2JS2A

Solution structure of first sh3 domain of adaptor nck
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
63
structure length
63
Chain Sequence
b'GSMAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic protein NCK1
publication title Specificity determinants of a novel Nck interaction with the juxtamembrane domain of the epidermal growth factor receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 7
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2js2A00
2DYBA 1X2KA 1UGVA 2CSQA 1U06A 2EGCA 1W1FA 3I9QA 1UTIA 1T3LA 4LE9A 1ZLMA 1HJDA 4JZ4A 2JTEA 1KIKA 2JT4A 2A28A 1M27C 1T3SA 2DRMA 2XMFA 4AG1C 1MV0B 1H92A 5FWCA 3H0IA 4RTYA 1QWEA 2D1XA 2GQIA 4F16A 1JQQA 2EYYA 2K79A 4IIOA 2DMOA 4OMPA 2HDAA 3VS4A 2FPFA 1SHFA 3H41A 2RPNA 2DF6A 1AWXA 3UATA 1B07A 1K9AA 2L3SA 2VKNA 2YDLA 1ZUYA 1GCQA 4IIMA 3VRZA 2KT1A 4AFQC 1UHCA 2JM9A 1VYVA 2J06A 3H0HA 2F2VA 4GLMA 1X6GA 4JJCA 2FO0A 2HBWA 1T0JA 1W6XA 2L2PA 1AWJA 2KRSA 1BBZA 1UDLA 2D8HA 2RQVA 1T0HA 2CREA 1VA7A 4RTVA 2MOXA 2BZXA 1IO6A 4J9BA 1M30A 1LCKA 1JEGA 4LUEA 2ESWA 1BB9A 3M0UA 2DL5A 1N5ZA 4RTWA 2DL4A 2LJ3A 1WFWA 4FSSA 1UHFA 3VS6A 1WXUA 2IIMA 3SHWA 4RTXA 1TG0A 1ZX6A 1NEBA 4RTUA 4ORZA 1AOJA 1U5SA 2LQNA 5HCKA 2K6DA 3EG1A 5IHKA 4HCKA 1SRMA 2C0IA 3THKA 2CDTA 1AZGB 1M8MA 1GBRA 1YWPA 2ENMA 2FPEA 2RQTA 2M51A 2DL8A 4LN2A 4M4ZA 1NLOC 5GJVB 2KBTA 2EGAA 3M0RA 2BZYA 2RQRA 5ECAA 1BU1A 2LX7A 2RF0A 2RN8A 4CC7A 1X43A 1QKXA 3M0QA 1FYNA 2EYWA 1K76A 4HVWA 1Y57A 1H3HA 2O9SA 1NYFA 4E6RA 2EYZA 2KRMA 2JMAA 1CKBA 3R6NA 4A63B 4DEYA 2MIOA 4Y92A 2ED1A 1Z9QA 4CC3A 1EFNA 1M3AA 1RUWA 1UUEA 3PVQA 2GTOA 2C0OA 1UJ0A 1K0SA 4J9CA 4HVVA 2KXCA 1ZBJA 1JU5C 1MV3A 1G83A 3NHNA 3VRYA 2F2WA 1HD3A 2F2XA 1J3TA 1V1CA 2DVJA 2DL3A 1NLPC 1OV3A 4RUGA 2ROLA 1KFZA 1WA7A 2E5KA 3QWYA 4X1VA 2JS0A 3C0CA 2EQIA 1MUZA 2M0YA 3VS0A 2FG0A 3UF4A 3EG3A 2BZ8A 2LQWA 5FW9A 1JO8A 3LH5A 2PNIA 4WCIA 2B86A 2AZSA 4JJBA 3I5SA 1HSQA 1WI7A 2C0TA 3ULRB 2W10A 2J05A 4CC2A 3RNJA 4JZ3A 2GGRA 1ARKA 4J9FA 1Y0MA 1OPKA 1YWOA 2HEQA 3PVLA 3EHRA 2KYBA 1QLYA 2V1QA 2K7AA 4AFZC 4CC4B 2CUBA 1X69A 3EG2A 1JXMA 1CKAA 1Z9ZA 4OMOA 1RLQC 1GRIA 1KSWA 1PKTA 2LJ1A 2ROTA 1FMKA 2KGTA 5IXBA 3VS2A 2JM8A 1OEBA 1AWOA 2LJ0A 2ABLA 1SRLA 3NMZC 1GFDA 2W0ZA 2DX1A 4D8KA 4F17A 1ZUUA 1NEGA 2NUZA 1UECA 2HSPA 2EBPA 3PE0A 1SPKA 2D8JA 5I11A 2LNHB 2YUQA 1X27A 1K1ZA 3M0SA 1VYTA 4QT7A 1M3CA 3EHQA 2EYXA 2DJQA 2I0NA 2QDLA 4D8DA 2K2MA 2X3XD 2YUPA 4RTZA 5IHIA 3TSWA 1W70A 1AVZC 3REAB 1E6GA 4J9EA 4R0KA 2OI3A 4OMNA 1SHGA 2CUDA 1GBQA 3NPFA 2VWFA 1H8KA 3A98A 3TSZA 5L23A 2SRCA 2DL7A 2J7IA 1YN8A 2KRNA 1G2BA 1E6HA 2EGEA 2ECZA 1SEMA 2AK5A 1NYGA 2CSIA 3H0FA 1B3QA 1UG1A 3TVTA 1AEYA 2YSQA 3I35A 2YUOA 1KJWA 2GBQA 2V1RA 2ED0A 1M3BA 3NGPA 2KEAA 1QWFA 2FEIA 2DILA 4LUDA 1QCFA 1X6BA 2CH4W 4LNPA 4AFSC 4DEXA 1K0XA 2BTTA 1GCQC 3JV3A 1YCSB 2AKLA 4JPBW 2J6OA 1OOTA 2P4RA 1PKSA 1YP5A 1WLPB 4Z8AA 1AZEA 5IXFA 1QKWA 3QWXX 2DNUA 1ZUKA 3O5ZA 3I5RA 2KNBB 4OMMA 4J9IA 4OMLA 3FJ5A 2G6FX 1RLPC 2HCKA 2EVRA 2DLPA 1GL5A 3CQTA 1E7OA 1PNJA 4OMQA 1NM7A 1OPLA 4EIKA 4K11A 2RMOA 1VYUA 2A08A 1WYXA 3IQLA 2O88A 4J9HA 1I07A 2EPDA 3M0PA 4RTTA 2DM1A 1BK2A 2DRKA 1GCPA 4Z89A 4AG2C 2L3QA 1TUCA 4Z88A 2JW4A 2MCNA 2O2OA 2YUNA 1I0CA 1PRLC 1WIEA 5EC7A 2KR3A 2K3BA 2J6KA 2FRWA 2JXBA 2O9VA 1CSKA 1PWTA 2X3WD 1A0NB 2CT4A 3EGUA 1U3OA 2CT3A 1PRMC 2CH4A 5IH2A 2A37A 4KRTA 2O31A 5FWBA 2L3PA 2NWMA 1ABOA 2DA9A 1NG2A 3EG0A 4GBQA 2AKKA 4J9GA 1AWWA 4F14A 2DBMA 1PHTA 2FPDA 3UA6A 3VS3A 1I1JA 3VS1A 3RBBB 1SSHA 2PTKA 2OAWA 2KE9A 4ESRA 2EKHA 4JJDA 3SEMA 3REBB 1X2QA 4ZNXA 2J6FA 3ZL7C 4AFUC 2DE0X 1WXBA 2VVKA 2LCSA 1UJYA 1AD5A 2YT6A 1ABQA 1UE9A 3KFVA 2GTJA 2RNAA 1YNZA 5I22A 3VS5A 2JS2A 2OJ2A 1TUDA 2D0NA 2H8HA 1S1NA 3UA7A 4J9DA 3VS7A 2PZ1A 2KT8A 1GFCA 2FRYA 2K9GA 5GJWB 2LP5A 2LMJA 1JXOA 2KYMA 1XOVA 2GNCA 2KROA 2RQUA 3U23A 1WXTA 5IHNA 2SEMA 1WDXA 1ZSGA 4HXJA 4HVUA 1K4US 2LZ6B 1RI9A 3M0TA 2A36A 2AZVA 2EW3A 2L0AA 2RQWA 2DBKA 3GBQA 2KXDA 1WX6A 1UFFA 2JMCA
chains in the Genus database with same CATH superfamily
1UB4A 4C8QF 3CXCP 1U06A 1WZOA 2A28A 5C0MA 1YJ9A 4ZN1A 3GNGA 2CP3A 3SDZA 3RUXA 4M7AG 1VQKA 3V7SA 1KC8U 2NLUA 1QWEA 2I2LA 2X4JA 3DB3A 3KUFA 5CK9A 2DMOA 2HDAA 5GAN6 1B34A 3JCMh 2DF6A 3UATA 1D3BB 4FT4A 4PFPA 2L3SA 4A4EA 4XAXB 4XTVA 4IIMA 4XK8E 3CCJQ 2RI3A 4E7IA 3VRZA 3MCAB 1O75A 4C5EA 2VV5A 3EFRA 1M5Q1 2MYSA 1IGQA 2F2VA 1X6GA 1YFNA 1IHWA 2FO0A 1VQ9T 2DKGA 3L2QA 1W6XA 1UDLA 3HRSA 3CPWA 4C5GA 4C92E 2K5FA 2EKOA 1VQLQ 4JJNK 4J9BA 1M30A 4PKCC 2CP6A 2QYZA 1ZHIA 2OTJQ 2HD0A 4CI0C 1YI2Q 4A4FA 4EPCA 4RTWA 4N4IA 1K73R 4QW2A 1K8AU 1JRIA 3MO8A 2K57A 1VQNQ 2XKOC 4ORZA 1AOJA 5HCKA 3EG1A 3V8KA 2ZCFB 2LNVA 3RKWA 3CMET 1IZ6A 2DO3A 3THKA 2OTLT 3C12A 2DZ9A 1AZGB 2HKNA 4OF1A 2FPEA 2M51A 2M9UA 4LN2A 4M4ZA 1M4ZA 5GJVB 2CYZB 2RQRA 2RF0A 5KYWB 3M0QA 2P84A 3DKMA 5CKDA 4HCCA 2O9SA 5HY6A 1NYFA 2YHTA 4QKUA 1CKBA 3R6NA 1YJNT 2LTOA 2ED1A 2CP2A 1VQ4A 2D9TA 2ZAEA 4M77G 2VXEA 1NPPA 3HKSA 1RUWA 3G4ST 1QP2A 5GAN2 2LCCA 1UJ0A 1K0SA 2DJZA 2F2WA 2EWNA 2A7YA 1ZQ1A 4L6V5 3MP1A 2ZPBB 2V8JA 3JCMW 1NLPC 2ROLA 3UT1A 1M1FA 2E5KA 2EIFA 4X1VA 3C0CA 3EGXB 5I2SA 3BW1A 3UF4A 4A4GA 2LQWA 4MZMA 2XIDA 1JB0E 1IXDA 3VKIA 3J7AF 4LDVA 3I56Q 2RHYA 1ARKA 1OQKA 3OYCA 2ZGWA 4AFZC 4CC4B 2CUBA 3CCSQ 1X69A 1Y7XA 1JXMA 2QEXT 3PTAA 4OMOA 2HZYA 3QJ6A 4WF2A 2LJ1A 4C8QD 5LJ5j 2ROTA 4M75C 4FSXA 4BE1A 5HKCA 3M5AA 1FMKA 4PJOE 2KGTA 3VS2A 2LX9A 2MF2A 1AWOA 2K5LA 2LJ0A 2F1LA 1SRLA 1WHGA 2W0ZA 3GLXA 2E6NA 4ME7A 1NEGA 5GMKl 3UPUA 4L5GA 1N8RC 3CCJA 1VOMA 2YUQA 2MI6A 2DEUA 4M7AC 2XI9A 2XDDA 3CC7T 3M0SA 4BY6B 2E4HA 4VUBA 1M3CA 1NJIC 1G8XA 5GANe 4M77A 2EYXA 2DJQA 4FYXB 2QDLA 2KSSA 4O6JA 1D1AA 4RTZA 2YRVA 1W70A 3MP8A 1VQLA 2CUDA 2LC4A 2OTJA 2XDPA 5LJ5e 3D7SB 4HA8A 1YI2A 4M78F 3CCQQ 1NZ9A 2KRNA 2NUTA 1TTHB 1SEMA 1NYGA 3H0FA 1AEYA 3TREA 2YSQA 4RMOA 2NYSA 4NS5A 1VQNA 3LWHA 2GBQA 1RAIB 1JJ2A 2FEIA 4EMKB 4Y91A 2RI2A 3WVEB 2CH4W 1HYOA 4J7IA 3JCMc 8AT1B 1WHMA 3HPWA 4XU3A 1H641 1GCQC 4J6XA 4N0AA 2MAMA 4JPBW 2XU8A 3NTHA 1OOTA 3OY9A 3V8JA 4PK4A 2VGMA 1M2VB 5CCAA 5KE2A 2KVQG 1AZEA 2X9HA 2EQKA 3FEOA 5GMKi 2RB6A 1YIJQ 3O5ZA 3OYEA 4FM4B 2PVGB 5I2MA 1FMVA 