2JS2A

Solution structure of first sh3 domain of adaptor nck
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
63
structure length
63
Chain Sequence
b'GSMAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic protein NCK1
molecule tags Signaling protein
source organism Homo sapiens
publication title Specificity determinants of a novel Nck interaction with the juxtamembrane domain of the epidermal growth factor receptor.
pubmed doi rcsb
total genus 7
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2js2A00
2JMCA 1QCFA 4LUDA 4LE9A 1VYTA 4RTWA 2PNIA 1M8MA 3PVLA 1M3CA 1YCSB 2D1XA 4AG2C 2AK5A 2KBTA 3O5ZA 4ZNXA 4A63B 2O88A 2YUPA 1BK2A 1GRIA 1YNZA 4CC3A 2CUBA 2RNAA 1AZEA 2CREA 3M0PA 2KYMA 2X3WD 1ABQA 4HVVA 2DJQA 4CC7A 2FRYA 5IXFA 1H92A 1RUWA 2KRNA 4AFUC 2DE0X 4JZ4A 2L3QA 5FWCA 2RQVA 2D8HA 2E5KA 5IHKA 3SHWA 1BB9A 1JQQA 2J06A 4J9DA 1NEBA 3GBQA 4OMPA 1SPKA 2G6FX 1U06A 1WIEA 1JU5C 1ZSGA 2DL3A 2EYWA 1E6HA 4ESRA 2J6KA 1RI9A 4IIOA 3EGUA 2LMJA 1GL5A 1HJDA 2KE9A 1XOVA 2YSQA 4RTXA 1SSHA 4OMQA 1PRLC 2EBPA 3H0FA 2ESWA 1H8KA 3VRYA 1B3QA 2GBQA 2J7IA 2K9GA 3NGPA 4J9GA 2JMAA 1PNJA 2DL7A 1S1NA 2FG0A 3VS1A 3ULRB 2CUDA 5GJVB 2HSPA 1AD5A 2I0NA 2J6OA 2LX7A 2D8JA 3PVQA 1JEGA 1I07A 2P4RA 3NPFA 4RTUA 2D0NA 3VS3A 2KRSA 2JM9A 1NLPC 3H0HA 2AKKA 2FPFA 3M0TA 1NLOC 1V1CA 1UECA 1GCQA 1BBZA 1HSQA 4J9IA 1YWPA 2J6FA 1AZGB 1CKAA 2YUQA 1MUZA 1TUDA 2KT8A 2LJ3A 1NM7A 1ARKA 3FJ5A 5EC7A 1QLYA 1T0HA 2VWFA 2LP5A 2HDAA 2HBWA 2XMFA 4CC4B 2ABLA 1QWFA 5IXBA 1NYGA 1UG1A 2JM8A 3UA6A 1GBQA 2ED1A 4R0KA 2AZSA 4HCKA 2KRMA 3VRZA 2SEMA 1AWJA 3VS5A 1K76A 3I5RA 2GTJA 2EGCA 4J9BA 2F2WA 2O2OA 4AFSC 4F17A 1UGVA 1ZLMA 3LH5A 3VS6A 2LCSA 1ZX6A 4RTZA 1WXUA 2DILA 2KXDA 5FW9A 2BZXA 1PWTA 2QDLA 3I35A 2L0AA 1UJYA 1M3AA 2C0IA 4F14A 1AEYA 1UTIA 1X69A 4Z88A 4HVWA 3CQTA 2O31A 1YN8A 1K9AA 2EGAA 3VS7A 2O9SA 2JT4A 1PHTA 2A28A 1VYUA 1FYNA 2DVJA 1QKXA 1I1JA 2K3BA 4KRTA 2LQNA 2RMOA 3EG2A 1W1FA 2K6DA 4RTYA 1JXMA 2CH4W 2NWMA 2JS2A 1AOJA 1GFDA 1TG0A 2DLPA 1T3LA 1WI7A 2SRCA 2V1RA 1ZUUA 3EHRA 4OMNA 1U3OA 3JV3A 1KJWA 2JXBA 4AG1C 2EYZA 3REAB 3EG1A 1AVZC 1PKTA 2DA9A 5FWBA 5GJWB 4JJBA 4Z89A 4OMOA 2FPEA 4LNPA 4FSSA 1EFNA 3H0IA 2M51A 2FEIA 1M30A 1ZBJA 1T0JA 1MV3A 1RLPC 1X6GA 2KGTA 3THKA 3UA7A 2OAWA 1WXTA 1LCKA 2EVRA 1W6XA 2C0OA 3UF4A 3U23A 1Y57A 4J9CA 1KIKA 2GTOA 3M0RA 2EYXA 3SEMA 1MV0B 4GBQA 1OPLA 2RQRA 2ENMA 2JW4A 2VVKA 2M0YA 2EKHA 2DBKA 1KFZA 2HCKA 2A37A 2FPDA 5HCKA 1G83A 2RQWA 1YP5A 4J9HA 1GFCA 1E6GA 1NYFA 1NG2A 1B07A 1OOTA 2PTKA 4J9FA 2EPDA 2K2MA 1X2QA 2CT3A 1WYXA 2K7AA 1WA7A 1Z9QA 1OPKA 1T3SA 2EGEA 2DL4A 2W0ZA 2W10A 2OI3A 2KT1A 1JO8A 2CDTA 3C0CA 2ECZA 2LNHB 2CSIA 1M3BA 3VS0A 3IQLA 4Y92A 4JZ3A 4CC2A 4D8DA 4J9EA 3RNJA 4HVUA 4JJCA 5IHNA 1WX6A 1X6BA 2L3PA 5IHIA 1ZUYA 2DRKA 1SEMA 2DX1A 2EQIA 1GCQC 3REBB 1SHFA 3A98A 1I0CA 3VS2A 1PKSA 2LQWA 1CSKA 2KXCA 2K79A 1K0SA 1G2BA 4RTTA 1CKBA 1AWWA 5L23A 1SRLA 4DEYA 2BZYA 2ED0A 2KYBA 3RBBB 1Z9ZA 3H41A 2RF0A 1X27A 1JXOA 2BTTA 4EIKA 3KFVA 2RN8A 2DMOA 2YUNA 2AZVA 1UUEA 1VYVA 3NHNA 1UHFA 1Y0MA 4HXJA 1FMKA 2KNBB 5I11A 4D8KA 2LZ6B 2DBMA 3EHQA 4IIMA 2JS0A 2DF6A 2CH4A 1WFWA 1QWEA 4RUGA 1SHGA 2MCNA 4Z8AA 2A36A 3ZL7C 2FRWA 2NUZA 2DM1A 2MOXA 4WCIA 4X1VA 3I9QA 2ROLA 4E6RA 3NMZC 4AFZC 2A08A 4LUEA 1QKWA 1WXBA 2H8HA 2KROA 2GQIA 2YDLA 3PE0A 5IH2A 1N5ZA 3R6NA 2OJ2A 2VKNA 1KSWA 4OMMA 1IO6A 2JTEA 1GCPA 2IIMA 1ABOA 2F2VA 1A0NB 1UE9A 5ECAA 2BZ8A 1WLPB 4LN2A 2RQTA 2KR3A 2V1QA 1UFFA 1AWXA 4JJDA 1NEGA 2C0TA 2LJ1A 1UHCA 4RTVA 1W70A 1ZUKA 1GBRA 5I22A 3UATA 2L3SA 2YT6A 2DL8A 1X43A 1WDXA 2AKLA 2HEQA 2MIOA 2J05A 3VS4A 2RPNA 1J3TA 3TVTA 1K1ZA 1VA7A 4ORZA 2DL5A 3QWXX 2X3XD 4F16A 2DNUA 3QWYA 1X2KA 3EG3A 1TUCA 1K4US 2CSQA 2GNCA 2PZ1A 3EG0A 3M0QA 1M27C 2EW3A 1OEBA 4GLMA 3TSWA 3M0SA 4DEXA 2FO0A 3TSZA 4M4ZA 1UJ0A 2YUOA 4AFQC 2F2XA 4JPBW 2RQUA 3M0UA 2EYYA 2DYBA 2CT4A 4QT7A 1YWOA 2O9VA 2B86A 1UDLA 1U5SA 4OMLA 1HD3A 3I5SA 1OV3A 1SRMA 1AWOA 2GGRA 2LJ0A 4K11A 1E7OA 1K0XA 1BU1A 1PRMC 2DRMA 2ROTA 2L2PA 1RLQC 1H3HA 2KEAA
