QA 1RUWA 1E6HA 2EPDA 2J7IA 4LE9A 1N5ZA 2K6DA 2AK5A 1MUZA 2RQVA 2HEQA 4LN2A 1PNJA 1AD5A 1U3OA 2JM8A 2L3QA 3I5RA 2CUDA 2J6OA 2J06A 2QDLA 1GBQA 1PHTA 3VS6A 2O31A 1JO8A 4J9GA 2B86A 2DF6A 4JJBA 2D8JA 4KRTA 4JZ3A 3NHNA 2C0IA 1YP5A 2IIMA 1YCSB 3VS4A 1NEBA 1I07A 1MV0B 2A28A 1BBZA 3RBBB 2EGEA 1WXUA 5ECAA 2K9GA 4J9EA 2ROTA 2VWFA 3PVLA 4F14A 4J9DA 2EYWA 3TSZA 1OPLA 3ULRB 4OMLA 1UFFA 2J6KA 1S1NA 2HCKA 1T0HA 3QWYA 2G6FX 2V1QA 5IXBA 1SHFA 2GNCA 1ABQA 2O9SA 1SRMA 4CC3A 1HSQA 3O5ZA 1BK2A 3EG3A 3EG2A 2RQTA 1M30A 2LP5A 4AFSC 1AWXA 3U23A 1AZGB 4D8DA 1NYGA 4E6RA 2X3WD 1RLPC 3JV3A 1GBRA 2EQIA 1AZEA 4AG1C 1UDLA 2H8HA 2JMAA 2JT4A 2FRWA 4JZ4A 1UECA 2CT3A 2PTKA 4RUGA 2SRCA 2W0ZA 2CSIA 2ECZA 5EC7A 1SRLA 3M0TA 2LQWA 1KIKA 1AWOA 4X1VA 1VYTA 5IHKA 1SHGA 2JXBA 3ZL7C 1GCPA 1A0NB 3TSWA 2JMCA 2FO0A 1VYVA 1JXMA 3EHQA 2PNIA 2K7AA 2BZ8A 2K79A 1PRLC 1U06A 2KBTA 3NPFA 4FSSA 2JTEA 1GCQA 1BB9A 3H0IA 1GFDA 2DL5A 1GL5A 1OEBA 2K2MA 2GGRA 1I1JA 2DRKA 2L0AA 2PZ1A 1WLPB 4IIMA 4Z88A 3EHRA 1GRIA 1PKSA 4AFQC 1X27A 2RF0A 1AVZC 2D1XA 2AZSA 2EYYA 3TVTA 4ORZA 3VRYA 3I5SA 1RI9A 2FPFA 2ED1A 4J9HA 1QWEA 2M51A 2KYMA 2JM9A 2LJ3A 3QWXX 1W1FA 4AFUC 3NGPA 1ZUKA 1UJYA 3KFVA 4QT7A 1K76A 1ZBJA 1G2BA 1B3QA 2A37A 2CH4A 2KROA 1X2KA 3UF4A 2DVJA 1SPKA 1PKTA 2ABLA 4J9CA 1E6GA 1T3LA 2JW4A 2JS0A 5IH2A 1TUCA 2CT4A 2ESWA 4D8KA 1K4US 2LZ6B 2D8HA 3GBQA 2DBKA 1WX6A 1XOVA 2BZXA 2O88A 1NLPC 2K3BA 5HCKA 2HBWA 2L3PA 3REBB 1W70A 1LCKA 3M0RA 3H0FA 1UUEA 1HD3A 1WDXA 4RTTA 2YUOA 2JS2A 2ENMA 2KRMA 5IXFA 3R6NA 3UA7A 3VS7A 2GTJA 1JEGA 1K0SA 2P4RA 1H8KA 2LJ1A 2LCSA 1GCQC 2A08A 2CDTA 4HVWA 1U5SA 3VS3A 2X3XD 1B07A 2J05A 4J9FA 2ROLA 4ESRA 3UATA 1SSHA 1WXBA 4IIOA 4DEYA 2LQNA 2VKNA 4CC7A 2RNAA 1FYNA 1EFNA 4RTWA 2EBPA 1SEMA 1CSKA 1TUDA 2V1RA 2KGTA 2C0TA 2W10A 4R0KA 1W6XA 2RN8A 4AG2C 1H92A 1Y57A 2F2VA 2F2XA 2VVKA 2GBQA 1QKXA 5IHNA 4ZNXA 3PVQA 1ZUUA 2OAWA 4CC2A 1UGVA 5L23A 1AWJA 2OI3A 3A98A 2EYXA 4HVVA 2EVRA 4OMMA 1NM7A 2DMOA 2DJQA 1K1ZA 2O9VA 1E7OA 2KRNA 2YT6A 3H0HA 3VRZA 4DEXA 1QLYA 2RQUA 4LUDA 4RTXA 2DL4A 2YUPA 1KSWA 4AFZC 2L2PA 1ZUYA 1WYXA 5I11A 2EGAA 1WXTA 2CUBA 3IQLA 2BZYA 2DX1A 4M4ZA 1Y0MA 4Z89A 1J3TA 1Z9ZA 1QKWA 1IO6A 1X69A 1M3BA 1KJWA 1MV3A 2RQWA 3VS5A 4J9BA 3EGUA 2DA9A 3I35A 3RNJA 2KYBA 2HSPA 2OJ2A 1FMKA 5GJWB 3EG1A 2RQRA 2M0YA 2J6FA 2KEAA 4Y92A 2KT8A 2LX7A 2DILA 2EKHA 1M3CA 4K11A 2D0NA 3UA6A 1VYUA 3FJ5A 2AZVA 1GFCA 1T3SA 2LJ0A 1WI7A 2EW3A 1G83A 2LNHB 5FW9A 1WIEA 1AWWA 1HJDA 2KXDA 2NUZA 1YWPA 2DBMA 4CC4B 1ZX6A 3SHWA 1UTIA 1M8MA 1ABOA 1UHCA 1WA7A 4J9IA 2FEIA 1UHFA 2DL7A 2E5KA 2C0OA 4F16A 1H3HA 4HCKA 2GTOA 2CSQA 2NWMA 4GBQA 3M0QA 2FPEA 3C0CA 1YWOA 4RTZA 2KNBB 1CKAA 1ZLMA 1X6GA 2FPDA 1V1CA 1NYFA 1T0JA 2AKKA 3REAB 2KE9A 4GLMA 2DRMA 1TG0A 1M3AA 1X6BA 1CKBA 1NLOC 3SEMA 1K9AA 2YUNA 2HDAA 1X43A 2EGCA 2SEMA 1YNZA 1NG2A 2XMFA 3LH5A 5GJVB 4EIKA 4JJDA 4HXJA 1YN8A 4F17A 4LNPA 2O2OA 5FWCA 1AOJA 3VS2A 4RTVA 1NEGA 2YUQA 3M0PA 1KFZA 1K0XA 2AKLA 2DNUA 1UG1A 1ARKA 3M0UA 1WFWA 2YDLA 2L3SA 2DL8A 1OPKA 4OMQA 2KRSA 1RLQC 4OMOA 2EYZA 1Z9QA 2CH4W 2KT1A 2A36A 1OV3A 3M0SA 4JPBW 2GQIA 3NMZC 3PE0A 4OMNA 2LMJA 1VA7A 5I22A 2I0NA 2CREA 2ED0A 1AEYA 1M27C 1JU5C 4Z8AA 3VS0A 1PRMC 1X2QA 3CQTA 1UJ0A 2FG0A 2MOXA 2RMOA 1JXOA 4LUEA 2DM1A 1QCFA 1PWTA 2F2WA 3VS1A 2DL3A 5IHIA 1BU1A 2RPNA 2DLPA 2KR3A 2MIOA 1JQQA 1OOTA 1QWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HVU A;  4RTY A;  3THK A;  2YSQ A;  1I0C A;  1ZSG A;  2FRY A;  2BTT A;  4A63 B;  1UE9 A;  4WCI A;  2DYB A;  2KXC A;  2MCN A;  4OMP A;  4JJC A;  3H41 A;  4RTU A;  2DE0 X;  3EG0 A;  5FWB A;  3I9Q A;  1RUW A;  1E6H A;  2EPD A;  2J7I A;  4LE9 A;  1N5Z A;  2K6D A;  2AK5 A;  1MUZ A;  2RQV A;  2HEQ A;  4LN2 A;  1PNJ A;  1AD5 A;  1U3O A;  2JM8 A;  2L3Q A;  3I5R A;  2CUD A;  2J6O A;  2J06 A;  2QDL A;  1GBQ A;  1PHT A;  3VS6 A;  2O31 A;  1JO8 A;  4J9G A;  2B86 A;  2DF6 A;  4JJB A;  2D8J A;  4KRT A;  4JZ3 A;  3NHN A;  2C0I A;  1YP5 A;  2IIM A;  1YCS B;  3VS4 A;  1NEB A;  1I07 A;  1MV0 B;  2A28 A;  1BBZ A;  3RBB B;  2EGE A;  1WXU A;  5ECA A;  2K9G