4OMMA 4M7DC 5LJ3j 4OMQA 2R58A 4HCZA 4HT9A 1NM7A 2ZPIB 5GAOr 3KBGA 1ZSZA 4K11A 3M4YA 8ATCB 1WYXA 4E7HA 4J9HA 1BK2A 1QW1A 2DRKA 2LDMA 1Q82C 2FVUA 1GCPA 3CCEQ 4Z88A 2JW4A 4AMCA 1JJ2S 1QMCA 1I0CA 1PRLC 1WNLA 4J6WA 1B34B 2O9VA 3M59A 4PJLA 1Q86U 3LW5E 2CZ0B 3PNWC 3ZFJA 2CT4A 1I8FA 4A4HA 4PJMA 1U3OA 4RCCA 3JAME 5IH2A 4PJJA 2DETA 2EFIA 1NG2A 4BI4A 3PMIA 1PHTA 3CCMQ 5FROA 1SF9A 1BCMA 3OMCA 2K3YA 2CP7A 1H3ZA 3C4SA 2OAWA 2JOYA 3I56A 5A2QE 3SEMA 3AHUA 2J6FA 1WXBA 2VVKA 1UJYA 5GANh 3C94A 2VXFA 5I22A 1IRXA 2H8HA 3CC4Q 4Q5WA 4ELZC 3JCMb 4GLKA 3CCSA 2QA4Q 1GFCA 2K9GA 5LJ5h 3G1JA 3FJPA 4J7FA 2LMJA 2KYMA 1RAHB 2MWOA 9ATCB 2ZPHB 2E70A 2JVVA 1K9MR 2COZA 2KROA 2K5IA 5CVIA 2EJFA 2MWPA 4PJOA 5IHNA 1WDXA 1N27A 3ASKA 2LZ6B 5GAMj 5IT9E 2DBKA 2FB7A 2WSCE 2VYTA 3SWNA 2DYBA 3PMTA 1UGVA 4E7ZA 2CSQA 1W1FA 1WHJA 3I9QA 3M4GA 1UTIA 1OI1A 2RH2A 1HJDA 3AT1B 3MEWA 4ANJA 4KH0B 2DRMA 2XMFA 3MJXA 4AG1C 3H0IA 5KYNA 3RR6A 4RTYA 5A0LA 3G71Q 3CBMA 3BE3A 4F16A 2LT1A 5GAOn 1WPYA 1KD1R 4M78C 3QDRB 1Y71A 1K8AR 3JCMe 1M90C 3VS4A 3CCQA 1SHFA 2DXCA 2F5TX 5DM7R 2RPNA 4A53A 1AWXA 1TU0B 1LPLA 5GAMe 1K9AA 4C8QE 3G6EQ 5D7UA 3MPUB 3PFSA 2KY9A 2JM9A 1N6AA 2J06A 4M78D 3S6WA 4XTXA 2DERA 3M53A 6AT1B 4FU6A 4Y28E 1T0JA 2DEQA 3OW2A 2KRSA 1K9MC 2ZZDA 1WHHA 3CCUT 4XU2A 3CPWP 2D8HA 2RQVA 1T0HA 2CREA 2QI2A 3CCLQ 1W2BA 1VA7A 4RTVA 2MOXA 2BZXA 1Q81U 1IO6A 1LCKA 2AHJB 3MKDA 2ESWA 5GAN4 1M1GA 2XDBA 1N5ZA 4MDWA 1YIJA 2LJ3A 1WFWA 1WXUA 1ZBXA 2RK2A 3HFNA 1FX7A 5L8RE 3SHWA 1PCXA 3TCJA 2V8IA 1TG0A 2PU9B 4GY5A 3E2UA 4PJNA 1U5SA 2LQNA 3E9FA 3M55A 4N4GA 2C0IA 1KD1C 4ATOA 1K8AC 3CCEA 2R57A 5KCHA 1MHNA 1EZZB 2E41A 1QVGS 4C5HA 1YJ9T 2EGAA 2MK5A 2P4TA 3OW2S 2XG8D 1VQ7Q 4CC7A 2Z0WA 1VQKT 2HSEB 1FYNA 2EYWA 1TXQA 1H3HA 2YRDA 1VUBA 2HQEA 3QSUA 4RKUE 4C8QG 4ZGDB 1C6VX 2JMAA 4M77B 2QQ9A 4DEYA 3CCMA 4Y92A 1Z9QA 2JNGA 2L3RA 1EFNA 5FRNA 1VQ8Q 1DJ7B 3X28B 1UUEA 1ACMB 2JN0A 2C0OA 1Q7YU 3GOXA 3VRYA 1SSFA 2H3EB 3OMGA 1YITQ 2NUTB 1J3TA 5FLXE 1QVFP 3CC4A 2DL3A 4M75F 2QA4A 1W4SA 4E7SA 3QWYA 3OSSC 4OMFB 3WXMB 1HK9A 2EQIA 3OYGA 3CC2Q 4FCYA 3I55Q 3VS0A 2HL3A 4X34A 3R6OA 3S3NA 2BZ8A 3LWIA 5FW9A 4BDYA 2PNIA 5LJ3d 2VGNA 4QQGA 4BY6C 2B86A 3OYHA 2AZSA 5GAMh 2P0KA 4XTWA 1HSQA 4J6YA 4M7AF 3ULRB 1TUGB 4IUTA 2D0QB 4JRQA 5KYXA 2GFAA 3DB4A 1V76A 1Y0MA 1WJSA 4MZPA 1MMAA 3VV0A 1XQHA 1RACB 3PVLA 1RAGB 2K7AA 3FC3A 1ZSZB 5CKHA 4BDZA 2WSFE 1CKAA 3G71A 1VQMQ 1RLQC 1GRIA 1KSWA 5AT1B 2F69A 3CPFA 3E1SA 4F7UF 1G3WA 5D6XA 1YHQQ 1WHKA 2JTFA 3NTIA 4ZGEB 5IXBA 1B7TA 2FYKA 1OEBA 1YCYA 1UGQB 2ABLA 4XU0A 4D8KA 4F17A 2XHCA 3QJYA 4C8QA 2DVEA 4OGCA 3G6EA 2NUZA 1UECA 2HSPA 2X4WA 1VQ4T 5I11A 2LNHB 1X27A 3CD6Q 2CKKA 2IPOB 4L59A 1SKUB 2A3LA 3QPHA 4DA4A 3EHQA 4EDUA 4MZTA 5IHIA 3VYHB 4V2SA 1E6GA 3E9GA 2OI3A 4OMNA 3CCLA 4FYYB 3NPFA 3CMAQ 2FZGB 3TSZA 4ZTJA 2SRCA 3JB9I 2DL7A 4M7DF 3JCMd 3OYAA 2E5QA 5CKFA 4DBHA 3HTRA 1G2BA 2ECZA 3PIOA 5FU7B 3JCMX 1B3QA 3TVTA 1MMNA 4TVRA 4E2FB 2QAZA 2YUOA 3QZ5B 1M1KU 3HL8A 2V1RA 1M3BA 1X75C 2LQ8A 4C92G 4ZTFA 1BCOA 2ZPFB 5CR2A 4E7KA 1K73C 1QCFA 4DEXA 1OULA 3OYNA 1S72Q 3CXCA 3VYGA 4XQ3A 2YXYA 1R8OB 1YCSB 3RERA 2P4RA 3UWNA 4PJOB 4IKFA 1YP5A 4M78E 3VJPA 4Z8AA 1VQ7A 4BUGA 1KQSS 4M77F 4KUDK 1PM3A 2GCXA 2DNUA 3P8DA 5HK0A 3I5RA 2RD1A 3SWNB 3QYGB 3FJ5A 5HK3A 1VQ6Q 2FL7A 2COWA 3BY7A 1G5VA 2RJDA 1VQOQ 3CQTA 2D6FA 1E7OA 2IVWA 1QP3A 2QGFB 3L2WA 4PL6A 3MP6A 5J26A 1VQ8A 5J3BA 5LJ5g 2O88A 5GANj 3CCJT 4DOVA 4Z89A 2L3QA 3CCRQ 5CQXA 3OYIA 4J83A 2YUNA 4F04B 5EC7A 1BKBA 1YITA 3JCMJ 2JXBA 1CSKA 1C0MA 2X3WD 3CXCS 3FRNA 1VQLT 3A8GB 1OU8A 2CT3A 2CH4A 4II1A 1VQPQ 2OTJT 3CC2A 2O31A 4MMKA 3A8OB 4JRIA 1IGUA 3I55A 1YI2T 2K4YA 3EGDA 1ABOA 3M57A 4ZGJB 2DA9A 3EFSA 2BE9B 2YWWA 5GAN8 3EG0A 4XTYA 1EX4A 1VQMT 1AWWA 3OYFA 3JSCA 2FPDA 3VS1A 3RBBB 2VC8A 4M75D 4ESRA 1VQNT 2XD0A 2DD5A 3OYYA 5CKBA 2DZCA 3REBB 1X2QA 2KQWA 1XJWB 1UE9A 4LD6A 2E1HA 3M54A 3QYHB 4C92A 2L5QA 2GTJA 4LDWA 3QG1A 3MEVA 1FWZA 2JS2A 4X9DA 2D0NA 1S1NA 4M7AD 4UC4A 2KI7A 2FRYA 5GJWB 1VQMA 3BFMA 2PUKB 2RJCA 2GNCA 5I21A 2PVDB 2RQUA 1YHQA 1F1BB 3L2UA 5KYYA 3EG9A 2HBPA 2HMAA 2SEMA 1R0BG 1K4US 3S3OA 2AZVA 2KXDA 1H92A 2M1HA 1OZ3A 3CD6A 1T3LA 4LE9A 1ZLMA 4JS5A 4JZ4A 2DD4A 3A1PA 5LJ3g 1KIKA 2Y90A 5GAOp 1Q81R 1M2OA 1PSFA 4OB2B 3FB9A 1BIBA 4PJOG 3L2VA 1NE8A 2D1XA 2DAQA 2K3XA 3RIRA 2GQIA 2E3HA 3JB9G 1WQWA 2EYYA 3CMAA 4IIOA 1VQ5Q 1PSEA 3P8BB 4OMPA 3X25B 2WSEE 4OB3B 2FPFA 4BACA 2CZ1B 2X35A 4N4HA 3LGFA 3FIFA 2E6ZA 1B07A 3QZ9B 2KDSA 2KT1A 3EFOA 1UHCA 4FYWB 1VQOT 4FYVB 1VYVA 3L2ZA 3I56T 2LCLA 4M7DD 2HQXA 4JJCA 1D0XA 2HBWA 4BE0A 4PLIA 1TH7A 3A8MB 1AWJA 3DLMA 1BBZA 5KYUA 2AIRB 5IN1A 1S72A 3OS2A 1C1AA 1W2BP 2QG9B 4PLLA 4IUPA 4M78A 4M77C 3OBYA 4OB1B 2QXFA 1G3SA 1BB9A 3M0UA 2RHXA 1QCOA 3CCST 5M9OA 2DL4A 1QVPA 4FSSA 1N8RU 4B6MA 3VS6A 5KYXB 1U8RA 1VQ6A 3H9NA 1VQOA 1XTDA 2DIGA 2QTVA 2JZ2A 1NJIU 4RTUA 1KQ1A 1SG5A 3CCVQ 3LLRA 3H8ZA 4M77D 1Q7YR 1D1CA 2K6DA 3VUBA 1MNDA 3INZA 3V7CA 1SRMA 3JCMg 1KC8R 3OS0A 2GF7A 2EQJA 3CCRA 2RQTA 2ENMA 5CAIA 3QO3A 4PFZA 2DL8A 5GAMg 5LL6S 2BZYA 5LJ3f 1BU1A 3META 4D6WA 2VUBA 1X43A 1O9SA 1QKXA 2L8DA 4C8QB 1D1BA 1Y57A 4N0AC 2AT1B 1VQPA 4FW2A 1YBYA 1KK7A 2E3IA 4E6RA 1RI0A 2KRMA 3CCQT 4A63B 2RJFA 2MIOA 1V29B 2GTOA 4HKEA 3MEAA 2HQHA 4HVVA 1LJOA 1OU9A 5GMKe 4IUVA 1V1CA 2DTIA 4OVAA 2MPXC 1G3YA 3M56A 1OV3A 4RUGA 1KFZA 1WA7A 4DOWA 1MUZA 2FG0A 2YLBA 3EG3A 2LQKA 2ZPGB 1JO8A 1YIJT 2O4XA 1KC8C 2BUDA 2VASA 1Q82U 4JJBA 3I5SA 1WI7A 2C0TA 1QVGA 2JTMA 4OGEA 2NUPA 1FXXA 1RAEB 1VQ9Q 5GANd 3C95A 3RNJA 2GGRA 2QQRA 1IHVA 1YWOA 2CGHA 2CP0A 4M75E 3CCET 4C5IA 3EHRA 2KYBA 1UEBA 3V8LA 2V1QA 5LJ5d 3EG2A 5FU7C 2RHZA 1Y07A 2L89A 4EMGA 5KH6A 2CP5A 3FLGA 5DY9A 1VQ5A 3GP8A 3OB9A 4YTLA 1BIAA 2RI5A 4KBMB 4M7AE 1I5LA 2JM8A 3EAEA 1AT1B 1M1KR 3QXEB 1OZ2A 2DFUA 3PIPA 3CMEQ 1ZUUA 3JCMP 3H6ZA 1Y96A 3CCMT 3HFOA 1SPKA 3PE0A 2XK0A 1TS9A 5GAN7 4IUUA 4MDXA 2QASA 3QKJA 4JDSA 3RMQA 2GFUA 4E7LA 2K2MA 2X3XD 4QVCA 3SWNC 2YUPA 3EGDB 1AVZC 3REAB 3EH1A 1PG5B 2LT4A 3DLLA 4F7UE 1PD0A 4O5VA 4BI3A 3QBYA 2P0PA 4BB7A 2VWFA 1H8KA 3URGA 2X4YA 3CC4T 3JRZA 5L23A 2BKDN 2QA4T 3HRTA 4RG2A 1YJNQ 3GNFB 1E6HA 2EGEA 2QDYB 4C92B 3X24B 5A0GA 2CSIA 2DIQA 5DLQE 