chains in the Genus database with same CATH superfamily
1I81A 1ZQ1A 3EFOA 1YJ9T 2RHZA 1Q81R 1VQ6T 4LUDA 3JCMX 4LE9A 3PTAA 1VYTA 1VQLT 3PVLA 1YCSB 1MMAA 4DQ2A 2VXFA 2NUTB 4M7AD 2K2VA 3C94A 2O88A 1XTDA 1YNZA 1YJNT 4Z02A 1K8AC 2HL3A 3OYYA 5KH6A 5GANf 2BE9B 5KCHA 2RNAA 3JCMP 5AT1B 3M0PA 4CC7A 2DJQA 3OYFA 1QCOA 1FWZA 4GLKA 2F1LA 3GF5A 4QVCA 4RG8A 1M1KR 5FWCA 4AT1B 2YRCA 1Q82C 3SHWA 4J9DA 1NEBA 1QP2A 2RJDA 4A54A 3ER0A 1IHWA 3OYEA 2RK2A 2DL3A 1OI1A 4OF1A 1M2VB 5LJ5h 1RI9A 2GFAA 3R6OA 3PIOA 4BE1A 1XOVA 3LLRA 4RTXA 1SSHA 3QHSA 1VQ8A 1K9MC 2OTJT 3LWIA 1PNJA 2XHCA 5D6WA 2FG0A 3G6ET 1VQ5Q 2XI9A 1OU8A 2M02A 1AD5A 2D8JA 2FB7A 1VQLQ 1I8FA 1PC0A 3JCMJ 1X6OA 3OW2A 3PMTA 3CPWS 3CBMA 3M0TA 4Y91A 1V1CA 2JN0A 4R55A 2RJEA 4X9DA 3CCQA 3HHTB 1C6VX 1TUDA 3CCJT 3HP9A 5GAMj 1T0HA 1Q7YC 2MWPA 2HBWA 1Q81U 1QWFA 1NYGA 5J26A 2F69A 6AT1B 2ZPFB 2XU8A 3CXCP 1PD0A 2ATCB 2JM8A 2ED1A 1Y96B 2KRMA 3VRZA 2SEMA 3VKIA 1AWJA 4J5YA 1K76A 2LQKA 4KUIA 4FSXA 5KE3A 2YLBA 1M1KC 1N9SA 4F17A 1UGVA 2VXEA 3PIPA 3TQ7P 5GANe 3CMAT 3G7ZA 2NLUA 2LCSA 4KH1B 1YJWA 2XD0A 5FW9A 2QDLA 1PWTA 2QTXA 3I35A 1UJYA 2C0IA 2DIGA 3HPWA 3ASKA 3CC2Q 1WNLA 5GAN7 3MHXA 3CC4T 1K9AA 2EGAA 1VQ4T 2HMAA 1VYUA 4IURA 4PFZA 3G6EA 3MPUB 5CCAA 1W4SA 1W1FA 1JXMA 1AOJA 1MMNA 1GFDA 1TG0A 1KHCA 1WI7A 3FC3A 3CCVQ 3WVDB 3HRTA 5CKFA 3C12A 5FROA 1ZUUA 2R57A 2CP5A 3V7SA 3LW5E 1QVGP 4OB2B 2EYQA 4AG1C 3CMAQ 1C1AA 1TWBA 3EG1A 4M77B 1PKTA 3L2QA 4FSSA 1EFNA 2CKKA 2FEIA 3OYAA 1M30A 1T0JA 2KGTA 3THKA 3UA7A 1WXTA 1AT1B 1W6XA 3U23A 1Y57A 3EGXA 1NE8A 3JB9D 3M4GA 2XICA 3M0RA 1U1SA 4XU1A 3SEMA 1MV0B 4GBQA 3KUFA 3CPWP 2ENMA 3OYJA 1VUBA 2DBKA 3CXCA 1HXDA 4IUPA 4KH0B 1GFCA 4M7DA 2E1HA 5CR2A 5IT9E 1QVPA 2E6ZA 4RCCA 2D6FA 1B07A 2DETA 4FT4A 2COZA 3GNGA 3X25B 2EPDA 2E3HA 2K2MA 4LDWA 4OB3B 1DJ7B 1ZBXA 2M16A 2CZ1B 2W10A 3E9FA 2OI3A 1IHVA 2KT1A 3VJPA 1IZ6A 1LNXA 3CC7T 1KG1A 5M9OA 1M3BA 3CCST 3IQLA 1R77A 1M2VA 1N6AA 4C8QA 4FIBA 4E7JA 3RNJA 4HVUA 3INZA 3RKYA 1WQ7A 1WX6A 1ZUYA 2DRKA 1O75A 3CCRQ 2DX1A 1IRXA 3WVEB 2K4YA 5GMKl 1GCQC 1VQ7T 4XK8E 1ZSZB 4BUGA 1I0CA 3VS2A 1K9MU 3OW2P 1MHNA 1K0SA 3CBOA 4RG2A 2X4WA 3CCMA 4RTTA 4NL2A 4CI0C 3CCUA 3PGGA 3PT9A 4JUVA 1CKBA 3CCUT 4FYYB 5L23A 1SRLA 1RAHB 4DEYA 2BZYA 2ED0A 3AHUA 4C92G 1QVGS 2RF0A 1X27A 5KYUB 2BTTA 3KFVA 2DMOA 4V2SA 2QQSA 2X9HA 1S72Q 3NHNA 2XDBA 1RAIB 1UHFA 1Y0MA 3S3NA 3JCMh 5CKBA 3CC2T 5LJ3h 5GAMd 1WPYA 4IIMA 2XK0A 4C0GA 2B8AA 5GAOr 1SHGA 4Z8AA 3CC7A 3ZL7C 2LVMA 5LJ3g 2RHXA 4WCIA 4X1VA 1LOJA 3OA6A 2ROLA 3C95A 3NMZC 2A08A 2KSSA 2QEXT 4LUEA 4LDUA 3BY7A 3A5ZB 2EWNA 4XTYA 2IIMA 1YHQQ 4M78D 1ABOA 5ECAA 1D0YA 1UB4A 2DJZA 4EMHA 4JJDA 3CCRT 1NEGA 1B34B 2PU9B 5GANd 1UHCA 4RTVA 4ATOA 1W70A 1N8RC 2L3SA 1WJRA 2DL8A 4M77D 4KUDK 5CKEA 2AKLA 3TVTA 3HL8A 3SFMA 1VQMA 4R56A 5KYYB 4F16A 3X20B 1V76A 4UC4A 2DNUA 1YFNA 3QWYA 3EG3A 5J3BA 3EG0A 3P8HA 3M0QA 4GLMA 3TSWA 4KGXB 3X26B 1VQNA 4DEXA 5GAMf 2FO0A 2HQHA 2QEXQ 2CP7A 5DLOA 1UJ0A 2QAZA 1K8AU 3WXMB 3S3OA 3OW2S 4HCCA 1WQWA 2CT4A 4F7UA 3QUIA 2DERA 3RDVA 4JLIA 1UDLA 4C8QE 1D3BB 1U5SA 4OMLA 4XQ3A 1OV3A 4N4HA 4F7UB 1VIEA 2K3YA 3OYBA 