A;  4J9E A;  2ROT A;  2VWF A;  3PVL A;  4F14 A;  4J9D A;  2EYW A;  3TSZ A;  1OPL A;  3ULR B;  4OML A;  1UFF A;  2J6K A;  1S1N A;  2HCK A;  1T0H A;  3QWY A;  2G6F X;  2V1Q A;  5IXB A;  1SHF A;  2GNC A;  1ABQ A;  2O9S A;  1SRM A;  4CC3 A;  1HSQ A;  3O5Z A;  1BK2 A;  3EG3 A;  3EG2 A;  2RQT A;  1M30 A;  2LP5 A;  4AFS C;  1AWX A;  3U23 A;  1AZG B;  4D8D A;  1NYG A;  4E6R A;  2X3W D;  1RLP C;  3JV3 A;  1GBR A;  2EQI A;  1AZE A;  4AG1 C;  1UDL A;  2H8H A;  2JMA A;  2JT4 A;  2FRW A;  4JZ4 A;  1UEC A;  2CT3 A;  2PTK A;  4RUG A;  2SRC A;  2W0Z A;  2CSI A;  2ECZ A;  5EC7 A;  1SRL A;  3M0T A;  2LQW A;  1KIK A;  1AWO A;  4X1V A;  1VYT A;  5IHK A;  1SHG A;  2JXB A;  3ZL7 C;  1GCP A;  1A0N B;  3TSW A;  2JMC A;  2FO0 A;  1VYV A;  1JXM A;  3EHQ A;  2PNI A;  2K7A A;  2BZ8 A;  2K79 A;  1PRL C;  1U06 A;  2KBT A;  3NPF A;  4FSS A;  2JTE A;  1GCQ A;  1BB9 A;  3H0I A;  1GFD A;  2DL5 A;  1GL5 A;  1OEB A;  2K2M A;  2GGR A;  1I1J A;  2DRK A;  2L0A A;  2PZ1 A;  1WLP B;  4IIM A;  4Z88 A;  3EHR A;  1GRI A;  1PKS A;  4AFQ C;  1X27 A;  2RF0 A;  1AVZ C;  2D1X A;  2AZS A;  2EYY A;  3TVT A;  4ORZ A;  3VRY A;  3I5S A;  1RI9 A;  2FPF A;  2ED1 A;  4J9H A;  1QWE A;  2M51 A;  2KYM A;  2JM9 A;  2LJ3 A;  3QWX X;  1W1F A;  4AFU C;  3NGP A;  1ZUK A;  1UJY A;  3KFV A;  4QT7 A;  1K76 A;  1ZBJ A;  1G2B A;  1B3Q A;  2A37 A;  2CH4 A;  2KRO A;  1X2K A;  3UF4 A;  2DVJ A;  1SPK A;  1PKT A;  2ABL A;  4J9C A;  1E6G A;  1T3L A;  2JW4 A;  2JS0 A;  5IH2 A;  1TUC A;  2CT4 A;  2ESW A;  4D8K A;  1K4U S;  2LZ6 B;  2D8H A;  3GBQ A;  2DBK A;  1WX6 A;  1XOV A;  2BZX A;  2O88 A;  1NLP C;  2K3B A;  5HCK A;  2HBW A;  2L3P A;  3REB B;  1W70 A;  1LCK A;  3M0R A;  3H0F A;  1UUE A;  1HD3 A;  1WDX A;  4RTT A;  2YUO A;  2JS2 A;  2ENM A;  2KRM A;  5IXF A;  3R6N A;  3UA7 A;  3VS7 A;  2GTJ A;  1JEG A;  1K0S A;  2P4R A;  1H8K A;  2LJ1 A;  2LCS A;  1GCQ C;  2A08 A;  2CDT A;  4HVW A;  1U5S A;  3VS3 A;  2X3X D;  1B07 A;  2J05 A;  4J9F A;  2ROL A;  4ESR A;  3UAT A;  1SSH A;  1WXB A;  4IIO A;  4DEY A;  2LQN A;  2VKN A;  4CC7 A;  2RNA A;  1FYN A;  1EFN A;  4RTW A;  2EBP A;  1SEM A;  1CSK A;  1TUD A;  2V1R A;  2KGT A;  2C0T A;  2W10 A;  4R0K A;  1W6X A;  2RN8 A;  4AG2 C;  1H92 A;  1Y57 A;  2F2V A;  2F2X A;  2VVK A;  2GBQ A;  1QKX A;  5IHN A;  4ZNX A;  3PVQ A;  1ZUU A;  2OAW A;  4CC2 A;  1UGV A;  5L23 A;  1AWJ A;  2OI3 A;  3A98 A;  2EYX A;  4HVV A;  2EVR A;  4OMM A;  1NM7 A;  2DMO A;  2DJQ A;  1K1Z A;  2O9V A;  1E7O A;  2KRN A;  2YT6 A;  3H0H A;  3VRZ A;  4DEX A;  1QLY A;  2RQU A;  4LUD A;  4RTX A;  2DL4 A;  2YUP A;  1KSW A;  4AFZ C;  2L2P A;  1ZUY A;  1WYX A;  5I11 A;  2EGA A;  1WXT A;  2CUB A;  3IQL A;  2BZY A;  2DX1 A;  4M4Z A;  1Y0M A;  4Z89 A;  1J3T A;  1Z9Z A;  1QKW A;  1IO6 A;  1X69 A;  1M3B A;  1KJW A;  1MV3 A;  2RQW A;  3VS5 A;  4J9B A;  3EGU A;  2DA9 A;  3I35 A;  3RNJ A;  2KYB A;  2HSP A;  2OJ2 A;  1FMK A;  5GJW B;  3EG1 A;  2RQR A;  2M0Y A;  2J6F A;  2KEA A;  4Y92 A;  2KT8 A;  2LX7 A;  2DIL A;  2EKH A;  1M3C A;  4K11 A;  2D0N A;  3UA6 A;  1VYU A;  3FJ5 A;  2AZV A;  1GFC A;  1T3S A;  2LJ0 A;  1WI7 A;  2EW3 A;  1G83 A;  2LNH B;  5FW9 A;  1WIE A;  1AWW A;  1HJD A;  2KXD A;  2NUZ A;  1YWP A;  2DBM A;  4CC4 B;  1ZX6 A;  3SHW A;  1UTI A;  1M8M A;  1ABO A;  1UHC A;  1WA7 A;  4J9I A;  2FEI A;  1UHF A;  2DL7 A;  2E5K A;  2C0O A;  4F16 A;  1H3H A;  4HCK A;  2GTO A;  2CSQ A;  2NWM A;  4GBQ A;  3M0Q A;  2FPE A;  3C0C A;  1YWO A;  4RTZ A;  2KNB B;  1CKA A;  1ZLM A;  1X6G A;  2FPD A;  1V1C A;  1NYF A;  1T0J A;  2AKK A;  3REA B;  2KE9 A;  4GLM A;  2DRM A;  1TG0 A;  1M3A A;  1X6B A;  1CKB A;  1NLO C;  3SEM A;  1K9A A;  2YUN A;  2HDA A;  1X43 A;  2EGC A;  2SEM A;  1YNZ A;  1NG2 A;  2XMF A;  3LH5 A;  5GJV B;  4EIK A;  4JJD A;  4HXJ A;  1YN8 A;  4F17 A;  4LNP A;  2O2O A;  5FWC A;  1AOJ A;  3VS2 A;  4RTV A;  1NEG A;  2YUQ A;  3M0P A;  1KFZ A;  1K0X A;  2AKL A;  2DNU A;  1UG1 A;  1ARK A;  3M0U A;  1WFW A;  2YDL A;  2L3S A;  2DL8 A;  1OPK A;  4OMQ A;  2KRS A;  1RLQ C;  4OMO A;  2EYZ A;  1Z9Q A;  2CH4 W;  2KT1 A;  2A36 A;  1OV3 A;  3M0S A;  4JPB W;  2GQI A;  3NMZ C;  3PE0 A;  4OMN A;  2LMJ A;  1VA7 A;  5I22 A;  2I0N A;  2CRE A;  2ED0 A;  1AEY A;  1M27 C;  1JU5 C;  4Z8A A;  3VS0 A;  1PRM C;  1X2Q A;  3CQT A;  1UJ0 A;  2FG0 A;  2MOX A;  2RMO A;  1JXO A;  4LUE A;  2DM1 A;  1QCF A;  1PWT A;  2F2W A;  3VS1 A;  2DL3 A;  5IHI A;  1BU1 A;  2RPN A;  2DLP A;  2KR3 A;  2MIO A;  1JQQ A;  1OOT A;  1QWF A; 