3G4SQ 1OX9A 2H3JA 1D0ZA 3OSVA 3ER0A 5GAOq 1RADB 3CCVA 2R5AA 1QWFA 2DILA 4LUDA 4M75G 1X6BA 4LNPA 2DYIA 1K0XA 5GMKh 3JV3A 2AKLA 2J6OA 1UGPB 5KYYB 3EG9B 1M1KC 1M90U 5IAYA 5D6YA 4M7DE 2QQSA 3X20B 1I5OB 4C0DB 5IXFA 1QKWA 3CBPA 3QWXX 2KAFA 3G71T 2DPPB 4J9IA 4OMLA 2G6FX 3BDLA 2DLPA 2JUFA 1PNJA 1HXDA 2PQWA 3ZBDA 2RMOA 2A08A 1K9MU 3G6ET 4RTTA 2GQVA 3M0PA 2RK1A 4LDYA 4AG2C 1TUCA 5GAOm 3NFCA 2PUOB 3G7ZA 4BD3A 3EH2A 4F7UG 1RL2A 3RDVA 1WIEA 4M77E 2KR3A 2QEXQ 2K3BA 2FRWA 1PWTA 3CCLT 4MMLA 4WTOB 1MNEA 3N5BB 3EGUA 4EMKC 4KRTA 2OAUA 3EFOB 5FWBA 5CKEA 3J81E 3S3MA 5KE3A 4GBQA 1TOVA 2AKKA 4J9GA 2DBMA 4J5YA 5KYUB 3JCMV 1ZA2B 1I1JA 1KD1U 1TSFA 1SSHA 2HNIA 2KE9A 1MMDA 2EJ9A 3CC7Q 2K2VA 1IREB 2HKQB 4KGZB 2EKHA 4JJDA 3QDFA 1VQ9A 2DXTA 4JRKA 4M78B 4AFUC 2LCSA 1KQSA 1AD5A 1ABQA 3SFMA 3PT9A 2RNAA 4M7DG 1EIFA 1NPRA 4XTUA 3VS5A 4M75A 2OJ2A 2RO0A 1VIEA 5EG2A 5FU6B 3UA7A 1RAAB 4R55A 3VS7A 2KT8A 1RAFB 2EQMA 3TQ7P 1MGQA 1ZA1B 1VQ7T 1I4K1 2RJEA 4IUQA 3CPWS 5GAMd 3OA6A 1WXTA 4M7AA 3QHSA 1ZSGA 1BI3A 4HXJA 4HVUA 4PFOA 1RI9A 1JJ2P 1N9RA 3HSBA 2A36A 4JUVA 4FW1A 2V26A 3CMEA 2OTLA 1X2KA 2KK4A 5KCOA 2CZ6B 4X9CA 2EGCA 2E10A 5CIUA 1VQ8T 1Q86R 3GF5A 3OYDA 3HRUA 3OYLA 3A8LB 2JTEA 2JT4A 3OBWA 1FMWA 1WHLA 1M27C 2EJGA 1T3SA 5FRMA 3UDCA 1MV0B 5FWCA 3SD4A 4QQ6A 1YITT 1KQ2A 4F7UA 2IG0A 5GANg 1JQQA 4C92F 2K79A 1N8RR 1QVFA 4OB0B 2C06A 1OX8A 2ATCB 1YJNA 3CC2T 3H41A 1NJIR 3I55T 2X4XA 2VKNA 2YDLA 1ZUYA 3L42A 1GCQA 2E64A 3G4SA 2XICA 4P5NA 3M9QA 5A0DA 4AFQC 4NL3A 3H0HA 3KXTA 4GLMA 3V7RA 1LVKA 1D09B 4JS4A 2L2PA 4C8QC 4AT1B 3MEUA 2O4XB 1BI2A 4J8OA 1JEGA 4M7DA 1LNXA 4LUEA 3O8VA 4LDUA 1YJWQ 2NUPB 2DL5A 1D0YA 1NBEB 4IURA 2DTHA 4NL2A 3HP9A 1UHFA 1Q86C 1GXIE 2IIMA 1JBMA 2FZKB 4RTXA 1QVFS 2RHIA 1YHQT 1ZX6A 4KGXB 2DXBA 1NEBA 4JLGA 4QVDA 2EQUA 5IHKA 4HCKA 2BIVA 4FIBA 4M78G 2QTXA 1I81A 2CDTA 3CD6T 1M8MA 1GBRA 1YWPA 1NLOC 2KBTA 3M0RA 2QEXA 3L1AA 5ECAA 4JRPA 2LX7A 2RN8A 1RABB 1K76A 2HL5C 1Y96B 4HVWA 3MHXA 3T9NA 3CMAT 3VUZA 3RESA 5GANf 1Q82R 1Q95G 2EYZA 1K73U 3GIBA 2RA2A 1KG1A 2WACA 4BE2A 4CC3A 1M3AA 5CQYA 3CC7A 4QQDA 3PVQA 5LJ5f 3OYKA 4J9CA 2KMTA 1UGSB 4LD9K 2KXCA 1ZBJA 1JU5C 1MV3A 1G83A 3NHNA 4HCBA 1D3BA 2F5KA 1HD3A 3OQ5A 3OYJA 2F2XA 1S72T 2RM4A 2DVJA 5AYFA 4C0FA 4DBQA 1TWBA 2MMPA 2V8KA 1IB8A 2JS0A 2M0YA 1QQJA 3OS5A 1BI1A 2A0FB 2FHDA 3LH5A 1M9SA 3X26B 3VU3C 4WCIA 1VQ6T 2M16A 2CS7A 4PJOF 4C0GA 1QVGP 3ME9A 3JB9F 2W10A 2J05A 4CC2A 4ZN3A 3OW2P 4JZ3A 5GAOl 2E65A 4J9FA 3CCUQ 3PGGA 5CO7A 1OPKA 2EAYA 3QIIA 2HEQA 2FZCB 3CCRT 1WJQA 5J39A 1QLYA 2X51A 3A5ZB 4RG8A 4C92C 1G3TA 1Z9ZA 1PKTA 1WGSA 2M0OA 1P92A 2EYQA 1Q81C 3HHTB 3SB2A 1VQPT 1UGRB 2Y4YA 1N9SA 2VB6A 3BDUA 2OX7A 1YJWT 3NMZC 5KYWA 1GFDA 2DX1A 1MMGA 5LJ3e 1XNIA 1PC0A 1KHCA 2EBPA 4KT0E 4C92D 2D8JA 1K1ZA 5GMKj 2CZ7B 1VYTA 4QT7A 4C0DC 2B8AA 1OYXA 2I0NA 4PNOA 4D8DA 1YJ9Q 2PVOB 1M90R 4KH1B 3TSWA 4KULA 2JJ9A 4J9EA 1VQKQ 4CRIA 4R0KA 4XTZA 2R5MA 1SHGA 4RCBA 1AHJB 3TU4K 1GBQA 2G3RA 2DK3A 3A98A 1VIFA 1LOJA 1KHIA 1YJWA 2HAXA 2J7IA 2QQBA 1YN8A 3TEEA 3LX7A 2AK5A 1QCNA 3FDRA 1UG1A 4DBRA 5GAN3 3I35A 1KJWA 2BE7D 1WQ7A 4A4KA 4M75B 4Z02A 4ELYC 3JB9H 1X6OA 1ZSZC 3NGPA 2ED0A 3EGXA 3RMSA 4A54A 2KEAA 4C0ZA 4HT8A 3ZEHA 4E7JA 4DBFA 3E19A 1WJRA 4AFSC 2LRQA 3OYBA 1R77A 2BTTA 4B9XA 5GAN5 4M7AB 4EMHA 1Q7YC 2YLCA 1PKSA 3LH0A 1WLPB 1BI0A 1ZUKA 5D6WA 4NOYA 2KNBB 3LGLA 1VQ5T 1RLPC 2HCKA 2EVRA 1GL5A 1OPLA 4EIKA 4FT2A 3F70A 4E47A 3A8HB 1VYUA 3IQLA 3NTKA 3JCMQ 5FU6C 3OYMA 1I07A 2EPDA 2DM1A 4F7UB 2O01E 2RHUA 3CEYA 3JCMf 3J80E 2MCNA 2O2OA 3L2RA 4KGVB 2Y4XA 2J6KA 4XU1A 5GAMf 1X01A 3RKYA 1BYMA 2E12A 4DQ2A 3OS1A 1A0NB 1PRMC 3LYIA 2A37A 7AT1B 3WVDB 4BI8B 2L3PA 4JLIA 2NWMA 2YRCA 2DTOA 2DXUA 4KUIA 4F14A 2OTLQ 1M8VA 2LVMA 3UA6A 3VS3A 2ZPEB 4QVZA 3GPLA 1VQ4Q 5LJ3h 4PJOC 4OP0A 2PTKA 3M58A 5GMKm 3JB9J 4LXCA 4B9WA 4ZNXA 3ZL7C 4M7DB 2DE0X 3CCVT 4R56A 5C6SA 2P0QA 1KQSP 2YT6A 3CCUA 3KFVA 4LDXA 3P8HA 1YNZA 1R0CB 1U1TA 1TUDA 4PJOD 4J9DA 4EMKA 1PD1A 2PZ1A 3CBOA 2QGGA 3Q1JA 3JB9D 2COYA 5DLOA 2LP5A 1JXOA 1XOVA 3QUIA 3U23A 1W2BS 2QK0A 1M2VA 1U1SA 3RKXA 2QQAA 3M0TA 4FL6A 2EW3A 2L0AA 2RQWA 3GBQA 1WX6A 2M02A 1UFFA 2JMCA
chains in the Genus database with same CATH topology
2DYBA 1X2KA 1UGVA 2CSQA 1U06A 2EGCA 1W1FA 3I9QA 1UTIA 1T3LA 4LE9A 1ZLMA 1HJDA 4JZ4A 2JTEA 1KIKA 2JT4A 2A28A 1M27C 1T3SA 2DRMA 2XMFA 4AG1C 1MV0B 1H92A 5FWCA 3H0IA 4RTYA 1QWEA 2D1XA 2GQIA 4F16A 1JQQA 2EYYA 2K79A 4IIOA 2DMOA 4OMPA 2HDAA 3VS4A 2FPFA 1SHFA 3H41A 2RPNA 2DF6A 1AWXA 3UATA 1B07A 1K9AA 2L3SA 2VKNA 2YDLA 1ZUYA 1GCQA 4IIMA 3VRZA 2KT1A 4AFQC 1UHCA 2JM9A 1VYVA 2J06A 3H0HA 2F2VA 4GLMA 1X6GA 4JJCA 2FO0A 2HBWA 1T0JA 1W6XA 2L2PA 1AWJA 2KRSA 1BBZA 1UDLA 2D8HA 2RQVA 1T0HA 2CREA 1VA7A 4RTVA 2MOXA 2BZXA 1IO6A 4J9BA 1M30A 1LCKA 1JEGA 4LUEA 2ESWA 1BB9A 3M0UA 2DL5A 1N5ZA 4RTWA 2DL4A 2LJ3A 1WFWA 4FSSA 1UHFA 3VS6A 1WXUA 2IIMA 3SHWA 4RTXA 1TG0A 1ZX6A 1NEBA 4RTUA 4ORZA 1AOJA 1U5SA 2LQNA 5HCKA 2K6DA 3EG1A 5IHKA 4HCKA 1SRMA 2C0IA 3THKA 2CDTA 1AZGB 1M8MA 1GBRA 1YWPA 2ENMA 2FPEA 2RQTA 2M51A 2DL8A 4LN2A 4M4ZA 1NLOC 5GJVB 2KBTA 2EGAA 3M0RA 2BZYA 2RQRA 5ECAA 1BU1A 2LX7A 2RF0A 2RN8A 4CC7A 1X43A 1QKXA 3M0QA 1FYNA 2EYWA 1K76A 4HVWA 1Y57A 1H3HA 2O9SA 1NYFA 4E6RA 2EYZA 2KRMA 2JMAA 1CKBA 3R6NA 4A63B 4DEYA 2MIOA 4Y92A 2ED1A 1Z9QA 4CC3A 1EFNA 1M3AA 1RUWA 1UUEA 3PVQA 2GTOA 2C0OA 1UJ0A 1K0SA 4J9CA 4HVVA 2KXCA 1ZBJA 1JU5C 1MV3A 1G83A 3NHNA 3VRYA 2F2WA 1HD3A 2F2XA 1J3TA 1V1CA 2DVJA 2DL3A 1NLPC 1OV3A 4RUGA 2ROLA 1KFZA 1WA7A 2E5KA 3QWYA 4X1VA 2JS0A 3C0CA 2EQIA 1MUZA 2M0YA 3VS0A 2FG0A 3UF4A 3EG3A 2BZ8A 2LQWA 5FW9A 1JO8A 3LH5A 2PNIA 4WCIA 2B86A 2AZSA 4JJBA 3I5SA 1HSQA 1WI7A 2C0TA 3ULRB 2W10A 2J05A 4CC2A 3RNJA 4JZ3A 2GGRA 1ARKA 4J9FA 1Y0MA 1OPKA 1YWOA 2HEQA 3PVLA 3EHRA 2KYBA 1QLYA 2V1QA 2K7AA 4AFZC 4CC4B 2CUBA 1X69A 3EG2A 1JXMA 1CKAA 1Z9ZA 4OMOA 1RLQC 1GRIA 1KSWA 1PKTA 2LJ1A 2ROTA 1FMKA 2KGTA 5IXBA 3VS2A 2JM8A 1OEBA 1AWOA 2LJ0A 2ABLA 1SRLA 3NMZC 1GFDA 2W0ZA 2DX1A 4D8KA 4F17A 1ZUUA 1NEGA 2NUZA 1UECA 2HSPA 2EBPA 3PE0A 1SPKA 2D8JA 5I11A 2LNHB 2YUQA 1X27A 1K1ZA 3M0SA 1VYTA 4QT7A 1M3CA 3EHQA 2EYXA 2DJQA 2I0NA 2QDLA 4D8DA 2K2MA 2X3XD 2YUPA 4RTZA 5IHIA 3TSWA 