2MWOA 4K11A 4J7FA 1E7OA 2E65A 1BU1A 3EGDB 4B9WA 2ROTA 4OGCA 3LGFA 1RLQC 1WHGA 2IPOB 4JLGA 1H3HA 4E7IA 1VQ5A 2LC4A 1SG5A 4M7AF 3X24B 4MDWA 4XTWA 2ZPIB 1FX7A 2AK5A 2CP0A 2QGFB 3VU3C 4A63B 4C92D 3QYHB 3SWNA 4CC3A 3RUXA 2M1HA 4JDSA 1MMGA 2ZPGB 3TCJA 1IXDA 5FU7B 2K5IA 4IUVA 4HCBA 4JS4A 4BD3A 1H92A 3OYMA 1G3WA 4AFUC 2DE0X 5LJ3j 2MMPA 4IKFA 2E41A 2NUPA 5IHKA 3G4SA 1BB9A 2GF7A 1K73R 2P0PA 3I55A 3META 2KQWA 4OMPA 2G6FX 1WIEA 4C8QC 1N8RU 4PKCC 3P8BB 3CCRA 4IIOA 3EGUA 3QPHA 5HKCA 2L89A 1D1CA 2E5QA 3HKSA 1HJDA 1G3TA 2RJCA 1PRLC 2EJ9A 3QSUA 1M5Q1 1YJWQ 2HNIA 2PVOB 1B3QA 1YBYA 2DL7A 2LCLA 1ZSZC 1KQ1A 3OYCA 2CP3A 2RA2A 2I0NA 2HD0A 2AT1B 3OS2A 2KDSA 2OX7A 4FW1A 3M54A 4FW2A 5GMKh 3NPFA 4RTUA 2WACA 3CMEA 1OZ2A 5I21A 2VGNA 4M7AB 1VQKQ 4XTXA 1FMVA 3JCMc 3OB9A 2DEQA 3CC2A 5FLXE 3OS1A 2VB6A 1HSQA 4J9IA 1YWPA 1AZGB 4FM4B 3V7RA 2KT8A 2LJ3A 5D6XA 3FJ5A 4M78F 2VWFA 4O6JA 4ANJA 2L8DA 2LDMA 2ZGWA 3E19A 3UA6A 1GBQA 2YRDA 4FYWB 3JCMg 1UGSB 1D0ZA 3I5RA 2MYSA 4PJOE 3QG1A 4C0DB 3M57A 1ZLMA 3GPLA 3VS6A 1ZX6A 2XKOC 3MEAA 3RKWA 1I5LA 1WXUA 1YIJT 2KXDA 1VQ8Q 4FYXB 3J80E 1UTIA 1QW1A 4FYVB 3CMET 4Z88A 2KMTA 4PFOA 3OS0A 3CQTA 1YITA 5FU7C 3VS7A 2O9SA 2JT4A 3QO3A 2EIFA 1FYNA 2DVJA 1YIJA 5GANg 1D1AA 1I1JA 2QQAA 2K3BA 3EG2A 2NWMA 2JS2A 4C0DC 5DLQE 1T3LA 2MI6A 2SRCA 1H641 3OYIA 1M90U 5KYUA 2P0QA 4C8QD 3RKXA 3I56T 1KJWA 4J6XA 2BUDA 2P0KA 2VGMA 3CCEA 1AVZC 2DA9A 5FWBA 2CP2A 1Y07A 2ZAEA 4M77E 2M51A 1ZBJA 3LX7A 1MV3A 3X28B 1PM3A 3KBGA 2ZPEB 4ME7A 2GTOA 1C0MA 1IB8A 4OVAA 3CCLT 2QQBA 1YI2Q 4M75B 2X51A 2DYIA 1Q7YR 4E7SA 1VQ7Q 2FPDA 5HK3A 2OTLA 5FRMA 4A53A 2E10A 1V29B 1OOTA 2PTKA 3JCMb 4J9FA 2XDPA 2K7AA 1Z9QA 1OPKA 3V8KA 2COYA 3M59A 2EKOA 2DL4A 3QZ9B 4QKUA 3A8HB 5LL6S 2CDTA 1D09B 1N8RR 4LXCA 4PJMA 2CSIA 3VS0A 1O9SA 2E4HA 3G4SQ 1WHLA 4JZ3A 4CC2A 4J9EA 5GAMh 2VASA 4JJCA 5IHNA 1PD1A 3BW1A 2R5AA 1YJWT 1X6BA 5IHIA 4QVDA 2M0OA 3I55T 1VOMA 4M7DD 3CC7Q 3G4ST 2PVGB 1YI2T 4A4EA 2X35A 2LNVA 4Y28E 4L6V5 2K79A 5GMKj 1Q82R 1G2BA 2DAQA 5HY6A 4EMGA 5GAOp 1AWWA 4M77A 1UEBA 2L3RA 3JB9G 2KYBA 2RJFA 3E1SA 2F5KA 2AHJB 1BCMA 5GAN5 4C5HA 3CC4Q 4EIKA 1HYOA 2YUNA 1UUEA 1NJIR 5KCOA 4HXJA 1G5VA 4D8KA 2LZ6B 4C92C 5I2MA 3TU4K 4TVRA 3N5BB 2DF6A 5GAN4 4QVZA 3F70A 4RUGA 1Q82U 2MCNA 2A36A 3SWNB 2QYZA 2CZ7B 4DBHA 2A3LA 3I9QA 1K8AR 2ZPBB 1UGRB 5GAMe 4AFZC 1VQNQ 2CZ6B 1WXBA 1Q81C 1VQ9A 2QEXA 1W2BA 3VV0A 2K57A 1NJIU 1VQ8T 1RAAB 2OJ2A 3UDCA 1IO6A 1OQKA 3A8OB 1GCPA 4M75F 3E9GA 1LPLA 1WLPB 4EMKC 2P4TA 2RQTA 3MCAB 1Q86R 3M56A 2LJ1A 1RAFB 2DTHA 3UATA 3TREA 4N0AC 1X43A 2CS7A 1J3TA 2MIOA 1VQMT 2RPNA 4LDVA 5GMKi 1K1ZA 1BI3A 2XIDA 4RKUE 1TH7A 2OTLQ 5CO7A 2MPXC 5GMKm 4GY5A 4C5GA 1K4US 4M78A 5J39A 2VV5A 4C92E 1U8RA 1OEBA 3CCMT 3RMSA 2DXTA 3TSZA 4E7LA 3FRNA 4LD9K 2YUOA 3H9NA 4AFQC 3FEOA 3SDZA 3PNWC 2EYYA 2QTVA 2V8KA 2NUTA 3JAME 3M4YA 3G71Q 2O9VA 1TS9A 2B86A 1K73U 3CCEQ 3V8JA 3I5SA 2DEUA 5GANh 5AYFA 1K0XA 3QBYA 2QA4T 4LDYA 2DRMA 2QA4A 2L2PA 1M1KU 3NFCA 1U1TA 4JRQA 4QW2A 1D1BA 2KEAA 2JMCA 1QCFA 5A0LA 4RTWA 2LCCA 2PNIA 3OYGA 1KHIA 1M3CA 4QQDA 1B7TA 4BI8B 2KBTA 3O5ZA 4ZNXA 3J81E 4JRKA 1BK2A 1GRIA 5IN1A 4JRPA 2NYSA 2CUBA 3JB9F 2DVEA 2QI2A 4F7UE 4HT8A 3URGA 1AZEA 2CREA 2RM4A 2KYMA 2HL5C 3JRZA 4HVVA 1F1BB 2FRYA 5KE2A 1S72T 3MEVA 3ZEHA 1RADB 4MMLA 5IXFA 4WTOB 2HBPA 1I5OB 4JZ4A 2L3QA 3OYNA 2RQVA 4E2FB 3OYDA 3A8LB 4M7DF 2G3RA 4OMFB 2J06A 1JQQA 1M2OA 2YXYA 3JCMd 3QZ5B 8ATCB 1QP3A 1NPRA 5LJ3d 1SPKA 1FXXA 1U06A 3QIIA 1YIJQ 2EYWA 1K9MR 1E6HA 1R0BG 2J6KA 2QQ9A 1ACMB 2LT1A 3H8ZA 3CCSA 4MDXA 2KE9A 2YSQA 2EBPA 2COWA 2ESWA 1H8KA 1TOVA 