#chains in the Genus database with same CATH topology
 2RI2 A;  3DKM A;  1ZSG A;  2FRY A;  9ATC B;  1UE9 A;  4N0A A;  3JCM e;  3BFM A;  2DYB A;  2RHX A;  4OB3 B;  3H41 A;  2IG0 A;  5FRO A;  3ASK A;  1FXX A;  1RUW A;  4HT8 A;  5KCH A;  1JJ2 S;  4M7A E;  3A8M B;  4LE9 A;  5KYN A;  3OYH A;  2HEQ A;  4LN2 A;  3UT1 A;  2CUD A;  4N4I A;  2J06 A;  3CC7 A;  4M7A G;  5HK0 A;  3VS6 A;  2FZG B;  2O31 A;  1JO8 A;  2B86 A;  1RAH B;  4XTU A;  1Q7Y C;  3NHN A;  4M75 G;  2C0I A;  1YP5 A;  2IIM A;  1YCS B;  2JJ9 A;  1HXD A;  3OSS C;  1MV0 B;  4FYV B;  3JB9 I;  2X51 A;  2X4Y A;  2DK3 A;  1YIJ Q;  1LPL A;  3URG A;  4OGC A;  3V8J A;  1I5L A;  1VQ8 T;  1H64 1;  3DB4 A;  1D0Y A;  2YRD A;  1S1N A;  4BDZ A;  3QWY A;  2XIC A;  3QZ9 B;  2P4T A;  4C8Q F;  2F5T X;  2GNC A;  4FYX B;  5FRN A;  1ABQ A;  3RER A;  1HSQ A;  3CCQ Q;  2FL7 A;  1YJN Q;  2XDD A;  1WQW A;  4M77 E;  1RAI B;  4J8O A;  1GBR A;  3E19 A;  5CKB A;  4JZ4 A;  2PTK A;  1Q86 R;  2ECZ A;  3EGX B;  3M0T A;  2K4Y A;  4XK8 E;  4J6X A;  1VQ7 T;  4X1V A;  2RO0 A;  1VYT A;  5IHK A;  3M4G A;  5GAN 7;  5CAI A;  3CEY A;  3WXM B;  1A0N B;  1D1A A;  1QCN A;  1Q95 G;  2LRQ A;  4KH1 B;  2K79 A;  3RMS A;  1U06 A;  2JTE A;  1QVG S;  1BB9 A;  3A8L B;  4J83 A;  1XQH A;  2DO3 A;  2DZ9 A;  2DIG A;  2KVQ G;  4PJO B;  4LDY A;  1I1J A;  1LOJ A;  1PKS A;  5FU6 B;  5GAM e;  1XNI A;  1TSF A;  2JTM A;  1KHC A;  5CCA A;  3EG9 A;  4J9H A;  3QBY A;  2ZPB B;  2HKQ B;  2F5K A;  5EG2 A;  4DA4 A;  4QT7 A;  2LCC A;  1K76 A;  3N5B B;  4DOW A;  2CP0 A;  3QO3 A;  1G2B A;  2CH4 A;  4PJO E;  2KRO A;  1X2K A;  1TU0 B;  1KG1 A;  1SPK A;  5GAN 8;  3RKW A;  3NTH A;  4J9C A;  5KYW A;  3R6O A;  1WJS A;  2JUF A;  3CD6 T;  2JS0 A;  2YRV A;  1QVF A;  1TUC A;  5LJ3 d;  4D8K A;  1K4U S;  5I2M A;  1M4Z A;  3ZFJ A;  2DEU A;  4Y91 A;  1XOV A;  5GAN f;  1NLP C;  3CCJ A;  4ANJ A;  3CCM Q;  2CZ0 B;  3LH0 A;  5FU7 C;  3DLM A;  3QZ5 B;  1I8F A;  5CKF A;  1WDX A;  2FZK B;  4MZM A;  1YIJ T;  2JS2 A;  2M9U A;  4KGZ B;  3JCM X;  2QEX A;  2FYK A;  3MP6 A;  4MZP A;  3VU3 C;  2H3J A;  1NJI C;  2RI5 A;  3VS7 A;  2IVW A;  3LGL A;  3M53 A;  1JEG A;  1K0S A;  1IGU A;  4C92 B;  3V8K A;  5LJ3 h;  2RI3 A;  4HVW A;  1MND A;  1VQ7 A;  5DY9 A;  2JN0 A;  1BCO A;  1B07 A;  3CCS A;  2K3X A;  2ROL A;  4ESR A;  2HBP A;  3EH1 A;  3CMA T;  2RJD A;  4IIO A;  4DEY A;  1G3Y A;  2HMA A;  5GAM j;  4RTW A;  4EMG A;  3JAM E;  2VGN A;  1TUD A;  5GAM f;  1KC8 U;  1K73 R;  3CXC A;  1N8R U;  2O4X A;  3MEA A;  4C92 E;  1H92 A;  3V7S A;  2EQU A;  2GBQ A;  1QQJ A;  4PLI A;  1WHM A;  1Q81 C;  3EH2 A;  4XU2 A;  1VQP Q;  1QMC A;  2LQ8 A;  3PVQ A;  2OAW A;  1XTD A;  1VQO A;  1K8A C;  2CZ6 B;  2OI3 A;  2GQV A;  4HVV A;  1U8R A;  4EMK A;  5GAM g;  3A8H B;  1C1A A;  1X6O A;  4QVZ A;  1K1Z A;  2R5M A;  4XAX B;  2LC4 A;  2LQK A;  2X9H A;  3H0H A;  3VRZ A;  3OYJ A;  4ELZ C;  1OUL A;  3M55 A;  2DL4 A;  2YUP A;  4C8Q A;  2L3R A;  1F1B B;  5D7U A;  1WXT A;  3IQL A;  1YFN A;  2A0F B;  2BZY A;  2V8J A;  2Y4X A;  1M3B A;  1KJW A;  2RQW A;  2YXY A;  1M2V A;  4J9B A;  3VS5 A;  3L2W A;  3EGD A;  2XDP A;  3CXC P;  4E47 A;  2KYB A;  3PTA A;  1B7T A;  1FMK A;  2ZPI B;  1WJR A;  5GJW B;  2EAY A;  3MEV A;  4BY6 B;  1Y07 A;  4PJO D;  4M7D G;  3JRZ A;  4B9X A;  4HT9 A;  3BDL A;  2KEA A;  1VQ9 A;  1IRE B;  2M0O A;  3BW1 A;  5HY6 A;  1Q82 U;  1WZO A;  1M3C A;  4EMH A;  3FJ5 A;  2ZZD A;  2RJC A;  1T3S A;  5GAM h;  1BIA A;  4A54 A;  3SWN A;  1G83 A;  4PNO A;  3CCL A;  4M7D A;  2LNH B;  2QGG A;  3A5Z B;  5FW9 A;  1AWW A;  2NUZ A;  3CPW S;  4E7K