1W70A 1AVZC 3REAB 1E6GA 4J9EA 4R0KA 2OI3A 4OMNA 1SHGA 2CUDA 1GBQA 3NPFA 2VWFA 1H8KA 3A98A 3TSZA 5L23A 2SRCA 2DL7A 2J7IA 1YN8A 2KRNA 1G2BA 1E6HA 2EGEA 2ECZA 1SEMA 2AK5A 1NYGA 2CSIA 3H0FA 1B3QA 1UG1A 3TVTA 1AEYA 2YSQA 3I35A 2YUOA 1KJWA 2GBQA 2V1RA 2ED0A 1M3BA 3NGPA 2KEAA 1QWFA 2FEIA 2DILA 4LUDA 1QCFA 1X6BA 2CH4W 4LNPA 4AFSC 4DEXA 1K0XA 2BTTA 1GCQC 3JV3A 1YCSB 2AKLA 4JPBW 2J6OA 1OOTA 2P4RA 1PKSA 1YP5A 1WLPB 4Z8AA 1AZEA 5IXFA 1QKWA 3QWXX 2DNUA 1ZUKA 3O5ZA 3I5RA 2KNBB 4OMMA 4J9IA 4OMLA 3FJ5A 2G6FX 1RLPC 2HCKA 2EVRA 2DLPA 1GL5A 3CQTA 1E7OA 1PNJA 4OMQA 1NM7A 1OPLA 4EIKA 4K11A 2RMOA 1VYUA 2A08A 1WYXA 3IQLA 2O88A 4J9HA 1I07A 2EPDA 3M0PA 4RTTA 2DM1A 1BK2A 2DRKA 1GCPA 4Z89A 4AG2C 2L3QA 1TUCA 4Z88A 2JW4A 2MCNA 2O2OA 2YUNA 1I0CA 1PRLC 1WIEA 5EC7A 2KR3A 2K3BA 2J6KA 2FRWA 2JXBA 2O9VA 1CSKA 1PWTA 2X3WD 1A0NB 2CT4A 3EGUA 1U3OA 2CT3A 1PRMC 2CH4A 5IH2A 2A37A 4KRTA 2O31A 5FWBA 2L3PA 2NWMA 1ABOA 2DA9A 1NG2A 3EG0A 4GBQA 2AKKA 4J9GA 1AWWA 4F14A 2DBMA 1PHTA 2FPDA 3UA6A 3VS3A 1I1JA 3VS1A 3RBBB 1SSHA 2PTKA 2OAWA 2KE9A 4ESRA 2EKHA 4JJDA 3SEMA 3REBB 1X2QA 4ZNXA 2J6FA 3ZL7C 4AFUC 2DE0X 1WXBA 2VVKA 2LCSA 1UJYA 1AD5A 2YT6A 1ABQA 1UE9A 3KFVA 2GTJA 2RNAA 1YNZA 5I22A 3VS5A 2JS2A 2OJ2A 1TUDA 2D0NA 2H8HA 1S1NA 3UA7A 4J9DA 3VS7A 2PZ1A 2KT8A 1GFCA 2FRYA 2K9GA 5GJWB 2LP5A 2LMJA 1JXOA 2KYMA 1XOVA 2GNCA 2KROA 2RQUA 3U23A 1WXTA 5IHNA 2SEMA 1WDXA 1ZSGA 4HXJA 4HVUA 1K4US 2LZ6B 1RI9A 3M0TA 2A36A 2AZVA 2EW3A 2L0AA 2RQWA 2DBKA 3GBQA 2KXDA 1WX6A 1UFFA 2JMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYB A;  1X2K A;  1UGV A;  2CSQ A;  1U06 A;  2EGC A;  1W1F A;  3I9Q A;  1UTI A;  1T3L A;  4LE9 A;  1ZLM A;  1HJD A;  4JZ4 A;  2JTE A;  1KIK A;  2JT4 A;  2A28 A;  1M27 C;  1T3S A;  2DRM A;  2XMF A;  4AG1 C;  1MV0 B;  1H92 A;  5FWC A;  3H0I A;  4RTY A;  1QWE A;  2D1X A;  2GQI A;  4F16 A;  1JQQ A;  2EYY A;  2K79 A;  4IIO A;  2DMO A;  4OMP A;  2HDA A;  3VS4 A;  2FPF A;  1SHF A;  3H41 A;  2RPN A;  2DF6 A;  1AWX A;  3UAT A;  1B07 A;  1K9A A;  2L3S A;  2VKN A;  2YDL A;  1ZUY A;  1GCQ A;  4IIM A;  3VRZ A;  2KT1 A;  4AFQ C;  1UHC A;  2JM9 A;  1VYV A;  2J06 A;  3H0H A;  2F2V A;  4GLM A;  1X6G A;  4JJC A;  2FO0 A;  2HBW A;  1T0J A;  1W6X A;  2L2P A;  1AWJ A;  2KRS A;  1BBZ A;  1UDL A;  2D8H A;  2RQV A;  1T0H A;  2CRE A;  1VA7 A;  4RTV A;  2MOX A;  2BZX A;  1IO6 A;  4J9B A;  1M30 A;  1LCK A;  1JEG A;  4LUE A;  2ESW A;  1BB9 A;  3M0U A;  2DL5 A;  1N5Z A;  4RTW A;  2DL4 A;  2LJ3 A;  1WFW A;  4FSS A;  1UHF A;  3VS6 A;  1WXU A;  2IIM A;  3SHW A;  4RTX A;  1TG0 A;  1ZX6 A;  1NEB A;  4RTU A;  4ORZ A;  1AOJ A;  1U5S A;  2LQN A;  5HCK A;  2K6D A;  3EG1 A;  5IHK A;  4HCK A;  1SRM A;  2C0I A;  3THK A;  2CDT A;  1AZG B;  1M8M A;  1GBR A;  1YWP A;  2ENM A;  2FPE A;  2RQT A;  2M51 A;  2DL8 A;  4LN2 A;  4M4Z A;  1NLO C;  5GJV B;  2KBT A;  2EGA A;  3M0R A;  2BZY A;  2RQR A;  5ECA A;  1BU1 A;  2LX7 A;  2RF0 A;  2RN8 A;  4CC7 A;  1X43 A;  1QKX A;  3M0Q A;  1FYN A;  2EYW A;  1K76 A;  4HVW A;  1Y57 A;  1H3H A;  2O9S A;  1NYF A;  4E6R A;  2EYZ A;  2KRM A;  2JMA A;  1CKB A;  3R6N A;  4A63 B;  4DEY A;  2MIO A;  4Y92 A;  2ED1 A;  1Z9Q A;  4CC3 A;  1EFN A;  1M3A A;  1RUW A;  1UUE A;  3PVQ A;  2GTO A;  2C0O A;  1UJ0 A;  1K0S A;  4J9C A;  4HVV A;  2KXC A;  1ZBJ A;  1JU5 C;  1MV3 A;  1G83 A;  3NHN A;  3VRY A;  2F2W A;  1HD3 A;  2F2X A;  1J3T A;  1V1C A;  2DVJ A;  2DL3 A;  1NLP C;  1OV3 A;  4RUG A;  2ROL A;  1KFZ A;  1WA7 A;  2E5K A;  3QWY A;  4X1V A;  2JS0 A;  3C0C A;  2EQI A;  1MUZ A;  2M0Y A;  3VS0 A;  2FG0 A;  3UF4 A;  3EG3 A;  2BZ8 A;  2LQW A;  5FW9 A;  1JO8 A;  3LH5 A;  2PNI A;  4WCI A;  2B86 A;  2AZS A;  4JJB A;  3I5S A;  1HSQ A;  1WI7 A;  2C0T A;  3ULR B;  2W10 A;  2J05 A;  4CC2 A;  3RNJ A;  4JZ3 A;  2GGR A;  1ARK A;  4J9F A;  1Y0M A;  1OPK A;  1YWO A;  2HEQ A;  3PVL A;  3EHR A;  2KYB A;  1QLY A;  2V1Q A;  2K7A A;  4AFZ C;  4CC4 B;  2CUB A;  1X69 A;  3EG2 A;  1JXM A;  1CKA A;  1Z9Z A;  4OMO A;  1RLQ C;  1GRI A;  1KSW A;  1PKT A;  2LJ1 A;  2ROT A;  1FMK A;  2KGT A;  5IXB A;  3VS2 A;  2JM8 A;  1OEB A;  1AWO A;  2LJ0 A;  2ABL A;  1SRL A;  3NMZ C;  1GFD A;  2W0Z A;  2DX1 A;  4D8K A;  4F17 A;  1ZUU A;  1NEG A;  2NUZ A;  1UEC A;  2HSP A;  2EBP A;  3PE0 A;  1SPK A;  2D8J A;  5I11 A;  2LNH B;  2YUQ A;  1X27 A;  1K1Z A;  3M0S A;  1VYT A;  4QT7 A;  1M3C A;  3EHQ A;  2EYX A;  2DJQ A;  2I0N A;  2QDL A;  4D8D A;  2K2M A;  2X3X D;  2YUP A;  4RTZ A;  5IHI A;  3TSW A;  1W70 A;  1AVZ C;  3REA B;  1E6G A;  4J9E A;  4R0K A;  2OI3 A;  4OMN A;  1SHG A;  2CUD A;  1GBQ A;  3NPF A;  2VWF A;  1H8K A;  3A98 A;  3TSZ A;  5L23 A;  2SRC A;  2DL7 A;  2J7I A;  1YN8 A;  2KRN A;  1G2B A;  1E6H A;  2EGE A;  2ECZ A;  1SEM A;  2AK5 A;  1NYG A;  2CSI A;  3H0F A;  1B3Q A;  1UG1 A;  3TVT A;  1AEY A;  2YSQ A;  3I35 A;  2YUO A;  1KJW A;  2GBQ A;  2V1R A;  2ED0 A;  1M3B A;  3NGP A;  2KEA A;  1QWF A;  2FEI A;  2DIL A;  4LUD A;  1QCF A;  1X6B A;  2CH4 W;  4LNP A;  4AFS C;  4DEX A;  1K0X A;  2BTT A;  1GCQ C;  3JV3 A;  1YCS B;  2AKL A;  4JPB W;  2J6O A;  1OOT A;  2P4R A;  1PKS A;  1YP5 A;  1WLP B;  4Z8A A;  1AZE A;  5IXF A;  1QKW A;  3QWX X;  2DNU A;  1ZUK A;  3O5Z A;  3I5R A;  2KNB B;  4OMM A;  4J9I A;  4OML A;  3FJ5 A;  2G6F X;  1RLP C;  2HCK A;  2EVR A;  2DLP A;  1GL5 A;  3CQT A;  1E7O A;  1PNJ A;  4OMQ A;  1NM7 A;  1OPL A;  4EIK A;  4K11 A;  2RMO A;  1VYU A;  2A08 A;  1WYX A;  3IQL A;  2O88 A;  4J9H A;  1I07 A;  2EPD A;  3M0P A;  4RTT A;  2DM1 A;  1BK2 A;  2DRK A;  1GCP A;  4Z89 A;  4AG2 C;  2L3Q A;  1TUC A;  4Z88 A;  2JW4 A;  2MCN A;  2O2O A;  2YUN A;  1I0C A;  1PRL C;  1WIE A;  5EC7 A;  2KR3 A;  2K3B A;  2J6K A;  2FRW A;  2JXB A;  2O9V A;  1CSK A;  1PWT A;  2X3W D;  1A0N B;  2CT4 A;  3EGU A;  1U3O A;  2CT3 A;  1PRM C;  2CH4 A;  5IH2 A;  2A37 A;  4KRT A;  2O31 A;  5FWB A;  2L3P A;  2NWM A;  1ABO A;  2DA9 A;  1NG2 A;  3EG0 A;  4GBQ A;  2AKK A;  4J9G A;  1AWW A;  4F14 A;  2DBM A;  1PHT A;  2FPD A;  3UA6 A;  3VS3 A;  1I1J A;  3VS1 A;  3RBB B;  1SSH A;  2PTK A;  2OAW A;  2KE9 A;  4ESR A;  2EKH A;  4JJD A;  3SEM A;  3REB B;  1X2Q A;  4ZNX A;  2J6F A;  3ZL7 C;  4AFU C;  2DE0 X;  1WXB A;  2VVK A;  2LCS A;  1UJY A;  1AD5 A;  2YT6 A;  1ABQ A;  1UE9 A;  3KFV A;  2GTJ A;  2RNA A;  1YNZ A;  5I22 A;  3VS5 A;  2JS2 A;  2OJ2 A;  1TUD A;  2D0N A;  2H8H A;  1S1N A;  3UA7 A;  4J9D A;  3VS7 A;  2PZ1 A;  2KT8 A;  1GFC A;  2FRY A;  2K9G A;  5GJW B;  2LP5 A;  2LMJ A;  1JXO A;  2KYM A;  1XOV A;  2GNC A;  2KRO A;  2RQU A;  3U23 A;  1WXT A;  5IHN A;  2SEM A;  1WDX A;  1ZSG A;  4HXJ A;  4HVU A;  1K4U S;  2LZ6 B;  1RI9 A;  3M0T A;  2A36 A;  2AZV A;  2EW3 A;  2L0A A;  2RQW A;  2DBK A;  3GBQ A;  2KXD A;  1WX6 A;  1UFF A;  2JMC A; 