3VRYA 2GBQA 2J7IA 2K9GA 3NGPA 4J9GA 2JMAA 4JJNK 3RERA 1VQ9T 3I56Q 4IUUA 3OS5A 1S1NA 3P8DA 2DKGA 2LRQA 2JOYA 3ULRB 2CUDA 4XTUA 1VQ4A 2HSPA 4PLIA 4KGVB 3KXTA 3CC4A 2IVWA 2LX7A 3JB9H 1BYMA 5GAN2 1IREB 1I07A 2P4RA 3PMIA 2RI5A 2RHUA 1KC8U 3VS3A 2KRSA 2JM9A 1WHHA 3H0HA 2AKKA 2FPFA 3HSBA 1OX9A 4DBRA 1UECA 1GCQA 4A4FA 1BBZA 2J6FA 4PK4A 3L2VA 4M7AA 3BDUA 1SSFA 1NM7A 2WSCE 1WZOA 1ARKA 4OB1B 1ZHIA 3FJPA 5I2SA 2LP5A 1VQPT 2XMFA 2ABLA 1UG1A 2H3EB 4PJOF 3L2RA 1H3ZA 3MP8A 5A2QE 5EG2A 2AZSA 1MNDA 2E3IA 3EG9B 2GTJA 4J9BA 4RMOA 1Q86C 2O2OA 4AFSC 2Y90A 3CCQT 3FIFA 1IGUA 3OY9A 4BE0A 3EG9A 2DILA 4C0ZA 4HA8A 3CD6Q 4F14A 2L0AA 2O4XA 1YCYA 1AEYA 3MP6A 1X69A 2PQWA 3CEYA 4HVWA 5LJ5j 3CPWA 1PHTA 2BKDN 5C0MA 2LQNA 4ZTJA 4AMCA 2K6DA 3CMAA 4RTYA 3EAEA 3CMEQ 2OTJA 2YHTA 1NPPA 4F7UG 3DB3A 2V1RA 3HRUA 1U3OA 4BI3A 3CXCS 3A8GB 1KK7A 4C8QB 2JXBA 3L42A 3GLXA 1NJIC 2QG9B 4L5GA 2DK3A 2K5FA 5GJWB 4JJBA 3LGLA 4OMOA 2JTMA 4YTLA 4J8OA 3H0IA 4PL6A 3CCJA 1MGQA 2EVRA 1LCKA 2C0OA 1ZSZA 3UF4A 2BE7D 1KIKA 1BI2A 2EYXA 1LJOA 1BKBA 1ZA2B 2JW4A 4FCYA 2M0YA 2OAUA 2EKHA 1KFZA 3I56A 5HCKA 2RQWA 1YP5A 4J6WA 1E6GA 3HFNA 3UPUA 1NG2A 4O5VA 2YRVA 4OP0A 1TUGB 4C92F 4A4HA 4II1A 4VUBA 4ZGEB 1T3SA 2EGEA 1YITQ 2W0ZA 2RHYA 3AT1B 1JO8A 4WF2A 1JJ2A 1JB0E 2ECZA 1YITT 2AIRB 4FT2A 4Y92A 4D8DA 1JJ2S 2DTOA 2FVUA 2V8IA 3A1PA 5KYXB 2L3PA 1WHJA 5GAOq 1SEMA 2EQIA 2A0FB 3REBB 5IAYA 2LX9A 4LDXA 4ELZC 4M75E 1CSKA 2GCXA 4JRIA 3L2ZA 4EMKA 1I4K1 4C8QG 1BCOA 5FU6B 4J83A 1VQKT 1RACB 4P5NA 2I2LA 1JXOA 2VYTA 3EFRA 3JCMe 2FHDA 2BIVA 2RN8A 2AZVA 2FZCB 5GAMg 1FMKA 5FRNA 1EX4A 2QK0A 2FZGB 3GNFB 1YJ9A 1M9SA 2JS0A 2ZPHB 4FL6A 3SB2A 1RI0A 1WFWA 4A4KA 1W2BS 3EGDA 2QGGA 4M78C 2JTFA 3G71A 1BI1A 2PUOB 4NS5A 1QVFA 3HFOA 2NUZA 5CVIA 2O4XB 2WSFE 2DM1A 1EIFA 2MOXA 4BE2A 4E6RA 4OB0B 2QDYB 2KROA 2GQIA 4ZTFA 1M1GA 2YDLA 3UT1A 1YHQT 2QXFA 3R6NA 2JJ9A 8AT1B 4X34A 3C4SA 1KSWA 3CCVT 1VQPQ 5LJ5f 1UE9A 3ZBDA 4BY6C 5HK0A 4M75C 4PJLA 1UFFA 4ZN1A 3J7AF 1AWXA 3VYGA 2MK5A 1ZUKA 1GBRA 4IUTA 3OSSC 2ZCFB 2HEQA 4C92B 3JCMQ 1SF9A 5L8RE 1VA7A 3PFSA 2DL5A 3JCMW 3OQ5A 4XU3A 4DOVA 4C92A 1X2KA 2CSQA 1QVFP 4BDZA 2EQUA 3M53A 5D7UA 1M27C 2EW3A 3OYKA 5FU6C 3M0SA 1OULA 2GQVA 5C6SA 1VQMQ 4M4ZA 4M77F 2EJFA 4JPBW 3M0UA 1OX8A 4M7DC 4B6MA 4XU2A 1WJSA 4QT7A 1YWOA 1JRIA 2DTIA 4A4GA 1KQSS 1HD3A 3V8LA 5GAN6 1SRMA 1TU0B 2GGRA 2Y4XA 1N9RA 3BDLA 3CCJQ 2X4XA 4BI4A 1PRMC 4Q5WA 4E7KA 1GXIE 5CQXA 2V26A 3NTIA 1IGQA 2RH2A 4MMKA 4PJOC 2Y4YA 4B9XA 3M58A 1KD1R 5GAN8 5LJ5g 1EZZB 1M8MA 2RI3A 5GAOn 1VQ4Q 3CCSQ 2V8JA 2D1XA 4HKEA 4AG2C 3CCLQ 4F04B 5GAOl 1MNEA 2YUPA 2HSEB 4XTZA 4E47A 2X3WD 1ABQA 5CQYA 1D0XA 5LJ3e 1KQ2A 4E7HA 1LVKA 1RUWA 2KRNA 1W2BP 2D8HA 3MEUA 2DXCA 1YI2A 2EFIA 2E5KA 7AT1B 3GP8A 4CRIA 2CGHA 3L1AA 3GBQA 3JB9I 2CZ0B 1JU5C 1ZSGA 5CKHA 2WSEE 2PVDB 2VC8A 3Q1JA 4ESRA 5KYWB 2LMJA 2XDDA 1GL5A 4M78G 4M77C 2EQJA 1RAGB 2FZKB 3NTKA 2EQMA 1M90R 4EMKB 4M7AG 3I55Q 2DFUA 4OMQA 2HQEA 4ELYC 3H0FA 3RMQA 3HTRA 3A8MB 4BB7A 4RCBA 1RL2A 4E7ZA 5GMKe 2QA4Q 1D3BA 3MO8A 3QYGB 3LH0A 3VS1A 2K3XA 2KK4A 1VQOA 1VIFA 5GJVB 2A7YA 1HK9A 4QQ6A 3DLMA 2J6OA 3PVQA 1JEGA 1NZ9A 1QVGA 5DM7R 2D0NA 1JBMA 3CBPA 1SKUB 1Q7YU 1NLPC 4PJOA 1KQSP 1VQ6Q 1NLOC 5CK9A 2ZZDA 3T9NA 5KYNA 3G1JA 3VUZA 4DBFA 4PJNA 2MF2A 2MAMA 2DIQA 1CKAA 2YUQA 1MUZA 2NUPB 3S6WA 3UWNA 1XNIA 2M9UA 2KAFA 2LT4A 4EPCA 5DY9A 5EC7A 1Q95G 2LQ8A 1QLYA 2E70A 2HDAA 4CC4B 1VQKA 5IXBA 4HCZA 4M77G 2GFUA 1KD1U 3LWHA 2KY9A 1R8OB 1K73C 2L5QA 4PJOD 4R0KA 4HCKA 3MJXA 3VS5A 3DB4A 2EGCA 3EGXB 2F2WA 3LH5A 3SD4A 3ZFJA 1M8VA 1VQLA 4RTZA 4J7IA 4BACA 