A;  4WF2 A;  1ZX6 A;  3PMT A;  1FX7 A;  1ABO A;  1UHC A;  3NTI A;  4IUP A;  3CCU Q;  2NUP B;  1YHQ T;  5CKD A;  3OYE A;  5GAN 5;  2E5K A;  4M78 E;  5KYY A;  1BIB A;  1BCM A;  2CSQ A;  2NWM A;  3M0Q A;  2FPE A;  3MCA B;  2RH2 A;  1LJO A;  5LL6 S;  3HRS A;  2PUO B;  2MWO A;  1VQ5 Q;  1VQL A;  4A4H A;  1VOM A;  2FPD A;  1MMA A;  2E64 A;  2K5L A;  3EGX A;  1X6B A;  1K9A A;  3FEO A;  5CVI A;  4M75 B;  4M75 F;  3VJP A;  3SDZ A;  4YTL A;  4RCC A;  4M78 B;  3L2U A;  2SEM A;  1X43 A;  5GAO r;  3INZ A;  1NG2 A;  3LH5 A;  1R8O B;  4GY5 A;  4N4G A;  4RMO A;  1M8V A;  3G7Z A;  3CCV Q;  4M77 A;  4C92 D;  5C0M A;  4E7I A;  3CCR Q;  4RTV A;  4JJN K;  2AKL A;  1ARK A;  3OYG A;  2EFI A;  3OYL A;  8ATC B;  4OMQ A;  2QA4 A;  2KSS A;  4F04 B;  4OMO A;  5KH6 A;  1Q86 C;  1C0M A;  2CH4 W;  4J7I A;  2KT1 A;  1YHQ A;  2EQK A;  1OV3 A;  4JPB W;  5GMK l;  1VQK A;  5I22 A;  4BE0 A;  1ZSZ A;  2I0N A;  2LX9 A;  1AEY A;  3VUB A;  1Q7Y U;  2OTL Q;  3E9F A;  1M1G A;  4XTX A;  3HRT A;  2E6N A;  5GMK j;  3L2R A;  2FG0 A;  2DM1 A;  1QCF A;  1K9M C;  1PWT A;  2E3H A;  2V26 A;  1IB8 A;  2F2W A;  1BU1 A;  4QVD A;  1IRX A;  4X34 A;  2C06 A;  4M7D B;  1OOT A;  1VQ4 A;  4RTY A;  3CCJ T;  2YSQ A;  3TEE A;  2YRC A;  5AYF A;  4C8Q B;  5C6S A;  1VUB A;  4WCI A;  2MCN A;  3CCV A;  3CD6 A;  2DAQ A;  4JJC A;  2DER A;  4RTU A;  3HTR A;  3PT9 A;  1E6H A;  2EPD A;  2GCX A;  1D3B B;  1LVK A;  1N5Z A;  2RQV A;  2JM8 A;  4DOV A;  2QDL A;  1GBQ A;  4M7D E;  1C6V X;  4J9G A;  1UEB A;  1UGS B;  2E65 A;  3PNW C;  4C8Q E;  5IT9 E;  2X4J A;  1VQN Q;  2DPP B;  3VS4 A;  1I07 A;  2A28 A;  3OYK A;  1NJI U;  3MEW A;  4M7A B;  2QQR A;  1WXU A;  4PJL A;  4M78 D;  4F14 A;  1MHN A;  2RB6 A;  3PVL A;  1D0Z A;  2BIV A;  2P0P A;  2RJF A;  2EJF A;  1VQM A;  3ULR B;  1M1F A;  1U1S A;  2Z0W A;  3CCE T;  2RK2 A;  3QYG B;  2GFA A;  3ME9 A;  1SHF A;  1YIJ A;  4WTO B;  3L42 A;  2O9S A;  4CC3 A;  2QAS A;  3EG2 A;  2RQT A;  1KD1 U;  4KH0 B;  2RJE A;  4PLL A;  2V8I A;  3QG1 A;  4D8D A;  1NYG A;  2X3W D;  4DBR A;  1AZE A;  4JRI A;  2JMA A;  2JT4 A;  2FRW A;  2W0Z A;  5EC7 A;  1SRL A;  5CQX A;  3J81 E;  1VQ9 Q;  4FYY B;  1WPY A;  4XQ3 A;  3ZL7 C;  8AT1 B;  4DQ2 A;  4C92 F;  3M58 A;  3TSW A;  5A0G A;  3CCR T;  2FO0 A;  3EHQ A;  3RES A;  4M77 F;  2RHY A;  4M77 B;  2CZ1 B;  3NPF A;  3X20 B;  5KYU B;  1TWB A;  1YCY A;  1QVF P;  3HRU A;  1G3T A;  1D3B A;  3FIF A;  4A4F A;  4R55 A;  2GGR A;  2PZ1 A;  1OZ3 A;  3JB9 G;  3OYI A;  4IIM A;  2CYZ B;  4Z88 A;  2VYT A;  1X27 A;  3S3N A;  1AT1 B;  2D1X A;  3OBY A;  2AZS A;  1ZSZ B;  3G6E T;  1QVP A;  4ORZ A;  3M5A A;  2FPF A;  3MPU B;  2ED1 A;  1O75 A;  1SF9 A;  3CC7 Q;  3SD4 A;  2KYM A;  2LJ3 A;  3RR6 A;  1W1F A;  2BKD N;  4AFU C;  3MEU A;  3OS2 A;  1UJY A;  1ZBJ A;  5CKE A;  1D0X A;  4AMC A;  4EMK B;  2VV5 A;  1M1K U;  2A3L A;  2E70 A;  2JVV A;  2DVJ A;  1WHG A;  3LX7 A;  1IZ6 A;  2K2V A;  4TVR A;  1RAC B;  2K57 A;  2DTI A;  3I55 A;  2EQM A;  3I56 Q;  3CCS Q;  2NUP A;  3PFS A;  2ESW A;  1PC0 A;  1VQP T;  2YLB A;  2DBK A;  1WX6 A;  4M77 D;  4FW1 A;  4C92 A;  5LJ3 j;  2DIQ A;  2BZX A;  5LJ5 f;  2GFU A;  2K3B A;  2EQJ A;  4J5Y A;  2OTJ Q;  3MP1 A;  4JLI A;  3OYF A;  4JRK A;  3GF5 A;  1PD0 A;  4PJO C;  2VXF A;  2L3P A;  2HL5 C;  4PJO F;  3CPW A;  1W70 A;  1YJN A;  2YWW A;  1BKB A;  2RK1 A;  1S72 T;  5IXF A;  2H3E B;  2QGF B;  5KYX A;  3GOX A;  3R6N A;  1KHI A;  2E4H A;  3TQ7 P;  4PL6 A;  2GTJ A;  1VQO Q;  2ZPG B;  4DBF A;  2P4R A;  3OMC A;  4M78 A;  2JOY A;  5D6X A;  2LNV A;  2ZPF B;  2A08 A;  3SWN C;  1MMG A;  2VAS A;  1U5S A;  4C0G A;  2X3X D;  1VQ8 A;  2J05 A;  3QYH B;  4GLK A;  3UAT A;  3GNG A;  2LQN A;  2VKN A;  2DXB A;  4CC7 A;  2RNA A;  1QVF S;  2EBP A;  1K8A U;  2QK0 A;  5M9O A;  3PMI A;  1I5O B;  1PD1 A;  2W10 A;  2XI9 A;  3M59 A;  4R0K A;  1Q82 R;  2ATC B;  4AG2 C;  4F7U G;  5KYY B;  2MWP A;  1Y57 A;  2LCL A;  4FCY A;  2F2V A;  2F2X A;  1RAF B;  1QKX A;  5IHN A;  3F70 A;  2LT1 A;  4KGX B;  3Q1J A;  4CC2 A;  1UGV A;  