#chains in the Genus database with same CATH topology
 1UB4 A;  4C8Q F;  3CXC P;  1U06 A;  1WZO A;  2A28 A;  5C0M A;  1YJ9 A;  4ZN1 A;  3GNG A;  2CP3 A;  3SDZ A;  3RUX A;  4M7A G;  1VQK A;  3V7S A;  1KC8 U;  2NLU A;  1QWE A;  2I2L A;  2X4J A;  3DB3 A;  3KUF A;  5CK9 A;  2DMO A;  2HDA A;  5GAN 6;  1B34 A;  3JCM h;  2DF6 A;  3UAT A;  1D3B B;  4FT4 A;  4PFP A;  2L3S A;  4A4E A;  4XAX B;  4XTV A;  4IIM A;  4XK8 E;  3CCJ Q;  2RI3 A;  4E7I A;  3VRZ A;  3MCA B;  1O75 A;  4C5E A;  2VV5 A;  3EFR A;  1M5Q 1;  2MYS A;  1IGQ A;  2F2V A;  1X6G A;  1YFN A;  1IHW A;  2FO0 A;  1VQ9 T;  2DKG A;  3L2Q A;  1W6X A;  1UDL A;  3HRS A;  3CPW A;  4C5G A;  4C92 E;  2K5F A;  2EKO A;  1VQL Q;  4JJN K;  4J9B A;  1M30 A;  4PKC C;  2CP6 A;  2QYZ A;  1ZHI A;  2OTJ Q;  2HD0 A;  4CI0 C;  1YI2 Q;  4A4F A;  4EPC A;  4RTW A;  4N4I A;  1K73 R;  4QW2 A;  1K8A U;  1JRI A;  3MO8 A;  2K57 A;  1VQN Q;  2XKO C;  4ORZ A;  1AOJ A;  5HCK A;  3EG1 A;  3V8K A;  2ZCF B;  2LNV A;  3RKW A;  3CME T;  1IZ6 A;  2DO3 A;  3THK A;  2OTL T;  3C12 A;  2DZ9 A;  1AZG B;  2HKN A;  4OF1 A;  2FPE A;  2M51 A;  2M9U A;  4LN2 A;  4M4Z A;  1M4Z A;  5GJV B;  2CYZ B;  2RQR A;  2RF0 A;  5KYW B;  3M0Q A;  2P84 A;  3DKM A;  5CKD A;  4HCC A;  2O9S A;  5HY6 A;  1NYF A;  2YHT A;  4QKU A;  1CKB A;  3R6N A;  1YJN T;  2LTO A;  2ED1 A;  2CP2 A;  1VQ4 A;  2D9T A;  2ZAE A;  4M77 G;  2VXE A;  1NPP A;  3HKS A;  1RUW A;  3G4S T;  1QP2 A;  5GAN 2;  2LCC A;  1UJ0 A;  1K0S A;  2DJZ A;  2F2W A;  2EWN A;  2A7Y A;  1ZQ1 A;  4L6V 5;  3MP1 A;  2ZPB B;  2V8J A;  3JCM W;  1NLP C;  2ROL A;  3UT1 A;  1M1F A;  2E5K A;  2EIF A;  4X1V A;  3C0C A;  3EGX B;  5I2S A;  3BW1 A;  3UF4 A;  4A4G A;  2LQW A;  4MZM A;  2XID A;  1JB0 E;  1IXD A;  3VKI A;  3J7A F;  4LDV A;  3I56 Q;  2RHY A;  1ARK A;  1OQK A;  3OYC A;  2ZGW A;  4AFZ C;  4CC4 B;  2CUB A;  3CCS Q;  1X69 A;  1Y7X A;  1JXM A;  2QEX T;  3PTA A;  4OMO A;  2HZY A;  3QJ6 A;  4WF2 A;  2LJ1 A;  4C8Q D;  5LJ5 j;  2ROT A;  4M75 C;  4FSX A;  4BE1 A;  5HKC A;  3M5A A;  1FMK A;  4PJO E;  2KGT A;  3VS2 A;  2LX9 A;  2MF2 A;  1AWO A;  2K5L A;  2LJ0 A;  2F1L A;  1SRL A;  1WHG A;  2W0Z A;  3GLX A;  2E6N A;  4ME7 A;  1NEG A;  5GMK l;  3UPU A;  4L5G A;  1N8R C;  3CCJ A;  1VOM A;  2YUQ A;  2MI6 A;  2DEU A;  4M7A C;  2XI9 A;  2XDD A;  3CC7 T;  3M0S A;  4BY6 B;  2E4H A;  4VUB A;  1M3C A;  1NJI C;  1G8X A;  5GAN e;  4M77 A;  2EYX A;  2DJQ A;  4FYX B;  2QDL A;  2KSS A;  4O6J A;  1D1A A;  4RTZ A;  2YRV A;  1W70 A;  3MP8 A;  1VQL A;  2CUD A;  2LC4 A;  2OTJ A;  2XDP A;  5LJ5 e;  3D7S B;  4HA8 A;  1YI2 A;  4M78 F;  3CCQ Q;  1NZ9 A;  2KRN A;  2NUT A;  1TTH B;  1SEM A;  1NYG A;  3H0F A;  1AEY A;  3TRE A;  2YSQ A;  4RMO A;  2NYS A;  4NS5 A;  1VQN A;  3LWH A;  2GBQ A;  1RAI B;  1JJ2 A;  2FEI A;  4EMK B;  4Y91 A;  2RI2 A;  3WVE B;  2CH4 W;  1HYO A;  4J7I A;  3JCM c;  8AT1 B;  1WHM A;  3HPW A;  4XU3 A;  1H64 1;  1GCQ C;  4J6X A;  4N0A A;  2MAM A;  4JPB W;  2XU8 A;  3NTH A;  1OOT A;  3OY9 A;  3V8J A;  4PK4 A;  2VGM A;  1M2V B;  5CCA A;  5KE2 A;  2KVQ G;  1AZE A;  2X9H A;  2EQK A;  3FEO A;  5GMK i;  2RB6 A;  1YIJ Q;  3O5Z A;  3OYE A;  4FM4 B;  2PVG B;  5I2M A;  1FMV A;  4OMM A;  4M7D C;  5LJ3 j;  4OMQ A;  2R58 A;  4HCZ A;  4HT9 A;  1NM7 A;  2ZPI B;  5GAO r;  3KBG A;  1ZSZ A;  4K11 A;  3M4Y A;  8ATC B;  1WYX A;  4E7H A;  4J9H A;  1BK2 A;  1QW1 A;  2DRK A;  2LDM A;  1Q82 C;  2FVU A;  1GCP A;  3CCE Q;  4Z88 A;  2JW4 A;  4AMC A;  1JJ2 S;  1QMC A;  1I0C A;  1PRL C;  1WNL A;  4J6W A;  1B34 B;  2O9V A;  3M59 A;  4PJL A;  1Q86 U;  3LW5 E;  2CZ0 B;  3PNW C;  3ZFJ A;  2CT4 A;  1I8F A;  4A4H A;  4PJM A;  1U3O A;  4RCC A;  3JAM E;  5IH2 A;  4PJJ A;  2DET A;  2EFI A;  1NG2 A;  4BI4 A;  3PMI A;  1PHT A;  3CCM Q;  5FRO A;  1SF9 A;  1BCM A;  3OMC A;  2K3Y A;  2CP7 A;  1H3Z A;  3C4S A;  2OAW A;  2JOY A;  3I56 A;  5A2Q E;  3SEM A;  3AHU A;  2J6F A;  1WXB A;  2VVK A;  1UJY A;  5GAN h;  3C94 A;  2VXF A;  5I22 A;  1IRX A;  2H8H A;  3CC4 Q;  4Q5W A;  4ELZ C;  3JCM b;  4GLK A;  3CCS A;  2QA4 Q;  1GFC A;  2K9G A;  5LJ5 h;  3G1J A;  3FJP A;  4J7F A;  2LMJ A;  2KYM A;  1RAH B;  2MWO A;  9ATC B;  2ZPH B;  2E70 A;  2JVV A;  1K9M R;  2COZ A;  2KRO A;  2K5I A;  5CVI A;  2EJF A;  2MWP A;  4PJO A;  5IHN A;  1WDX A;  1N27 A;  3ASK A;  2LZ6 B;  5GAM j;  5IT9 E;  2DBK A;  2FB7 A;  2WSC E;  2VYT A;  3SWN A;  2DYB A;  3PMT A;  1UGV A;  4E7Z A;  2CSQ A;  1W1F A;  1WHJ A;  3I9Q A;  3M4G A;  1UTI A;  1OI1 A;  2RH2 A;  1HJD A;  3AT1 B;  3MEW A;  4ANJ A;  4KH0 B;  2DRM A;  2XMF A;  3MJX A;  4AG1 C;  3H0I A;  5KYN A;  3RR6 A;  4RTY A;  5A0L A;  3G71 Q;  3CBM A;  3BE3 A;  4F16 A;  2LT1 A;  5GAO n;  1WPY A;  1KD1 R;  4M78 C;  3QDR B;  1Y71 A;  1K8A R;  3JCM e;  1M90 C;  3VS4 A;  3CCQ A;  1SHF A;  2DXC A;  2F5T X;  5DM7 R;  2RPN A;  4A53 A;  1AWX A;  1TU0 B;  1LPL A;  5GAM e;  1K9A A;  4C8Q E;  3G6E Q;  5D7U A;  3MPU B;  3PFS A;  2KY9 A;  2JM9 A;  1N6A A;  2J06 A;  4M78 D;  3S6W A;  4XTX A;  2DER A;  3M53 A;  6AT1 B;  4FU6 A;  4Y28 E;  1T0J A;  2DEQ A;  3OW2 A;  2KRS A;  1K9M C;  2ZZD A;  1WHH A;  3CCU T;  4XU2 A;  3CPW P;  2D8H A;  2RQV A;  1T0H A;  2CRE A;  2QI2 A;  3CCL Q;  1W2B A;  1VA7 A;  4RTV A;  2MOX A;  2BZX A;  1Q81 U;  1IO6 A;  1LCK A;  2AHJ B;  3MKD A;  2ESW A;  5GAN 4;  1M1G A;  2XDB A;  1N5Z A;  4MDW A;  1YIJ A;  2LJ3 A;  1WFW A;  1WXU A;  1ZBX A;  2RK2 A;  3HFN A;  1FX7 A;  5L8R E;  3SHW A;  1PCX A;  3TCJ A;  2V8I A;  1TG0 A;  2PU9 