2BZXA 1M3AA 4D6WA 3HRSA 2F5TX 5GAOm 3CCQQ 2O31A 2YWWA 1YN8A 3MKDA 4N4IA 2DXUA 2A28A 1R0CB 1QKXA 1M90C 1PSFA 1ZA1B 3V7CA 1BI0A 4KRTA 1G3YA 2RMOA 2HKQB 4F7UF 2CP6A 2CH4W 5CIUA 1X01A 3JCMf 3OYHA 2DLPA 5A0DA 3M55A 1XQHA 5LJ3f 1YJNQ 4KT0E 2DD4A 3EHRA 4OMNA 3S3MA 3JV3A 2EYZA 3REAB 4MZPA 4Z89A 3OBWA 3LYIA 3RESA 1WHMA 2FPEA 4LNPA 4DA4A 1JJ2P 4C5EA 1TSFA 1RLPC 1X6GA 2CYZB 2YLCA 2OAWA 4PNOA 2RHIA 3O8VA 4J9CA 1QMCA 2EJGA 4LD6A 4C5IA 2HQXA 3OSVA 2HZYA 1B34A 2EAYA 4PFPA 2JUFA 4MZTA 1OPLA 2RQRA 1NBEB 2VVKA 4KGZB 2FL7A 3QDRB 2VUBA 2HCKA 2A37A 3H6ZA 1M4ZA 2D9TA 1G83A 2RK1A 3DLLA 4J9HA 3MP1A 1NYFA 4L59A 1BIAA 4DOWA 3L2WA 1FMWA 4X9CA 4DBQA 2DZCA 4ZGDB 2RI2A 3CD6A 5A0GA 1VQOT 2D0QB 3M5AA 5CKDA 2E12A 5GAN3 1X2QA 2CT3A 2Z0WA 1WYXA 3QXEB 1WA7A 2DXBA 1N27A 1MMDA 2LTOA 2DD5A 1WHKA 1TTHB 1QCNA 3GOXA 3SWNC 3DKMA 3C0CA 3EFOB 2LNHB 3OYLA 5KYWA 2X4JA 3L2UA 4FU6A 4XU0A 5LJ5e 1YJ9Q 2P84A 1QQJA 3QKJA 3EH1A 1G3SA 1SHFA 3A98A 1PKSA 2LQWA 1KQSA 2JZ2A 4C8QF 2KXCA 3G6EQ 2C06A 3JB9J 3TEEA 2RD1A 4C0FA 4M75A 9ATCB 3D7SB 1RAEB 1WJQA 3ME9A 4M75G 1Z9ZA 3RBBB 1VQPA 3H41A 2FYKA 2RB6A 4MZMA 3BFMA 3VUBA 3GIBA 4JS5A 1VYVA 3EFSA 4XAXB 3NTHA 4M75D 2KNBB 5I11A 1VQ5T 3OBYA 2QQRA 3RIRA 2PUKB 1BIBA 2DBMA 3EHQA 4M7AC 2EQKA 4PLLA 1X75C 1VQ9Q 2CH4A 1QWEA 3QJ6A 5LJ5d 2KI7A 3OMGA 2DO3A 3CPFA 3FDRA 2HAXA 2FRWA 1Y7XA 3QJYA 1KD1C 3M9QA 1QKWA 2H8HA 2DZ9A 3CCMQ 4N0AA 3PE0A 5IH2A 1N5ZA 3CD6T 4PJOG 2E6NA 4M7DB 1M1FA 2E64A 2VKNA 4M78E 4OMMA 4PJJA 1PCXA 2JTEA 4PJOB 1OU9A 2F2VA 1UGPB 1A0NB 2BZ8A 4ZN3A 2OTLT 1VQNT 4LN2A 2KR3A 2V1QA 4HT9A 2C0TA 1QVFS 1XJWB 2K5LA 3CCLA 5GANj 5I22A 2RO0A 2YT6A 4KULA 5KYYA 3QDFA 3CCUQ 4BDYA 1WDXA 4N4GA 2J05A 3VS4A 4ZGJB 3VYHB 2DPPB 4ORZA 2R5MA 2QASA 3QWXX 2X3XD 4XTVA 2HKNA 1AHJB 2JNGA 1S72A 1TUCA 2GNCA 1Y96A 1Y71A 1P92A 3CCET 2PZ1A 3JCMV 3FB9A 5CAIA 2H3JA 4BY6B 4M7AE 3MEWA 1VQOQ 3E2UA 1YJNA 3CCVA 2F2XA 1KC8R 2RQUA 1OZ3A 2DYBA 5D6YA 1RABB 1YHQA 3EH2A 1KC8C 1VQ7A 4KBMB 3FLGA 4IUQA 4NOYA 3OMCA 4EDUA 2O01E 2KVQG 4M7DG 1UGQB 5KYXA 1VQ6A 1AWOA 2IG0A 2R58A 2XG8D 1OYXA 2LJ0A 2JVVA 3RR6A 2X4YA 4QQGA 4NL3A 1WGSA 1PG5B 4OGEA 3G71T 4M78B 1TXQA 1PSEA 3BE3A 1Q86U 4J6YA 3JSCA 2OTJQ 4M7DE 1G8XA
chains in the Genus database with same CATH topology
2JMCA 1QCFA 4LUDA 4LE9A 1VYTA 4RTWA 2PNIA 1M8MA 3PVLA 1M3CA 1YCSB 2D1XA 4AG2C 2AK5A 2KBTA 3O5ZA 4ZNXA 4A63B 2O88A 2YUPA 1BK2A 1GRIA 1YNZA 4CC3A 2CUBA 2RNAA 1AZEA 2CREA 3M0PA 2KYMA 2X3WD 1ABQA 4HVVA 2DJQA 4CC7A 2FRYA 5IXFA 1H92A 1RUWA 2KRNA 4AFUC 2DE0X 4JZ4A 2L3QA 5FWCA 2RQVA 2D8HA 2E5KA 5IHKA 3SHWA 1BB9A 1JQQA 2J06A 4J9DA 1NEBA 3GBQA 4OMPA 1SPKA 2G6FX 1U06A 1WIEA 1JU5C 1ZSGA 2DL3A 2EYWA 1E6HA 4ESRA 2J6KA 1RI9A 4IIOA 3EGUA 2LMJA 1GL5A 1HJDA 2KE9A 1XOVA 2YSQA 4RTXA 1SSHA 4OMQA 1PRLC 2EBPA 3H0FA 2ESWA 1H8KA 3VRYA 1B3QA 2GBQA 2J7IA 2K9GA 3NGPA 4J9GA 2JMAA 1PNJA 2DL7A 1S1NA 2FG0A 3VS1A 3ULRB 2CUDA 5GJVB 2HSPA 1AD5A 2I0NA 2J6OA 2LX7A 2D8JA 3PVQA 1JEGA 1I07A 2P4RA 3NPFA 4RTUA 2D0NA 3VS3A 2KRSA 2JM9A 1NLPC 3H0HA 2AKKA 2FPFA 3M0TA 1NLOC 1V1CA 1UECA 1GCQA 1BBZA 1HSQA 4J9IA 1YWPA 2J6FA 1AZGB 1CKAA 2YUQA 1MUZA 1TUDA 2KT8A 2LJ3A 1NM7A 1ARKA 3FJ5A 5EC7A 1QLYA 1T0HA 2VWFA 2LP5A 2HDAA 2HBWA 2XMFA 4CC4B 2ABLA 1QWFA 5IXBA 1NYGA 1UG1A 2JM8A 3UA6A 1GBQA 2ED1A 4R0KA 2AZSA 4HCKA 2KRMA 3VRZA 2SEMA 1AWJA 3VS5A 1K76A 3I5RA 2GTJA 2EGCA 4J9BA 2F2WA 2O2OA 4AFSC 4F17A 1UGVA 1ZLMA 3LH5A 3VS6A 2LCSA 1ZX6A 4RTZA 1WXUA 2DILA 2KXDA 5FW9A 2BZXA 1PWTA 2QDLA 3I35A 2L0AA 1UJYA 1M3AA 2C0IA 4F14A 1AEYA 1UTIA 1X69A 4Z88A 4HVWA 3CQTA 2O31A 1YN8A 1K9AA 2EGAA 3VS7A 