1Q82 C;  1AWJ A;  3X25 B;  4E7J A;  3A98 A;  1PSE A;  3HHT B;  2DZC A;  1QVG A;  4PJO A;  3EGD B;  4DEX A;  3CCE Q;  3CC4 Q;  1K9M U;  4OF1 A;  1OX8 A;  2RQU A;  4C92 C;  4AFZ C;  1K8A R;  4FSX A;  4F7U F;  3UWN A;  3CCL Q;  4ZN1 A;  3WVD B;  2F1L A;  1X01 A;  2QAZ A;  1IHV A;  2NUT B;  1FWZ A;  5GMK i;  4Z89 A;  2JZ2 A;  4E7L A;  5GMK e;  3EGU A;  3AHU A;  4LDU A;  1K73 C;  1OZ2 A;  2O01 E;  5CK9 A;  2COW A;  2OJ2 A;  3L2Z A;  2F69 A;  5KYW B;  1RL2 A;  3EG1 A;  4E7S A;  3H9N A;  4EMK C;  4RCB A;  3JCM V;  2EYQ A;  2CS7 A;  1TUG B;  1RAB B;  2E10 A;  4PKC C;  3FLG A;  2KT8 A;  4N0A C;  1IHW A;  2E41 A;  3HKS A;  1YJW A;  1EZZ B;  2EKH A;  4K11 A;  1QP3 A;  4C5I A;  2AZV A;  2LJ0 A;  3S3M A;  3CBM A;  2EW3 A;  3RIR A;  2KI7 A;  4ATO A;  1D1C A;  1WIE A;  4B6M A;  2KXD A;  2MYS A;  2DJZ A;  2HAX A;  4IUR A;  1KQ2 A;  2VGM A;  3QII A;  2I2L A;  2GF7 A;  2MAM A;  4F16 A;  4HCK A;  1ZBX A;  4BE2 A;  1YHQ Q;  1YWO A;  1SG5 A;  2KNB B;  1M1K R;  4OB2 B;  3CC2 Q;  3RKX A;  1X6G A;  1NYF A;  2AKK A;  2KE9 A;  5GAM d;  4GLM A;  2EJ9 A;  1R0B G;  3JB9 H;  5J39 A;  3MJX A;  1VQK T;  3LW5 E;  3NTK A;  3SEM A;  1WHK A;  5GAN 3;  2QQ9 A;  1YNZ A;  4M7A D;  2QEX T;  4EIK A;  1W2B P;  4LNP A;  1MNE A;  3VS2 A;  4RG8 A;  4ZGE B;  3X28 B;  4E7Z A;  3A1P A;  3M0U A;  1Y96 A;  4CRI A;  2XG8 D;  2YDL A;  1OU9 A;  3I55 Q;  3I56 A;  1NPP A;  2KAF A;  4ZTF A;  1RLQ C;  4M78 G;  1VQ7 Q;  4X9C A;  3DB3 A;  3NMZ C;  2RHU A;  4OMN A;  2LMJ A;  2VC8 A;  1SSF A;  2CKK A;  2RA2 A;  2CRE A;  4M75 E;  4BI4 A;  3JCM Q;  4FYW B;  1M27 C;  4KT0 E;  4ZGD B;  3OW2 S;  4Z8A A;  5GAN d;  1PRM C;  3FRN A;  1X2Q A;  1M90 R;  3V8L A;  1UJ0 A;  2D0Q B;  4C8Q C;  4LUE A;  3EFS A;  1ZHI A;  2XK0 A;  2WSC E;  1VQK Q;  5FRM A;  5IHI A;  2X4X A;  1D1B A;  2RPN A;  2DLP A;  4RKU E;  1VQP A;  2MIO A;  1JQQ A;  3CC2 T;  2P84 A;  2DFU A;  1QWF A;  1TTH B;  1I0C A;  1V29 B;  1VQ8 Q;  4A63 B;  2CP3 A;  2MMP A;  4JDS A;  1M5Q 1;  3L1A A;  4OMP A;  3GPL A;  2DE0 X;  3EG0 A;  4BI8 B;  3L2V A;  5FWB A;  1NJI R;  3I5R A;  1AD5 A;  2RHZ A;  2J6O A;  2LT4 A;  2PVO B;  1N8R C;  1PHT A;  4J6W A;  1BI0 A;  2FZC B;  2DET A;  4M78 F;  4C0F A;  4KRT A;  3CBO A;  4JZ3 A;  1EIF A;  4QQD A;  1NBE B;  4F7U A;  3VYG A;  3VKI A;  5KE3 A;  4OMF B;  1BBZ A;  1G8X A;  3EAE A;  2ZCF B;  5GAN e;  2EGE A;  2JNG A;  4J9E A;  2ROT A;  2VWF A;  4J9D A;  2EYW A;  2K5I A;  1W4S A;  2QDY B;  3O8V A;  4M7D C;  4OML A;  1UFF A;  2D6F A;  2J6K A;  1T0H A;  4M7D F;  1N8R R;  1B34 A;  1JBM A;  2V1Q A;  3KXT A;  1YIT A;  1K9M R;  3CCL T;  3H8Z A;  5CR2 A;  2R5A A;  2KQW A;  1WHH A;  3EG3 A;  1RAD B;  5LJ5 e;  3M54 A;  2LP5 A;  4KGV B;  4AFS C;  1AWX A;  2QQB A;  2FHD A;  2K5F A;  1W2B A;  4E6R A;  5GAO p;  3JV3 A;  3HPW A;  2EQI A;  3LGF A;  1FMW A;  3CCQ T;  1UEC A;  4RUG A;  1EX4 A;  4M75 D;  5KYX B;  1UGQ B;  4M77 C;  4MMK A;  4M78 C;  1YJ9 Q;  1VQM T;  1OQK A;  2MPX C;  2B8A A;  1N27 A;  3OW2 A;  1KIK A;  1AWO A;  1UGP B;  5IAY A;  2EJG A;  1SHG A;  2JXB A;  1YJW Q;  5CKH A;  3QJY A;  1GCP A;  2LTO A;  3JB9 J;  4C5H A;  1R77 A;  1JXM A;  2KMT A;  2K7A A;  1ACM B;  1PRL C;  1ZSZ C;  4FSS A;  2BE9 B;  4XTW A;  3PIP A;  5GAN 6;  1KQS A;  2DL5 A;  1Y96 B;  1GL5 A;  1OEB A;  4ZN3 A;  2K2M A;  2QEX Q;  3KUF A;  3OS1 A;  1RAA B;  4AFQ C;  1AVZ C;  3UDC A;  3RDV A;  3TVT A;  2XU8 A;  1M2O A;  2YLC A;  4FU6 A;  4MDW A;  3I5S A;  3JCM P;  1RI9 A;  4PK4 A;  1QWE A;  2M51 A;  2HQE A;  2JM9 A;  3QWX X;  3NGP A;  2NLU A;  1ZUK A;  4C0D C;  1VQO T;  3CCQ A;  2PQW A;  3G71 A;  2WSF E;  3LLR A;  3UPU A;  1B3Q A;  4XTV A;  3UF4 A;  2CGH A;  2ABL A;  4LDV A;  1NE8 A;  2KDS A;  5DLQ E;  1T3L A;  2JW4 A;  2FB7 A;  1RI0 A;  5IH2 A;  1N9S A;  1NPR A;  3QDR B;  4R56 A;  2LZ6 B;  2JTF A;  2HSE B;  1RAG B;  4L59 A;  3A8G B;  3VUZ A;  2OAU A;  5HCK A;  1JRI A;  2HBW A;  2E12 A;  4M7A A;  3M4Y A;  1OX9 A;  3MHX A;  2NYS A;  3SWN B;  1LCK A;  3M0R A;  3KBG A;  5LJ3 g;  3CBP A;  1UUE A;  4IUT