B;  4GY5 A;  3E2U A;  4PJN A;  1U5S A;  2LQN A;  3E9F A;  3M55 A;  4N4G A;  2C0I A;  1KD1 C;  4ATO A;  1K8A C;  3CCE A;  2R57 A;  5KCH A;  1MHN A;  1EZZ B;  2E41 A;  1QVG S;  4C5H A;  1YJ9 T;  2EGA A;  2MK5 A;  2P4T A;  3OW2 S;  2XG8 D;  1VQ7 Q;  4CC7 A;  2Z0W A;  1VQK T;  2HSE B;  1FYN A;  2EYW A;  1TXQ A;  1H3H A;  2YRD A;  1VUB A;  2HQE A;  3QSU A;  4RKU E;  4C8Q G;  4ZGD B;  1C6V X;  2JMA A;  4M77 B;  2QQ9 A;  4DEY A;  3CCM A;  4Y92 A;  1Z9Q A;  2JNG A;  2L3R A;  1EFN A;  5FRN A;  1VQ8 Q;  1DJ7 B;  3X28 B;  1UUE A;  1ACM B;  2JN0 A;  2C0O A;  1Q7Y U;  3GOX A;  3VRY A;  1SSF A;  2H3E B;  3OMG A;  1YIT Q;  2NUT B;  1J3T A;  5FLX E;  1QVF P;  3CC4 A;  2DL3 A;  4M75 F;  2QA4 A;  1W4S A;  4E7S A;  3QWY A;  3OSS C;  4OMF B;  3WXM B;  1HK9 A;  2EQI A;  3OYG A;  3CC2 Q;  4FCY A;  3I55 Q;  3VS0 A;  2HL3 A;  4X34 A;  3R6O A;  3S3N A;  2BZ8 A;  3LWI A;  5FW9 A;  4BDY A;  2PNI A;  5LJ3 d;  2VGN A;  4QQG A;  4BY6 C;  2B86 A;  3OYH A;  2AZS A;  5GAM h;  2P0K A;  4XTW A;  1HSQ A;  4J6Y A;  4M7A F;  3ULR B;  1TUG B;  4IUT A;  2D0Q B;  4JRQ A;  5KYX A;  2GFA A;  3DB4 A;  1V76 A;  1Y0M A;  1WJS A;  4MZP A;  1MMA A;  3VV0 A;  1XQH A;  1RAC B;  3PVL A;  1RAG B;  2K7A A;  3FC3 A;  1ZSZ B;  5CKH A;  4BDZ A;  2WSF E;  1CKA A;  3G71 A;  1VQM Q;  1RLQ C;  1GRI A;  1KSW A;  5AT1 B;  2F69 A;  3CPF A;  3E1S A;  4F7U F;  1G3W A;  5D6X A;  1YHQ Q;  1WHK A;  2JTF A;  3NTI A;  4ZGE B;  5IXB A;  1B7T A;  2FYK A;  1OEB A;  1YCY A;  1UGQ B;  2ABL A;  4XU0 A;  4D8K A;  4F17 A;  2XHC A;  3QJY A;  4C8Q A;  2DVE A;  4OGC A;  3G6E A;  2NUZ A;  1UEC A;  2HSP A;  2X4W A;  1VQ4 T;  5I11 A;  2LNH B;  1X27 A;  3CD6 Q;  2CKK A;  2IPO B;  4L59 A;  1SKU B;  2A3L A;  3QPH A;  4DA4 A;  3EHQ A;  4EDU A;  4MZT A;  5IHI A;  3VYH B;  4V2S A;  1E6G A;  3E9G A;  2OI3 A;  4OMN A;  3CCL A;  4FYY B;  3NPF A;  3CMA Q;  2FZG B;  3TSZ A;  4ZTJ A;  2SRC A;  3JB9 I;  2DL7 A;  4M7D F;  3JCM d;  3OYA A;  2E5Q A;  5CKF A;  4DBH A;  3HTR A;  1G2B A;  2ECZ A;  3PIO A;  5FU7 B;  3JCM X;  1B3Q A;  3TVT A;  1MMN A;  4TVR A;  4E2F B;  2QAZ A;  2YUO A;  3QZ5 B;  1M1K U;  3HL8 A;  2V1R A;  1M3B A;  1X75 C;  2LQ8 A;  4C92 G;  4ZTF A;  1BCO A;  2ZPF B;  5CR2 A;  4E7K A;  1K73 C;  1QCF A;  4DEX A;  1OUL A;  3OYN A;  1S72 Q;  3CXC A;  3VYG A;  4XQ3 A;  2YXY A;  1R8O B;  1YCS B;  3RER A;  2P4R A;  3UWN A;  4PJO B;  4IKF A;  1YP5 A;  4M78 E;  3VJP A;  4Z8A A;  1VQ7 A;  4BUG A;  1KQS S;  4M77 F;  4KUD K;  1PM3 A;  2GCX A;  2DNU A;  3P8D A;  5HK0 A;  3I5R A;  2RD1 A;  3SWN B;  3QYG B;  3FJ5 A;  5HK3 A;  1VQ6 Q;  2FL7 A;  2COW A;  3BY7 A;  1G5V A;  2RJD A;  1VQO Q;  3CQT A;  2D6F A;  1E7O A;  2IVW A;  1QP3 A;  2QGF B;  3L2W A;  4PL6 A;  3MP6 A;  5J26 A;  1VQ8 A;  5J3B A;  5LJ5 g;  2O88 A;  5GAN j;  3CCJ T;  4DOV A;  4Z89 A;  2L3Q A;  3CCR Q;  5CQX A;  3OYI A;  4J83 A;  2YUN A;  4F04 B;  5EC7 A;  1BKB A;  1YIT A;  3JCM J;  2JXB A;  1CSK A;  1C0M A;  2X3W D;  3CXC S;  3FRN A;  1VQL T;  3A8G B;  1OU8 A;  2CT3 A;  2CH4 A;  4II1 A;  1VQP Q;  2OTJ T;  3CC2 A;  2O31 A;  4MMK A;  3A8O B;  4JRI A;  1IGU A;  3I55 A;  1YI2 T;  2K4Y A;  3EGD A;  1ABO A;  3M57 A;  4ZGJ B;  2DA9 A;  3EFS A;  2BE9 B;  2YWW A;  5GAN 8;  3EG0 A;  4XTY A;  1EX4 A;  1VQM T;  1AWW A;  3OYF A;  3JSC A;  2FPD A;  3VS1 A;  3RBB B;  2VC8 A;  4M75 D;  4ESR A;  1VQN T;  2XD0 A;  2DD5 A;  3OYY A;  5CKB A;  2DZC A;  3REB B;  1X2Q A;  2KQW A;  1XJW B;  1UE9 A;  4LD6 A;  2E1H A;  3M54 A;  3QYH B;  4C92 A;  2L5Q A;  2GTJ A;  4LDW A;  3QG1 A;  3MEV A;  1FWZ A;  2JS2 A;  4X9D A;  2D0N A;  1S1N A;  4M7A D;  4UC4 A;  2KI7 A;  2FRY A;  5GJW B;  1VQM A;  3BFM A;  2PUK B;  2RJC A;  2GNC A;  5I21 A;  2PVD B;  2RQU A;  1YHQ A;  1F1B B;  3L2U A;  5KYY A;  3EG9 A;  2HBP A;  2HMA A;  2SEM A;  1R0B G;  1K4U S;  3S3O A;  2AZV A;  2KXD A;  1H92 A;  2M1H A;  1OZ3 A;  3CD6 A;  1T3L A;  4LE9 A;  1ZLM A;  4JS5 A;  4JZ4 A;  2DD4 A;  3A1P A;  5LJ3 g;  1KIK A;  2Y90 A;  5GAO p;  1Q81 R;  1M2O A;  1PSF A;  4OB2 B;  3FB9 A;  1BIB A;  4PJO G;  3L2V A;  1NE8 A;  2D1X A;  2DAQ A;  2K3X A;  3RIR A;  2GQI A;  2E3H A;  3JB9 G;  1WQW A;  2EYY A;  3CMA A;  4IIO A;  1VQ5 Q;  1PSE A;  3P8B B;  4OMP A;  3X25 B;  2WSE E;  4OB3 B;  2FPF A;  4BAC A;  2CZ1 B;  2X35 A;  4N4H A;  3LGF A;  3FIF A;  2E6Z A;  1B07 A;  3QZ9 B;  2KDS A;  2KT1 A;  3EFO A;  1UHC A;  4FYW B;  1VQO T;  4FYV B;  1VYV A;  3L2Z A;  3I56 T;  2LCL A;  4M7D D;  2HQX A;  4JJC A;  1D0X A;  2HBW A;  4BE0 A;  4PLI A;  1TH7 A;  3A8M B;  1AWJ A;  3DLM A;  1BBZ A;  5KYU A;  2AIR B;  5IN1 A;  1S72 A;  3OS2 A;  1C1A A;  1W2B P;  2QG9 B;  4PLL A;  4IUP A;  4M78 A;  4M77 C;  3OBY A;  4OB1 B;  2QXF A;  1G3S A;  1BB9 A;  3M0U A;  2RHX A;  1QCO A;  3CCS T;  5M9O A;  2DL4 A;  1QVP A;  4FSS A;  1N8R U;  4B6M A;  3VS6 A;  5KYX B;  1U8R A;  1VQ6 A;  3H9N A;  1VQO A;  1XTD A;  2DIG A;  2QTV A;  2JZ2 A;  1NJI U;  4RTU A;  1KQ1 A;  1SG5 A;  3CCV Q;  3LLR A;  3H8Z A;  4M77 D;  1Q7Y R;  1D1C A;  2K6D A;  3VUB A;  1MND A;  3INZ A;  3V7C A;  1SRM A;  3JCM g;  1KC8 R;  3OS0 A;  2GF7 A;  2EQJ A;  3CCR A;  2RQT A;  2ENM A;  5CAI A;  3QO3 A;  4PFZ A;  2DL8 A;  5GAM g;  5LL6 S;  2BZY A;  5LJ3 f;  1BU1 A;  3MET A;  4D6W A;  2VUB A;  1X43 A;  1O9S A;  1QKX A;  2L8D A;  4C8Q B;  1D1B A;  1Y57 A;  4N0A C;  2AT1 B;  1VQP A;  4FW2 A;  1YBY A;  1KK7 A;  2E3I A;  4E6R A;  1RI0 A;  2KRM A;  3CCQ T;  4A63 B;  2RJF A;  2MIO A;  1V29 B;  2GTO A;  4HKE A;  3MEA A;  2HQH A;  4HVV A;  1LJO A;  1OU9 A;  5GMK e;  4IUV A;  1V1C A;  2DTI A;  4OVA A;  2MPX C;  1G3Y A;  3M56 A;  1OV3 A;  4RUG A;  1KFZ A;  1WA7 A;  4DOW A;  1MUZ A;  2FG0 A;  2YLB A;  3EG3 A;  2LQK A;  2ZPG B;  1JO8 A;  1YIJ T;  2O4X A;  1KC8 C;  2BUD A;  2VAS A;  1Q82 U;  4JJB A;  3I5S A;  1WI7 A;  2C0T A;  1QVG A;  2JTM A;  4OGE A;  2NUP A;  1FXX A;  1RAE B;  1VQ9 Q;  5GAN d;  3C95 A;  3RNJ A;  2GGR A;  2QQR A;  1IHV A;  1YWO A;  2CGH A;  2CP0 A;  4M75 E;  3CCE T;  4C5I A;  3EHR A;  2KYB A;  1UEB A;  3V8L A;  2V1Q A;  5LJ5 d;  3EG2 A;  5FU7 C;  2RHZ A;  1Y07 A;  2L89 A;  4EMG A;  5KH6 