2O9SA 2JT4A 1PHTA 2A28A 1VYUA 1FYNA 2DVJA 1QKXA 1I1JA 2K3BA 4KRTA 2LQNA 2RMOA 3EG2A 1W1FA 2K6DA 4RTYA 1JXMA 2CH4W 2NWMA 2JS2A 1AOJA 1GFDA 1TG0A 2DLPA 1T3LA 1WI7A 2SRCA 2V1RA 1ZUUA 3EHRA 4OMNA 1U3OA 3JV3A 1KJWA 2JXBA 4AG1C 2EYZA 3REAB 3EG1A 1AVZC 1PKTA 2DA9A 5FWBA 5GJWB 4JJBA 4Z89A 4OMOA 2FPEA 4LNPA 4FSSA 1EFNA 3H0IA 2M51A 2FEIA 1M30A 1ZBJA 1T0JA 1MV3A 1RLPC 1X6GA 2KGTA 3THKA 3UA7A 2OAWA 1WXTA 1LCKA 2EVRA 1W6XA 2C0OA 3UF4A 3U23A 1Y57A 4J9CA 1KIKA 2GTOA 3M0RA 2EYXA 3SEMA 1MV0B 4GBQA 1OPLA 2RQRA 2ENMA 2JW4A 2VVKA 2M0YA 2EKHA 2DBKA 1KFZA 2HCKA 2A37A 2FPDA 5HCKA 1G83A 2RQWA 1YP5A 4J9HA 1GFCA 1E6GA 1NYFA 1NG2A 1B07A 1OOTA 2PTKA 4J9FA 2EPDA 2K2MA 1X2QA 2CT3A 1WYXA 2K7AA 1WA7A 1Z9QA 1OPKA 1T3SA 2EGEA 2DL4A 2W0ZA 2W10A 2OI3A 2KT1A 1JO8A 2CDTA 3C0CA 2ECZA 2LNHB 2CSIA 1M3BA 3VS0A 3IQLA 4Y92A 4JZ3A 4CC2A 4D8DA 4J9EA 3RNJA 4HVUA 4JJCA 5IHNA 1WX6A 1X6BA 2L3PA 5IHIA 1ZUYA 2DRKA 1SEMA 2DX1A 2EQIA 1GCQC 3REBB 1SHFA 3A98A 1I0CA 3VS2A 1PKSA 2LQWA 1CSKA 2KXCA 2K79A 1K0SA 1G2BA 4RTTA 1CKBA 1AWWA 5L23A 1SRLA 4DEYA 2BZYA 2ED0A 2KYBA 3RBBB 1Z9ZA 3H41A 2RF0A 1X27A 1JXOA 2BTTA 4EIKA 3KFVA 2RN8A 2DMOA 2YUNA 2AZVA 1UUEA 1VYVA 3NHNA 1UHFA 1Y0MA 4HXJA 1FMKA 2KNBB 5I11A 4D8KA 2LZ6B 2DBMA 3EHQA 4IIMA 2JS0A 2DF6A 2CH4A 1WFWA 1QWEA 4RUGA 1SHGA 2MCNA 4Z8AA 2A36A 3ZL7C 2FRWA 2NUZA 2DM1A 2MOXA 4WCIA 4X1VA 3I9QA 2ROLA 4E6RA 3NMZC 4AFZC 2A08A 4LUEA 1QKWA 1WXBA 2H8HA 2KROA 2GQIA 2YDLA 3PE0A 5IH2A 1N5ZA 3R6NA 2OJ2A 2VKNA 1KSWA 4OMMA 1IO6A 2JTEA 1GCPA 2IIMA 1ABOA 2F2VA 1A0NB 1UE9A 5ECAA 2BZ8A 1WLPB 4LN2A 2RQTA 2KR3A 2V1QA 1UFFA 1AWXA 4JJDA 1NEGA 2C0TA 2LJ1A 1UHCA 4RTVA 1W70A 1ZUKA 1GBRA 5I22A 3UATA 2L3SA 2YT6A 2DL8A 1X43A 1WDXA 2AKLA 2HEQA 2MIOA 2J05A 3VS4A 2RPNA 1J3TA 3TVTA 1K1ZA 1VA7A 4ORZA 2DL5A 3QWXX 2X3XD 4F16A 2DNUA 3QWYA 1X2KA 3EG3A 1TUCA 1K4US 2CSQA 2GNCA 2PZ1A 3EG0A 3M0QA 1M27C 2EW3A 1OEBA 4GLMA 3TSWA 3M0SA 4DEXA 2FO0A 3TSZA 4M4ZA 1UJ0A 2YUOA 4AFQC 2F2XA 4JPBW 2RQUA 3M0UA 2EYYA 2DYBA 2CT4A 4QT7A 1YWOA 2O9VA 2B86A 1UDLA 1U5SA 4OMLA 1HD3A 3I5SA 1OV3A 1SRMA 1AWOA 2GGRA 2LJ0A 4K11A 1E7OA 1K0XA 1BU1A 1PRMC 2DRMA 2ROTA 2L2PA 1RLQC 1H3HA 2KEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMC A;  1QCF A;  4LUD A;  4LE9 A;  1VYT A;  4RTW A;  2PNI A;  1M8M A;  3PVL A;  1M3C A;  1YCS B;  2D1X A;  4AG2 C;  2AK5 A;  2KBT A;  3O5Z A;  4ZNX A;  4A63 B;  2O88 A;  2YUP A;  1BK2 A;  1GRI A;  1YNZ A;  4CC3 A;  2CUB A;  2RNA A;  1AZE A;  2CRE A;  3M0P A;  2KYM A;  2X3W D;  1ABQ A;  4HVV A;  2DJQ A;  4CC7 A;  2FRY A;  5IXF A;  1H92 A;  1RUW A;  2KRN A;  4AFU C;  2DE0 X;  4JZ4 A;  2L3Q A;  5FWC A;  2RQV A;  2D8H A;  2E5K A;  5IHK A;  3SHW A;  1BB9 A;  1JQQ A;  2J06 A;  4J9D A;  1NEB A;  3GBQ A;  4OMP A;  1SPK A;  2G6F X;  1U06 A;  1WIE A;  1JU5 C;  1ZSG A;  2DL3 A;  2EYW A;  1E6H A;  4ESR A;  2J6K A;  1RI9 A;  4IIO A;  3EGU A;  2LMJ A;  1GL5 A;  1HJD A;  2KE9 A;  1XOV A;  2YSQ A;  4RTX A;  1SSH A;  4OMQ A;  1PRL C;  2EBP A;  3H0F A;  2ESW A;  1H8K A;  3VRY A;  1B3Q A;  2GBQ A;  2J7I A;  2K9G A;  3NGP A;  4J9G A;  2JMA A;  1PNJ A;  2DL7 A;  1S1N A;  2FG0 A;  3VS1 A;  3ULR B;  2CUD A;  5GJV B;  2HSP A;  1AD5 A;  2I0N A;  2J6O A;  2LX7 A;  2D8J A;  3PVQ A;  1JEG A;  1I07 A;  2P4R A;  3NPF A;  4RTU A;  2D0N A;  3VS3 A;  2KRS A;  2JM9 A;  1NLP C;  3H0H A;  2AKK A;  2FPF A;  3M0T A;  1NLO C;  1V1C A;  1UEC A;  1GCQ A;  1BBZ A;  1HSQ A;  4J9I A;  1YWP A;  2J6F A;  1AZG B;  1CKA A;  2YUQ A;  1MUZ A;  1TUD A;  2KT8 A;  2LJ3 A;  1NM7 A;  1ARK A;  3FJ5 A;  5EC7 A;  1QLY A;  