A;  4ZTJ A;  4KUD K;  3TRE A;  1FMV A;  2KRM A;  5CO7 A;  1KK7 A;  3UA7 A;  3OYA A;  1HYO A;  1N9R A;  5GMK m;  4DBH A;  4XU0 A;  3JCM f;  3ZEH A;  4F7U B;  1Y71 A;  2QQS A;  5J26 A;  1UGR B;  3SFM A;  2KY9 A;  5HK3 A;  1VQ6 Q;  4O5V A;  3VS3 A;  4NOY A;  5GAN 2;  4B9W A;  4PJJ A;  4L6V 5;  3M57 A;  2P0K A;  3EFR A;  2XHC A;  1EFN A;  3OYN A;  4M77 G;  1SEM A;  1I4K 1;  2V1R A;  1B34 B;  4HCZ A;  4BDY A;  1WHL A;  3LWH A;  3J7A F;  3FJP A;  7AT1 B;  1IXD A;  4F7U E;  4CI0 C;  4BI3 A;  2VVK A;  3MP8 A;  5FLX E;  2VUB A;  4OVA A;  1MMD A;  1ZUU A;  2NUT A;  2E3I A;  2EYX A;  2DMO A;  3OW2 P;  2QG9 B;  4A4K A;  2O9V A;  1E7O A;  2KRN A;  2YT6 A;  1VIE A;  3V7C A;  4LUD A;  1TH7 A;  5LJ3 e;  5LJ5 j;  3OYD A;  1KC8 R;  4NL2 A;  1UB4 A;  2L2P A;  4XU1 A;  3BE3 A;  2R57 A;  3JCM W;  1WYX A;  3G6E Q;  2EGA A;  2CUB A;  2DX1 A;  4A4E A;  1J3T A;  5A2Q E;  1QKW A;  1D09 B;  3OS0 A;  4QQG A;  1Y7X A;  2DA9 A;  3I35 A;  3RNJ A;  2OTJ A;  2QQA A;  3E9G A;  3OYB A;  2COY A;  2X35 A;  3P8D A;  2RQR A;  1M1K C;  3QKJ A;  2DTO A;  4O6J A;  2M1H A;  4MML A;  5LJ5 d;  2DIL A;  4PFO A;  1S72 Q;  3JCM d;  5GAO l;  1KD1 R;  1Q7Y R;  1M2V B;  2XD0 A;  1GFC A;  4BY6 C;  5GAN h;  3JCM b;  4HCC A;  3OB9 A;  5DM7 R;  1BI3 A;  1YWP A;  2DBM A;  2XDB A;  1PG5 B;  2RM4 A;  3SHW A;  2OTL A;  1WA7 A;  1WJQ A;  4QKU A;  2FEI A;  1XJW B;  2V8K A;  4C0D B;  4C0Z A;  1H3H A;  3CME T;  4GBQ A;  3C0C A;  2DXT A;  4M75 C;  4RTZ A;  3D7S B;  1GXI E;  3CD6 Q;  1YJN T;  3QSU A;  3TCJ A;  3QJ6 A;  1V1C A;  1T0J A;  5GAN j;  3CXC S;  2DRM A;  3CMA Q;  5D6W A;  1M3A A;  1KQ1 A;  2AHJ B;  4LDW A;  1NLO C;  3G4S T;  4OB1 B;  4EPC A;  3PIO A;  1OU8 A;  2EGC A;  1S72 A;  4LDX A;  4HXJ A;  1M90 C;  5D6Y A;  5A0L A;  3DLL A;  3ER0 A;  1NEG A;  1KFZ A;  1K0X A;  2DNU A;  1UG1 A;  1G5V A;  5GAN g;  1WFW A;  2L3S A;  2DL8 A;  1OPK A;  1M9S A;  3FDR A;  2ZAE A;  4C8Q D;  2A36 A;  4PJN A;  2GQI A;  1R0C B;  3VV0 A;  4N4H A;  3C4S A;  2ED0 A;  5FU6 C;  3CCM T;  2HQX A;  1M90 U;  4IKF A;  1VQ9 T;  3H6Z A;  1VIF A;  2MOX A;  5KYU A;  2RMO A;  4JLG A;  1MGQ A;  3OBW A;  2KK4 A;  1QCO A;  1TS9 A;  3G4S A;  3JSC A;  1ZA2 B;  2KR3 A;  2EIF A;  4JUV A;  4LD9 K;  1WQ7 A;  2MI6 A;  3JB9 F;  3BY7 A;  4HVU A;  2WAC A;  3THK A;  4QW2 A;  2PU9 B;  2WSE E;  1PCX A;  2BTT A;  2OTL T;  3JB9 D;  2KXC A;  2DKG A;  4QVC A;  4C8Q G;  4A53 A;  3QXE B;  4QQ6 A;  4D6W A;  5J3B A;  2DYI A;  1VQL T;  5I21 A;  3I9Q A;  4NS5 A;  2QA4 T;  2ZPH B;  2J7I A;  5KCO A;  2K6D A;  2AK5 A;  1MUZ A;  5CQY A;  1PNJ A;  1U3O A;  2L3Q A;  4JS5 A;  1VQN T;  1H3Z A;  4XTZ A;  4LD6 A;  3CC2 A;  4JRQ A;  2DF6 A;  4JJB A;  2D8J A;  3JCM h;  4IUV A;  3RUX A;  3ZBD A;  4FW2 A;  3MET A;  1NEB A;  3X24 B;  2CP2 A;  2QA4 Q;  3RBB B;  1YI2 A;  4M7A F;  5ECA A;  1PSF A;  2K9G A;  3G4S Q;  3LYI A;  3TSZ A;  4AT1 B;  1OPL A;  2DXU A;  2HCK A;  2G6F X;  2L89 A;  2COZ A;  5IXB A;  3OS5 A;  4FIB A;  3CCM A;  3OYM A;  2PVG B;  4VUB A;  5I2S A;  1VQ4 Q;  1SRM A;  3O5Z A;  4BD3 A;  1BK2 A;  2VXE A;  4II1 A;  1SKU B;  2G3R A;  3P8H A;  1HK9 A;  1M30 A;  2E5Q A;  3U23 A;  1AZG B;  2CP7 A;  4RG2 A;  3CC4 T;  1RLP C;  4AG1 C;  1UDL A;  2H8H A;  1O9S A;  2CT3 A;  2QTV A;  2SRC A;  2CSI A;  5GAO m;  1BI1 A;  2LQW A;  5DLO A;  4EDU A;  1MMN A;  1WHJ A;  2O4X B;  2P0Q A;  4DBQ A;  3G71 Q;  2AIR B;  4PJO G;  4M7D D;  1N6A A;  2IPO B;  2CP5 A;  3S3O A;  2JMC A;  4KUI A;  1VYV A;  4PFZ A;  2PNI A;  3TU4 K;  2BZ8 A;  2KBT A;  2PUK B;  2R58 A;  4X9D A;  1GCQ A;  1VQ6 T;  3H0I A;  1GFD A;  3JCM c;  4MDX A;  4UC4 A;  2HL3 A;  2QTX A;  2L0A A;  2DRK A;  2E1H A;  1WLP B;  3EHR A;  1GRI A;  2HQH A;  1VQN A;  1ZA1 B;  2HZY A;  2RF0 A;  1VQM Q;  2MF2 A;  2QYZ A;  4FT4 A;  2EYY A;  3VRY A;  4HKE A;  1BI2 A;  2DD5 A;  2L5Q A;  3C95 A;  1VQ5 T;  3KFV A;  5GMK h;  2XID A;  2OX7 A;  3LWI A;  3MKD A;  4P5N A;  5CIU A;  2QI2 A;  2A37 A;  2DTH A;  4A4G A;  4Z02 A;  1PKT A;  4KUL A;  3NFC A;  1E6G A;  2DEQ A;  1G3S