A;  2CP5 A;  3FLG A;  5DY9 A;  1VQ5 A;  3GP8 A;  3OB9 A;  4YTL A;  1BIA A;  2RI5 A;  4KBM B;  4M7A E;  1I5L A;  2JM8 A;  3EAE A;  1AT1 B;  1M1K R;  3QXE B;  1OZ2 A;  2DFU A;  3PIP A;  3CME Q;  1ZUU A;  3JCM P;  3H6Z A;  1Y96 A;  3CCM T;  3HFO A;  1SPK A;  3PE0 A;  2XK0 A;  1TS9 A;  5GAN 7;  4IUU A;  4MDX A;  2QAS A;  3QKJ A;  4JDS A;  3RMQ A;  2GFU A;  4E7L A;  2K2M A;  2X3X D;  4QVC A;  3SWN C;  2YUP A;  3EGD B;  1AVZ C;  3REA B;  3EH1 A;  1PG5 B;  2LT4 A;  3DLL A;  4F7U E;  1PD0 A;  4O5V A;  4BI3 A;  3QBY A;  2P0P A;  4BB7 A;  2VWF A;  1H8K A;  3URG A;  2X4Y A;  3CC4 T;  3JRZ A;  5L23 A;  2BKD N;  2QA4 T;  3HRT A;  4RG2 A;  1YJN Q;  3GNF B;  1E6H A;  2EGE A;  2QDY B;  4C92 B;  3X24 B;  5A0G A;  2CSI A;  2DIQ A;  5DLQ E;  3G4S Q;  1OX9 A;  2H3J A;  1D0Z A;  3OSV A;  3ER0 A;  5GAO q;  1RAD B;  3CCV A;  2R5A A;  1QWF A;  2DIL A;  4LUD A;  4M75 G;  1X6B A;  4LNP A;  2DYI A;  1K0X A;  5GMK h;  3JV3 A;  2AKL A;  2J6O A;  1UGP B;  5KYY B;  3EG9 B;  1M1K C;  1M90 U;  5IAY A;  5D6Y A;  4M7D E;  2QQS A;  3X20 B;  1I5O B;  4C0D B;  5IXF A;  1QKW A;  3CBP A;  3QWX X;  2KAF A;  3G71 T;  2DPP B;  4J9I A;  4OML A;  2G6F X;  3BDL A;  2DLP A;  2JUF A;  1PNJ A;  1HXD A;  2PQW A;  3ZBD A;  2RMO A;  2A08 A;  1K9M U;  3G6E T;  4RTT A;  2GQV A;  3M0P A;  2RK1 A;  4LDY A;  4AG2 C;  1TUC A;  5GAO m;  3NFC A;  2PUO B;  3G7Z A;  4BD3 A;  3EH2 A;  4F7U G;  1RL2 A;  3RDV A;  1WIE A;  4M77 E;  2KR3 A;  2QEX Q;  2K3B A;  2FRW A;  1PWT A;  3CCL T;  4MML A;  4WTO B;  1MNE A;  3N5B B;  3EGU A;  4EMK C;  4KRT A;  2OAU A;  3EFO B;  5FWB A;  5CKE A;  3J81 E;  3S3M A;  5KE3 A;  4GBQ A;  1TOV A;  2AKK A;  4J9G A;  2DBM A;  4J5Y A;  5KYU B;  3JCM V;  1ZA2 B;  1I1J A;  1KD1 U;  1TSF A;  1SSH A;  2HNI A;  2KE9 A;  1MMD A;  2EJ9 A;  3CC7 Q;  2K2V A;  1IRE B;  2HKQ B;  4KGZ B;  2EKH A;  4JJD A;  3QDF A;  1VQ9 A;  2DXT A;  4JRK A;  4M78 B;  4AFU C;  2LCS A;  1KQS A;  1AD5 A;  1ABQ A;  3SFM A;  3PT9 A;  2RNA A;  4M7D G;  1EIF A;  1NPR A;  4XTU A;  3VS5 A;  4M75 A;  2OJ2 A;  2RO0 A;  1VIE A;  5EG2 A;  5FU6 B;  3UA7 A;  1RAA B;  4R55 A;  3VS7 A;  2KT8 A;  1RAF B;  2EQM A;  3TQ7 P;  1MGQ A;  1ZA1 B;  1VQ7 T;  1I4K 1;  2RJE A;  4IUQ A;  3CPW S;  5GAM d;  3OA6 A;  1WXT A;  4M7A A;  3QHS A;  1ZSG A;  1BI3 A;  4HXJ A;  4HVU A;  4PFO A;  1RI9 A;  1JJ2 P;  1N9R A;  3HSB A;  2A36 A;  4JUV A;  4FW1 A;  2V26 A;  3CME A;  2OTL A;  1X2K A;  2KK4 A;  5KCO A;  2CZ6 B;  4X9C A;  2EGC A;  2E10 A;  5CIU A;  1VQ8 T;  1Q86 R;  3GF5 A;  3OYD A;  3HRU A;  3OYL A;  3A8L B;  2JTE A;  2JT4 A;  3OBW A;  1FMW A;  1WHL A;  1M27 C;  2EJG A;  1T3S A;  5FRM A;  3UDC A;  1MV0 B;  5FWC A;  3SD4 A;  4QQ6 A;  1YIT T;  1KQ2 A;  4F7U A;  2IG0 A;  5GAN g;  1JQQ A;  4C92 F;  2K79 A;  1N8R R;  1QVF A;  4OB0 B;  2C06 A;  1OX8 A;  2ATC B;  1YJN A;  3CC2 T;  3H41 A;  1NJI R;  3I55 T;  2X4X A;  2VKN A;  2YDL A;  1ZUY A;  3L42 A;  1GCQ A;  2E64 A;  3G4S A;  2XIC A;  4P5N A;  3M9Q A;  5A0D A;  4AFQ C;  4NL3 A;  3H0H A;  3KXT A;  4GLM A;  3V7R A;  1LVK A;  1D09 B;  4JS4 A;  2L2P A;  4C8Q C;  4AT1 B;  3MEU A;  2O4X B;  1BI2 A;  4J8O A;  1JEG A;  4M7D A;  1LNX A;  4LUE A;  3O8V A;  4LDU A;  1YJW Q;  2NUP B;  2DL5 A;  1D0Y A;  1NBE B;  4IUR A;  2DTH A;  4NL2 A;  3HP9 A;  1UHF A;  1Q86 C;  1GXI E;  2IIM A;  1JBM A;  2FZK B;  4RTX A;  1QVF S;  2RHI A;  1YHQ T;  1ZX6 A;  4KGX B;  2DXB A;  1NEB A;  4JLG A;  4QVD A;  2EQU A;  5IHK A;  4HCK A;  2BIV A;  4FIB A;  4M78 G;  2QTX A;  1I81 A;  2CDT A;  3CD6 T;  1M8M A;  1GBR A;  1YWP A;  1NLO C;  2KBT A;  3M0R A;  2QEX A;  3L1A A;  5ECA A;  4JRP A;  2LX7 A;  2RN8 A;  1RAB B;  1K76 A;  2HL5 C;  1Y96 B;  4HVW A;  3MHX A;  3T9N A;  3CMA T;  3VUZ A;  3RES A;  5GAN f;  1Q82 R;  1Q95 G;  2EYZ A;  1K73 U;  3GIB A;  2RA2 A;  1KG1 A;  2WAC A;  4BE2 A;  4CC3 A;  1M3A A;  5CQY A;  3CC7 A;  4QQD A;  3PVQ A;  5LJ5 f;  3OYK A;  4J9C A;  2KMT A;  1UGS B;  4LD9 K;  2KXC A;  1ZBJ A;  1JU5 C;  1MV3 A;  1G83 A;  3NHN A;  4HCB A;  1D3B A;  2F5K A;  1HD3 A;  3OQ5 A;  3OYJ A;  2F2X A;  1S72 T;  2RM4 A;  2DVJ A;  5AYF A;  4C0F A;  4DBQ A;  1TWB A;  2MMP A;  2V8K A;  1IB8 A;  2JS0 A;  2M0Y A;  1QQJ A;  3OS5 A;  1BI1 A;  2A0F B;  2FHD A;  3LH5 A;  1M9S A;  3X26 B;  3VU3 C;  4WCI A;  1VQ6 T;  2M16 A;  2CS7 A;  4PJO F;  4C0G A;  1QVG P;  3ME9 A;  3JB9 F;  2W10 A;  2J05 A;  4CC2 A;  4ZN3 A;  3OW2 P;  4JZ3 A;  5GAO l;  2E65 A;  4J9F A;  3CCU Q;  3PGG A;  5CO7 A;  1OPK A;  2EAY A;  3QII A;  2HEQ A;  2FZC B;  3CCR T;  1WJQ A;  5J39 A;  1QLY A;  2X51 A;  3A5Z B;  4RG8 A;  4C92 C;  1G3T A;  1Z9Z A;  1PKT A;  1WGS A;  2M0O A;  1P92 A;  2EYQ A;  1Q81 C;  3HHT B;  3SB2 A;  1VQP T;  1UGR B;  2Y4Y A;  1N9S A;  2VB6 A;  3BDU A;  2OX7 A;  1YJW T;  3NMZ C;  5KYW A;  1GFD A;  2DX1 A;  1MMG A;  5LJ3 e;  1XNI A;  1PC0 A;  1KHC A;  2EBP A;  4KT0 E;  4C92 D;  2D8J A;  1K1Z A;  5GMK j;  2CZ7 B;  1VYT A;  4QT7 A;  4C0D C;  2B8A A;  1OYX A;  2I0N A;  4PNO A;  4D8D A;  1YJ9 Q;  2PVO B;  1M90 R;  4KH1 B;  3TSW A;  4KUL A;  2JJ9 A;  4J9E A;  1VQK Q;  4CRI A;  4R0K A;  4XTZ A;  2R5M A;  1SHG A;  4RCB A;  1AHJ B;  3TU4 K;  1GBQ A;  2G3R A;  2DK3 A;  3A98 A;  1VIF A;  1LOJ A;  1KHI A;  1YJW A;  2HAX A;  2J7I A;  2QQB A;  1YN8 A;  3TEE A;  3LX7 A;  2AK5 A;  1QCN A;  3FDR A;  1UG1 A;  4DBR A;  5GAN 3;  3I35 A;  1KJW A;  2BE7 D;  1WQ7 A;  4A4K A;  4M75 B;  4Z02 A;  4ELY C;  3JB9 H;  1X6O A;  1ZSZ C;  3NGP A;  2ED0 A;  3EGX A;  3RMS A;  4A54 A;  2KEA A;  4C0Z A;  4HT8 A;  3ZEH A;  4E7J A;  4DBF A;  3E19 A;  1WJR A;  4AFS C;  2LRQ A;  3OYB A;  1R77 A;  2BTT A;  4B9X A;  5GAN 5;  4M7A B;  4EMH A;  1Q7Y C;  2YLC A;  1PKS A;  3LH0 A;  1WLP B;  1BI0 A;  1ZUK A;  5D6W A;  4NOY A;  2KNB B;  3LGL A;  1VQ5 T;  1RLP C;  2HCK A;  2EVR A;  1GL5 A;  1OPL A;  4EIK A;  4FT2 A;  3F70 A;  4E47 A;  3A8H B;  1VYU A;  3IQL A;  3NTK A;  3JCM Q;  5FU6 C;  3OYM A;  1I07 A;  2EPD A;  2DM1 A;  4F7U B;  2O01 E;  2RHU A;  3CEY A;  3JCM f;  3J80 E;  2MCN A;  2O2O A;  3L2R A;  4KGV B;  2Y4X A;  2J6K A;  4XU1 A;  5GAM f;  1X01 A;  3RKY A;  1BYM A;  2E12 A;  4DQ2 A;  3OS1 A;  1A0N B;  1PRM C;  3LYI A;  2A37 A;  7AT1 B;  3WVD B;  4BI8 B;  2L3P A;  4JLI A;  2NWM A;  2YRC A;  2DTO A;  2DXU A;  4KUI A;  4F14 A;  2OTL Q;  1M8V A;  2LVM A;  3UA6 A;  3VS3 A;  2ZPE B;  4QVZ A;  3GPL A;  1VQ4 Q;  5LJ3 h;  4PJO C;  4OP0 A;  2PTK A;  3M58 A;  5GMK m;  3JB9 J;  4LXC A;  4B9W A;  4ZNX A;  3ZL7 C;  4M7D B;  2DE0 X;  3CCV T;  4R56 A;  5C6S A;  2P0Q A;  1KQS P;  2YT6 A;  3CCU A;  3KFV A;  4LDX A;  3P8H A;  1YNZ A;  1R0C B;  1U1T A;  1TUD A;  4PJO D;  4J9D A;  4EMK A;  1PD1 A;  2PZ1 A;  3CBO A;  2QGG A;  3Q1J A;  3JB9 D;  2COY A;  5DLO A;  2LP5 A;  1JXO A;  1XOV A;  3QUI A;  3U23 A;  1W2B S;  2QK0 A;  1M2V A;  1U1S A;  3RKX A;  2QQA A;  3M0T A;  4FL6 A;  2EW3 A;  2L0A A;  2RQW A;  3GBQ A;  1WX6 A;  2M02 A;  1UFF A;  2JMC A; 