1T0H A;  2VWF A;  2LP5 A;  2HDA A;  2HBW A;  2XMF A;  4CC4 B;  2ABL A;  1QWF A;  5IXB A;  1NYG A;  1UG1 A;  2JM8 A;  3UA6 A;  1GBQ A;  2ED1 A;  4R0K A;  2AZS A;  4HCK A;  2KRM A;  3VRZ A;  2SEM A;  1AWJ A;  3VS5 A;  1K76 A;  3I5R A;  2GTJ A;  2EGC A;  4J9B A;  2F2W A;  2O2O A;  4AFS C;  4F17 A;  1UGV A;  1ZLM A;  3LH5 A;  3VS6 A;  2LCS A;  1ZX6 A;  4RTZ A;  1WXU A;  2DIL A;  2KXD A;  5FW9 A;  2BZX A;  1PWT A;  2QDL A;  3I35 A;  2L0A A;  1UJY A;  1M3A A;  2C0I A;  4F14 A;  1AEY A;  1UTI A;  1X69 A;  4Z88 A;  4HVW A;  3CQT A;  2O31 A;  1YN8 A;  1K9A A;  2EGA A;  3VS7 A;  2O9S A;  2JT4 A;  1PHT A;  2A28 A;  1VYU A;  1FYN A;  2DVJ A;  1QKX A;  1I1J A;  2K3B A;  4KRT A;  2LQN A;  2RMO A;  3EG2 A;  1W1F A;  2K6D A;  4RTY A;  1JXM A;  2CH4 W;  2NWM A;  2JS2 A;  1AOJ A;  1GFD A;  1TG0 A;  2DLP A;  1T3L A;  1WI7 A;  2SRC A;  2V1R A;  1ZUU A;  3EHR A;  4OMN A;  1U3O A;  3JV3 A;  1KJW A;  2JXB A;  4AG1 C;  2EYZ A;  3REA B;  3EG1 A;  1AVZ C;  1PKT A;  2DA9 A;  5FWB A;  5GJW B;  4JJB A;  4Z89 A;  4OMO A;  2FPE A;  4LNP A;  4FSS A;  1EFN A;  3H0I A;  2M51 A;  2FEI A;  1M30 A;  1ZBJ A;  1T0J A;  1MV3 A;  1RLP C;  1X6G A;  2KGT A;  3THK A;  3UA7 A;  2OAW A;  1WXT A;  1LCK A;  2EVR A;  1W6X A;  2C0O A;  3UF4 A;  3U23 A;  1Y57 A;  4J9C A;  1KIK A;  2GTO A;  3M0R A;  2EYX A;  3SEM A;  1MV0 B;  4GBQ A;  1OPL A;  2RQR A;  2ENM A;  2JW4 A;  2VVK A;  2M0Y A;  2EKH A;  2DBK A;  1KFZ A;  2HCK A;  2A37 A;  2FPD A;  5HCK A;  1G83 A;  2RQW A;  1YP5 A;  4J9H A;  1GFC A;  1E6G A;  1NYF A;  1NG2 A;  1B07 A;  1OOT A;  2PTK A;  4J9F A;  2EPD A;  2K2M A;  1X2Q A;  2CT3 A;  1WYX A;  2K7A A;  1WA7 A;  1Z9Q A;  1OPK A;  1T3S A;  2EGE A;  2DL4 A;  2W0Z A;  2W10 A;  2OI3 A;  2KT1 A;  1JO8 A;  2CDT A;  3C0C A;  2ECZ A;  2LNH B;  2CSI A;  1M3B A;  3VS0 A;  3IQL A;  4Y92 A;  4JZ3 A;  4CC2 A;  4D8D A;  4J9E A;  3RNJ A;  4HVU A;  4JJC A;  5IHN A;  1WX6 A;  1X6B A;  2L3P A;  5IHI A;  1ZUY A;  2DRK A;  1SEM A;  2DX1 A;  2EQI A;  1GCQ C;  3REB B;  1SHF A;  3A98 A;  1I0C A;  3VS2 A;  1PKS A;  2LQW A;  1CSK A;  2KXC A;  2K79 A;  1K0S A;  1G2B A;  4RTT A;  1CKB A;  1AWW A;  5L23 A;  1SRL A;  4DEY A;  2BZY A;  2ED0 A;  2KYB A;  3RBB B;  1Z9Z A;  3H41 A;  2RF0 A;  1X27 A;  1JXO A;  2BTT A;  4EIK A;  3KFV A;  2RN8 A;  2DMO A;  2YUN A;  2AZV A;  1UUE A;  1VYV A;  3NHN A;  1UHF A;  1Y0M A;  4HXJ A;  1FMK A;  2KNB B;  5I11 A;  4D8K A;  2LZ6 B;  2DBM A;  3EHQ A;  4IIM A;  2JS0 A;  2DF6 A;  2CH4 A;  1WFW A;  1QWE A;  4RUG A;  1SHG A;  2MCN A;  4Z8A A;  2A36 A;  3ZL7 C;  2FRW A;  2NUZ A;  2DM1 A;  2MOX A;  4WCI A;  4X1V A;  3I9Q A;  2ROL A;  4E6R A;  3NMZ C;  4AFZ C;  2A08 A;  4LUE A;  1QKW A;  1WXB A;  2H8H A;  2KRO A;  2GQI A;  2YDL A;  3PE0 A;  5IH2 A;  1N5Z A;  3R6N A;  2OJ2 A;  2VKN A;  1KSW A;  4OMM A;  1IO6 A;  2JTE A;  1GCP A;  2IIM A;  1ABO A;  2F2V A;  1A0N B;  1UE9 A;  5ECA A;  2BZ8 A;  1WLP B;  4LN2 A;  2RQT A;  2KR3 A;  2V1Q A;  1UFF A;  1AWX A;  4JJD A;  1NEG A;  2C0T A;  2LJ1 A;  1UHC A;  4RTV A;  1W70 A;  1ZUK A;  1GBR A;  5I22 A;  3UAT A;  2L3S A;  2YT6 A;  2DL8 A;  1X43 A;  1WDX A;  2AKL A;  2HEQ A;  2MIO A;  2J05 A;  3VS4 A;  2RPN A;  1J3T A;  3TVT A;  1K1Z A;  1VA7 A;  4ORZ A;  2DL5 A;  3QWX X;  2X3X D;  4F16 A;  2DNU A;  3QWY A;  1X2K A;  3EG3 A;  1TUC A;  1K4U S;  2CSQ A;  2GNC A;  2PZ1 A;  3EG0 A;  3M0Q A;  1M27 C;  2EW3 A;  1OEB A;  4GLM A;  3TSW A;  3M0S A;  4DEX A;  2FO0 A;  3TSZ A;  4M4Z A;  1UJ0 A;  2YUO A;  4AFQ C;  2F2X A;  4JPB W;  2RQU A;  3M0U A;  2EYY A;  2DYB A;  2CT4 A;  4QT7 A;  1YWO A;  2O9V A;  2B86 A;  1UDL A;  1U5S A;  4OML A;  1HD3 A;  3I5S A;  1OV3 A;  1SRM A;  1AWO A;  2GGR A;  2LJ0 A;  4K11 A;  1E7O A;  1K0X A;  1BU1 A;  1PRM C;  2DRM A;  2ROT A;  2L2P A;  1RLQ C;  1H3H A;  2KEA A; 