A;  2OTJ T;  2RHI A;  5KE2 A;  3OQ5 A;  2CT4 A;  2D8H A;  3GBQ A;  3CCE A;  2O88 A;  3CCS T;  5GAN 4;  3V7R A;  3GNF B;  2EKO A;  1YIT Q;  2HKN A;  4C92 G;  1QW1 A;  3REB B;  3EFO B;  3H0F A;  4PFP A;  1HD3 A;  4RTT A;  4BE1 A;  2YUO A;  2ENM A;  1I81 A;  1KQS P;  1Q86 U;  4PJM A;  3CCR A;  4BB7 A;  1LNX A;  2QXF A;  1H8K A;  2MK5 A;  2LJ1 A;  3E2U A;  2LCS A;  1GCQ C;  1DJ7 B;  2DVE A;  1YJ9 A;  2CDT A;  3RMQ A;  5FU7 B;  4JRP A;  2YHT A;  4J9F A;  1SSH A;  1WXB A;  3CCU A;  1YJW T;  1TOV A;  1FYN A;  2D9T A;  1NZ9 A;  2Y4Y A;  3CCJ Q;  3G6E A;  1CSK A;  3GP8 A;  2KGT A;  4HCB A;  1JJ2 P;  2C0T A;  2HNI A;  3OSV A;  3P8B B;  5HKC A;  5GAO n;  3OY9 A;  3HFO A;  1W6X A;  2RN8 A;  4M75 A;  4IUU A;  3GLX A;  3VYH B;  3JCM g;  1VQL Q;  4FM4 B;  5L8R E;  3EG9 B;  3M56 A;  3FB9 A;  4ZNX A;  3CME Q;  3C12 A;  1RAE B;  5A0D A;  5L23 A;  5LJ3 f;  4Y28 E;  1VQ4 T;  1Q81 U;  2L8D A;  4XTY A;  2EVR A;  4FL6 A;  1NM7 A;  4OMM A;  2DJQ A;  4HA8 A;  4Q5W A;  1G3W A;  4NL3 A;  4J7F A;  2LVM A;  1V76 A;  3HSB A;  1QLY A;  4RTX A;  1YI2 Q;  1KSW A;  5GAO q;  3I55 T;  2LDM A;  1ZUY A;  1AHJ B;  2DD4 A;  3AT1 B;  5I11 A;  2PVD B;  4E2F B;  3C94 A;  1Y0M A;  4M4Z A;  3CCV T;  1Z9Z A;  3X26 B;  1IO6 A;  3CPF A;  1X69 A;  1MV3 A;  3PGG A;  3QUI A;  3E1S A;  3HP9 A;  2HSP A;  3QDF A;  1U1T A;  5AT1 B;  1ZQ1 A;  2M0Y A;  2J6F A;  3OYC A;  3OYY A;  5LJ5 g;  3CME A;  1BYM A;  4Y92 A;  4V2S A;  1W2B S;  4OP0 A;  3HL8 A;  3GIB A;  2LX7 A;  6AT1 B;  1OI1 A;  3OA6 A;  4ZGJ B;  2D0N A;  3UA6 A;  1VYU A;  1IGQ A;  2M02 A;  1WGS A;  2X4W A;  1PM3 A;  4OB0 B;  1YJ9 T;  1YI2 T;  1WI7 A;  1JJ2 A;  3CCU T;  3QHS A;  4M7A C;  2XKO C;  3G71 T;  3JCM J;  3CPW P;  1HJD A;  2BE7 D;  4CC4 B;  3T9N A;  3I56 T;  2A7Y A;  2E6Z A;  1QP2 A;  1QVG P;  1UTI A;  1M8M A;  2BUD A;  3OMG A;  4J9I A;  2ZPE B;  3M9Q A;  3CC4 A;  1UHF A;  5IN1 A;  2DXC A;  1KD1 C;  2DL7 A;  2C0O A;  2GTO A;  4FT2 A;  4KBM B;  1CKA A;  3SB2 A;  1ZLM A;  4ME7 A;  3EFO A;  4BUG A;  3REA B;  3S6W A;  3MO8 A;  3RKY A;  1TG0 A;  4C5E A;  2ZGW A;  1JB0 E;  1CKB A;  3CC7 T;  2YUN A;  5LJ5 h;  1YBY A;  3L2Q A;  2HDA A;  2XMF A;  5GJV B;  4JJD A;  1YN8 A;  4F17 A;  3CMA A;  4JS4 A;  2O2O A;  5FWC A;  1AOJ A;  2Y90 A;  3QPH A;  3BDU A;  1X75 C;  1KC8 C;  2YUQ A;  3M0P A;  4J6Y A;  2AT1 B;  3J80 E;  2HD0 A;  3WVE B;  2M16 A;  1K73 U;  2KRS A;  4C5G A;  2K3Y A;  1VQ6 A;  4MZT A;  2EYZ A;  4IUQ A;  4ELY C;  1Z9Q A;  3FC3 A;  4XU3 A;  3M0S A;  4E7H A;  3PE0 A;  1WNL A;  1VA7 A;  1VQ5 A;  2VB6 A;  2FVU A;  1JU5 C;  3VS0 A;  2RD1 A;  1YIT T;  1OYX A;  4LXC A;  1Q81 R;  3CQT A;  1KQS S;  3HFN A;  1JXO A;  2CP6 A;  3A8O B;  4BAC A;  2EWN A;  4OGE A;  4L5G A;  3VS1 A;  2DL3 A;  1P92 A;  2CZ7 B;  1TXQ A;  3G1J A; 
#chains in the Genus database with same CATH homology
 4HVU A;  4RTY A;  3THK A;  2YSQ A;  1I0C A;  1ZSG A;  2FRY A;  2BTT A;  4A63 B;  1UE9 A;  4WCI A;  2DYB A;  2KXC A;  2MCN A;  4OMP A;  4JJC A;  3H41 A;  4RTU A;  2DE0 X;  3EG0 A;  5FWB A;  3I9Q A;  1RUW A;  1E6H A;  2EPD A;  2J7I A;  4LE9 A;  1N5Z A;  2K6D A;  2AK5 A;  1MUZ A;  2RQV A;  2HEQ A;  4LN2 A;  1PNJ A;  1AD5 A;  1U3O A;  2JM8 A;  2L3Q A;  3I5R A;  2CUD A;  2J6O A;  2J06 A;  2QDL A;  1GBQ A;  1PHT A;  3VS6 A;  2O31 A;  1JO8 A;  4J9G A;  2B86 A;  2DF6 A;  4JJB A;  2D8J A;  4KRT A;  4JZ3 A;  3NHN A;  2C0I A;  1YP5 A;  2IIM A;  1YCS B;  3VS4 A;  1NEB A;  1I07 A;  1MV0 B;  2A28 A;  1BBZ A;  3RBB B;  2EGE A;  1WXU A;  5ECA A;  2K9G A;  4J9E A;  2ROT A;  2VWF A;  3PVL A;  4F14 A;  4J9D A;  2EYW A;  3TSZ A;  1OPL A;  3ULR B;  4OML A;  1UFF A;  2J6K A;  1S1N A;  2HCK A;  1T0H A;  3QWY A;  2G6F X;  2V1Q A;  5IXB A;  1SHF A;  2GNC A;  1ABQ A;  2O9S A;  1SRM A;  4CC3 A;  1HSQ A;  3O5Z A;  1BK2 A;  3EG3 A;  3EG2 A;  2RQT A;  1M30 A;  2LP5 A;  4AFS C;  1AWX A;  3U23 A;  1AZG B;  4D8D A;  1NYG A;  4E6R A;  2X3W D;  1RLP C;  3JV3 A;  1GBR A;  2EQI A;  1AZE A;  4AG1 C;  1UDL A;  2H8H A;  2JMA A;  2JT4 A;  2FRW A;  