#chains in the Genus database with same CATH homology
 2DYB A;  1X2K A;  1UGV A;  2CSQ A;  1U06 A;  2EGC A;  1W1F A;  3I9Q A;  1UTI A;  1T3L A;  4LE9 A;  1ZLM A;  1HJD A;  4JZ4 A;  2JTE A;  1KIK A;  2JT4 A;  2A28 A;  1M27 C;  1T3S A;  2DRM A;  2XMF A;  4AG1 C;  1MV0 B;  1H92 A;  5FWC A;  3H0I A;  4RTY A;  1QWE A;  2D1X A;  2GQI A;  4F16 A;  1JQQ A;  2EYY A;  2K79 A;  4IIO A;  2DMO A;  4OMP A;  2HDA A;  3VS4 A;  2FPF A;  1SHF A;  3H41 A;  2RPN A;  2DF6 A;  1AWX A;  3UAT A;  1B07 A;  1K9A A;  2L3S A;  2VKN A;  2YDL A;  1ZUY A;  1GCQ A;  4IIM A;  3VRZ A;  2KT1 A;  4AFQ C;  1UHC A;  2JM9 A;  1VYV A;  2J06 A;  3H0H A;  2F2V A;  4GLM A;  1X6G A;  4JJC A;  2FO0 A;  2HBW A;  1T0J A;  1W6X A;  2L2P A;  1AWJ A;  2KRS A;  1BBZ A;  1UDL A;  2D8H A;  2RQV A;  1T0H A;  2CRE A;  1VA7 A;  4RTV A;  2MOX A;  2BZX A;  1IO6 A;  4J9B A;  1M30 A;  1LCK A;  1JEG A;  4LUE A;  2ESW A;  1BB9 A;  3M0U A;  2DL5 A;  1N5Z A;  4RTW A;  2DL4 A;  2LJ3 A;  1WFW A;  4FSS A;  1UHF A;  3VS6 A;  1WXU A;  2IIM A;  3SHW A;  4RTX A;  1TG0 A;  1ZX6 A;  1NEB A;  4RTU A;  4ORZ A;  1AOJ A;  1U5S A;  2LQN A;  5HCK A;  2K6D A;  3EG1 A;  5IHK A;  4HCK A;  1SRM A;  2C0I A;  3THK A;  2CDT A;  1AZG B;  1M8M A;  1GBR A;  1YWP A;  2ENM A;  2FPE A;  2RQT A;  2M51 A;  2DL8 A;  4LN2 A;  4M4Z A;  1NLO C;  5GJV B;  2KBT A;  2EGA A;  3M0R A;  2BZY A;  2RQR A;  5ECA A;  1BU1 A;  2LX7 A;  2RF0 A;  2RN8 A;  4CC7 A;  1X43 A;  1QKX A;  3M0Q A;  1FYN A;  2EYW A;  1K76 A;  4HVW A;  1Y57 A;  1H3H A;  2O9S A;  1NYF A;  4E6R A;  2EYZ A;  2KRM A;  2JMA A;  1CKB A;  3R6N A;  4A63 B;  4DEY A;  2MIO A;  4Y92 A;  2ED1 A;  1Z9Q A;  4CC3 A;  1EFN A;  1M3A A;  1RUW A;  1UUE A;  3PVQ A;  2GTO A;  2C0O A;  1UJ0 A;  1K0S A;  4J9C A;  4HVV A;  2KXC A;  1ZBJ A;  1JU5 C;  1MV3 A;  1G83 A;  3NHN A;  3VRY A;  2F2W A;  1HD3 A;  2F2X A;  1J3T A;  1V1C A;  2DVJ A;  2DL3 A;  1NLP C;  1OV3 A;  4RUG A;  2ROL A;  1KFZ A;  1WA7 A;  2E5K A;  3QWY A;  4X1V A;  2JS0 A;  3C0C A;  2EQI A;  1MUZ A;  2M0Y A;  3VS0 A;  2FG0 A;  3UF4 A;  3EG3 A;  2BZ8 A;  2LQW A;  5FW9 A;  1JO8 A;  3LH5 A;  2PNI A;  4WCI A;  2B86 A;  2AZS A;  4JJB A;  3I5S A;  1HSQ A;  1WI7 A;  2C0T A;  3ULR B;  2W10 A;  2J05 A;  4CC2 A;  3RNJ A;  4JZ3 A;  2GGR A;  1ARK A;  4J9F A;  1Y0M A;  1OPK A;  1YWO A;  2HEQ A;  3PVL A;  3EHR A;  2KYB A;  1QLY A;  2V1Q A;  2K7A A;  4AFZ C;  4CC4 B;  2CUB A;  1X69 A;  3EG2 A;  1JXM A;  1CKA A;  1Z9Z A;  4OMO A;  1RLQ C;  1GRI A;  1KSW A;  1PKT A;  2LJ1 A;  2ROT A;  1FMK A;  2KGT A;  5IXB A;  3VS2 A;  2JM8 A;  1OEB A;  1AWO A;  2LJ0 A;  2ABL A;  1SRL A;  3NMZ C;  1GFD A;  2W0Z A;  2DX1 A;  4D8K A;  4F17 A;  1ZUU A;  1NEG A;  2NUZ A;  1UEC A;  2HSP A;  2EBP A;  3PE0 A;  1SPK A;  2D8J A;  5I11 A;  2LNH B;  2YUQ A;  1X27 A;  1K1Z A;  3M0S A;  1VYT A;  4QT7 A;  1M3C A;  3EHQ A;  2EYX A;  2DJQ A;  2I0N A;  2QDL A;  4D8D A;  2K2M A;  2X3X D;  2YUP A;  4RTZ A;  5IHI A;  3TSW A;  1W70 A;  1AVZ C;  3REA B;  1E6G A;  4J9E A;  4R0K A;  2OI3 A;  4OMN A;  1SHG A;  2CUD A;  1GBQ A;  3NPF A;  2VWF A;  1H8K A;  3A98 A;  3TSZ A;  5L23 A;  2SRC A;  2DL7 A;  2J7I A;  1YN8 A;  2KRN A;  1G2B A;  1E6H A;  2EGE A;  2ECZ A;  1SEM A;  2AK5 A;  1NYG A;  2CSI A;  3H0F A;  1B3Q A;  1UG1 A;  3TVT A;  1AEY A;  2YSQ A;  3I35 A;  2YUO A;  1KJW A;  2GBQ A;  2V1R A;  2ED0 A;  1M3B A;  3NGP A;  2KEA A;  1QWF A;  2FEI A;  2DIL A;  4LUD A;  1QCF A;  1X6B A;  2CH4 W;  4LNP A;  4AFS C;  4DEX A;  1K0X A;  2BTT A;  1GCQ C;  3JV3 A;  1YCS B;  2AKL A;  4JPB W;  2J6O A;  1OOT A;  2P4R A;  1PKS A;  1YP5 A;  1WLP B;  4Z8A A;  1AZE A;  5IXF A;  1QKW A;  3QWX X;  2DNU A;  1ZUK A;  3O5Z A;  3I5R A;  2KNB B;  4OMM A;  4J9I A;  4OML A;  3FJ5 A;  2G6F X;  1RLP C;  2HCK A;  2EVR A;  2DLP A;  1GL5 A;  3CQT A;  1E7O A;  1PNJ A;  4OMQ A;  1NM7 A;  1OPL A;  4EIK A;  4K11 A;  2RMO A;  1VYU A;  2A08 A;  1WYX A;  3IQL A;  2O88 A;  4J9H A;  1I07 A;  2EPD A;  3M0P A;  4RTT A;  2DM1 A;  1BK2 A;  2DRK A;  1GCP A;  4Z89 A;  4AG2 C;  2L3Q A;  1TUC A;  4Z88 A;  2JW4 A;  2MCN A;  2O2O A;  2YUN A;  1I0C A;  1PRL C;  1WIE A;  5EC7 A;  2KR3 A;  2K3B A;  2J6K A;  2FRW A;  2JXB A;  2O9V A;  1CSK A;  1PWT A;  2X3W D;  1A0N B;  2CT4 A;  3EGU A;  1U3O A;  2CT3 A;  1PRM C;  2CH4 A;  5IH2 A;  2A37 A;  4KRT A;  2O31 A;  5FWB A;  2L3P A;  2NWM A;  1ABO A;  2DA9 A;  1NG2 A;  3EG0 A;  4GBQ A;  2AKK A;  4J9G A;  1AWW A;  4F14 A;  2DBM A;  1PHT A;  2FPD A;  3UA6 A;  3VS3 A;  1I1J A;  3VS1 A;  3RBB B;  1SSH A;  2PTK A;  2OAW A;  2KE9 A;  4ESR A;  2EKH A;  4JJD A;  3SEM A;  3REB B;  1X2Q A;  4ZNX A;  2J6F A;  3ZL7 C;  4AFU C;  2DE0 X;  1WXB A;  2VVK A;  2LCS A;  1UJY A;  1AD5 A;  2YT6 A;  1ABQ A;  1UE9 A;  3KFV A;  2GTJ A;  2RNA A;  1YNZ A;  5I22 A;  3VS5 A;  2JS2 A;  2OJ2 A;  1TUD A;  2D0N A;  2H8H A;  1S1N A;  3UA7 A;  4J9D A;  3VS7 A;  2PZ1 A;  2KT8 A;  1GFC A;  2FRY A;  2K9G A;  5GJW B;  2LP5 A;  2LMJ A;  1JXO A;  2KYM A;  1XOV A;  2GNC A;  2KRO A;  2RQU A;  3U23 A;  1WXT A;  5IHN A;  2SEM A;  1WDX A;  1ZSG A;  4HXJ A;  4HVU A;  1K4U S;  2LZ6 B;  1RI9 A;  3M0T A;  2A36 A;  2AZV A;  2EW3 A;  2L0A A;  2RQW A;  2DBK A;  3GBQ A;  2KXD A;  1WX6 A;  1UFF A;  2JMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...