4JZ4 A;  1UEC A;  2CT3 A;  2PTK A;  4RUG A;  2SRC A;  2W0Z A;  2CSI A;  2ECZ A;  5EC7 A;  1SRL A;  3M0T A;  2LQW A;  1KIK A;  1AWO A;  4X1V A;  1VYT A;  5IHK A;  1SHG A;  2JXB A;  3ZL7 C;  1GCP A;  1A0N B;  3TSW A;  2JMC A;  2FO0 A;  1VYV A;  1JXM A;  3EHQ A;  2PNI A;  2K7A A;  2BZ8 A;  2K79 A;  1PRL C;  1U06 A;  2KBT A;  3NPF A;  4FSS A;  2JTE A;  1GCQ A;  1BB9 A;  3H0I A;  1GFD A;  2DL5 A;  1GL5 A;  1OEB A;  2K2M A;  2GGR A;  1I1J A;  2DRK A;  2L0A A;  2PZ1 A;  1WLP B;  4IIM A;  4Z88 A;  3EHR A;  1GRI A;  1PKS A;  4AFQ C;  1X27 A;  2RF0 A;  1AVZ C;  2D1X A;  2AZS A;  2EYY A;  3TVT A;  4ORZ A;  3VRY A;  3I5S A;  1RI9 A;  2FPF A;  2ED1 A;  4J9H A;  1QWE A;  2M51 A;  2KYM A;  2JM9 A;  2LJ3 A;  3QWX X;  1W1F A;  4AFU C;  3NGP A;  1ZUK A;  1UJY A;  3KFV A;  4QT7 A;  1K76 A;  1ZBJ A;  1G2B A;  1B3Q A;  2A37 A;  2CH4 A;  2KRO A;  1X2K A;  3UF4 A;  2DVJ A;  1SPK A;  1PKT A;  2ABL A;  4J9C A;  1E6G A;  1T3L A;  2JW4 A;  2JS0 A;  5IH2 A;  1TUC A;  2CT4 A;  2ESW A;  4D8K A;  1K4U S;  2LZ6 B;  2D8H A;  3GBQ A;  2DBK A;  1WX6 A;  1XOV A;  2BZX A;  2O88 A;  1NLP C;  2K3B A;  5HCK A;  2HBW A;  2L3P A;  3REB B;  1W70 A;  1LCK A;  3M0R A;  3H0F A;  1UUE A;  1HD3 A;  1WDX A;  4RTT A;  2YUO A;  2JS2 A;  2ENM A;  2KRM A;  5IXF A;  3R6N A;  3UA7 A;  3VS7 A;  2GTJ A;  1JEG A;  1K0S A;  2P4R A;  1H8K A;  2LJ1 A;  2LCS A;  1GCQ C;  2A08 A;  2CDT A;  4HVW A;  1U5S A;  3VS3 A;  2X3X D;  1B07 A;  2J05 A;  4J9F A;  2ROL A;  4ESR A;  3UAT A;  1SSH A;  1WXB A;  4IIO A;  4DEY A;  2LQN A;  2VKN A;  4CC7 A;  2RNA A;  1FYN A;  1EFN A;  4RTW A;  2EBP A;  1SEM A;  1CSK A;  1TUD A;  2V1R A;  2KGT A;  2C0T A;  2W10 A;  4R0K A;  1W6X A;  2RN8 A;  4AG2 C;  1H92 A;  1Y57 A;  2F2V A;  2F2X A;  2VVK A;  2GBQ A;  1QKX A;  5IHN A;  4ZNX A;  3PVQ A;  1ZUU A;  2OAW A;  4CC2 A;  1UGV A;  5L23 A;  1AWJ A;  2OI3 A;  3A98 A;  2EYX A;  4HVV A;  2EVR A;  4OMM A;  1NM7 A;  2DMO A;  2DJQ A;  1K1Z A;  2O9V A;  1E7O A;  2KRN A;  2YT6 A;  3H0H A;  3VRZ A;  4DEX A;  1QLY A;  2RQU A;  4LUD A;  4RTX A;  2DL4 A;  2YUP A;  1KSW A;  4AFZ C;  2L2P A;  1ZUY A;  1WYX A;  5I11 A;  2EGA A;  1WXT A;  2CUB A;  3IQL A;  2BZY A;  2DX1 A;  4M4Z A;  1Y0M A;  4Z89 A;  1J3T A;  1Z9Z A;  1QKW A;  1IO6 A;  1X69 A;  1M3B A;  1KJW A;  1MV3 A;  2RQW A;  3VS5 A;  4J9B A;  3EGU A;  2DA9 A;  3I35 A;  3RNJ A;  2KYB A;  2HSP A;  2OJ2 A;  1FMK A;  5GJW B;  3EG1 A;  2RQR A;  2M0Y A;  2J6F A;  2KEA A;  4Y92 A;  2KT8 A;  2LX7 A;  2DIL A;  2EKH A;  1M3C A;  4K11 A;  2D0N A;  3UA6 A;  1VYU A;  3FJ5 A;  2AZV A;  1GFC A;  1T3S A;  2LJ0 A;  1WI7 A;  2EW3 A;  1G83 A;  2LNH B;  5FW9 A;  1WIE A;  1AWW A;  1HJD A;  2KXD A;  2NUZ A;  1YWP A;  2DBM A;  4CC4 B;  1ZX6 A;  3SHW A;  1UTI A;  1M8M A;  1ABO A;  1UHC A;  1WA7 A;  4J9I A;  2FEI A;  1UHF A;  2DL7 A;  2E5K A;  2C0O A;  4F16 A;  1H3H A;  4HCK A;  2GTO A;  2CSQ A;  2NWM A;  4GBQ A;  3M0Q A;  2FPE A;  3C0C A;  1YWO A;  4RTZ A;  2KNB B;  1CKA A;  1ZLM A;  1X6G A;  2FPD A;  1V1C A;  1NYF A;  1T0J A;  2AKK A;  3REA B;  2KE9 A;  4GLM A;  2DRM A;  1TG0 A;  1M3A A;  1X6B A;  1CKB A;  1NLO C;  3SEM A;  1K9A A;  2YUN A;  2HDA A;  1X43 A;  2EGC A;  2SEM A;  1YNZ A;  1NG2 A;  2XMF A;  3LH5 A;  5GJV B;  4EIK A;  4JJD A;  4HXJ A;  1YN8 A;  4F17 A;  4LNP A;  2O2O A;  5FWC A;  1AOJ A;  3VS2 A;  4RTV A;  1NEG A;  2YUQ A;  3M0P A;  1KFZ A;  1K0X A;  2AKL A;  2DNU A;  1UG1 A;  1ARK A;  3M0U A;  1WFW A;  2YDL A;  2L3S A;  2DL8 A;  1OPK A;  4OMQ A;  2KRS A;  1RLQ C;  4OMO A;  2EYZ A;  1Z9Q A;  2CH4 W;  2KT1 A;  2A36 A;  1OV3 A;  3M0S A;  4JPB W;  2GQI A;  3NMZ C;  3PE0 A;  4OMN A;  2LMJ A;  1VA7 A;  5I22 A;  2I0N A;  2CRE A;  2ED0 A;  1AEY A;  1M27 C;  1JU5 C;  4Z8A A;  3VS0 A;  1PRM C;  1X2Q A;  3CQT A;  1UJ0 A;  2FG0 A;  2MOX A;  2RMO A;  1JXO A;  4LUE A;  2DM1 A;  1QCF A;  1PWT A;  2F2W A;  3VS1 A;  2DL3 A;  5IHI A;  1BU1 A;  2RPN A;  2DLP A;  2KR3 A;  2MIO A;  1JQQ A;  1OOT A;  1QWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...