#chains in the Genus database with same CATH topology
 1I81 A;  1ZQ1 A;  3EFO A;  1YJ9 T;  2RHZ A;  1Q81 R;  1VQ6 T;  4LUD A;  3JCM X;  4LE9 A;  3PTA A;  1VYT A;  1VQL T;  3PVL A;  1YCS B;  1MMA A;  4DQ2 A;  2VXF A;  2NUT B;  4M7A D;  2K2V A;  3C94 A;  2O88 A;  1XTD A;  1YNZ A;  1YJN T;  4Z02 A;  1K8A C;  2HL3 A;  3OYY A;  5KH6 A;  5GAN f;  2BE9 B;  5KCH A;  2RNA A;  3JCM P;  5AT1 B;  3M0P A;  4CC7 A;  2DJQ A;  3OYF A;  1QCO A;  1FWZ A;  4GLK A;  2F1L A;  3GF5 A;  4QVC A;  4RG8 A;  1M1K R;  5FWC A;  4AT1 B;  2YRC A;  1Q82 C;  3SHW A;  4J9D A;  1NEB A;  1QP2 A;  2RJD A;  4A54 A;  3ER0 A;  1IHW A;  3OYE A;  2RK2 A;  2DL3 A;  1OI1 A;  4OF1 A;  1M2V B;  5LJ5 h;  1RI9 A;  2GFA A;  3R6O A;  3PIO A;  4BE1 A;  1XOV A;  3LLR A;  4RTX A;  1SSH A;  3QHS A;  1VQ8 A;  1K9M C;  2OTJ T;  3LWI A;  1PNJ A;  2XHC A;  5D6W A;  2FG0 A;  3G6E T;  1VQ5 Q;  2XI9 A;  1OU8 A;  2M02 A;  1AD5 A;  2D8J A;  2FB7 A;  1VQL Q;  1I8F A;  1PC0 A;  3JCM J;  1X6O A;  3OW2 A;  3PMT A;  3CPW S;  3CBM A;  3M0T A;  4Y91 A;  1V1C A;  2JN0 A;  4R55 A;  2RJE A;  4X9D A;  3CCQ A;  3HHT B;  1C6V X;  1TUD A;  3CCJ T;  3HP9 A;  5GAM j;  1T0H A;  1Q7Y C;  2MWP A;  2HBW A;  1Q81 U;  1QWF A;  1NYG A;  5J26 A;  2F69 A;  6AT1 B;  2ZPF B;  2XU8 A;  3CXC P;  1PD0 A;  2ATC B;  2JM8 A;  2ED1 A;  1Y96 B;  2KRM A;  3VRZ A;  2SEM A;  3VKI A;  1AWJ A;  4J5Y A;  1K76 A;  2LQK A;  4KUI A;  4FSX A;  5KE3 A;  2YLB A;  1M1K C;  1N9S A;  4F17 A;  1UGV A;  2VXE A;  3PIP A;  3TQ7 P;  5GAN e;  3CMA T;  3G7Z A;  2NLU A;  2LCS A;  4KH1 B;  1YJW A;  2XD0 A;  5FW9 A;  2QDL A;  1PWT A;  2QTX A;  3I35 A;  1UJY A;  2C0I A;  2DIG A;  3HPW A;  3ASK A;  3CC2 Q;  1WNL A;  5GAN 7;  3MHX A;  3CC4 T;  1K9A A;  2EGA A;  1VQ4 T;  2HMA A;  1VYU A;  4IUR A;  4PFZ A;  3G6E A;  3MPU B;  5CCA A;  1W4S A;  1W1F A;  1JXM A;  1AOJ A;  1MMN A;  1GFD A;  1TG0 A;  1KHC A;  1WI7 A;  3FC3 A;  3CCV Q;  3WVD B;  3HRT A;  5CKF A;  3C12 A;  5FRO A;  1ZUU A;  2R57 A;  2CP5 A;  3V7S A;  3LW5 E;  1QVG P;  4OB2 B;  2EYQ A;  4AG1 C;  3CMA Q;  1C1A A;  1TWB A;  3EG1 A;  4M77 B;  1PKT A;  3L2Q A;  4FSS A;  1EFN A;  2CKK A;  2FEI A;  3OYA A;  1M30 A;  1T0J A;  2KGT A;  3THK A;  3UA7 A;  1WXT A;  1AT1 B;  1W6X A;  3U23 A;  1Y57 A;  3EGX A;  1NE8 A;  3JB9 D;  3M4G A;  2XIC A;  3M0R A;  1U1S A;  4XU1 A;  3SEM A;  1MV0 B;  4GBQ A;  3KUF A;  3CPW P;  2ENM A;  3OYJ A;  1VUB A;  2DBK A;  3CXC A;  1HXD A;  4IUP A;  4KH0 B;  1GFC A;  4M7D A;  2E1H A;  5CR2 A;  5IT9 E;  1QVP A;  2E6Z A;  4RCC A;  2D6F A;  1B07 A;  2DET A;  4FT4 A;  2COZ A;  3GNG A;  3X25 B;  2EPD A;  2E3H A;  2K2M A;  4LDW A;  4OB3 B;  1DJ7 B;  1ZBX A;  2M16 A;  2CZ1 B;  2W10 A;  3E9F A;  2OI3 A;  1IHV A;  2KT1 A;  3VJP A;  1IZ6 A;  1LNX A;  3CC7 T;  1KG1 A;  5M9O A;  1M3B A;  3CCS T;  3IQL A;  1R77 A;  1M2V A;  1N6A A;  4C8Q A;  4FIB A;  4E7J A;  3RNJ A;  4HVU A;  3INZ A;  3RKY A;  1WQ7 A;  1WX6 A;  1ZUY A;  2DRK A;  1O75 A;  3CCR Q;  2DX1 A;  1IRX A;  3WVE B;  2K4Y A;  5GMK l;  1GCQ C;  1VQ7 T;  4XK8 E;  1ZSZ B;  4BUG A;  1I0C A;  3VS2 A;  1K9M U;  3OW2 P;  1MHN A;  1K0S A;  3CBO A;  4RG2 A;  2X4W A;  3CCM A;  4RTT A;  4NL2 A;  4CI0 C;  3CCU A;  3PGG A;  3PT9 A;  4JUV A;  1CKB A;  3CCU T;  4FYY B;  5L23 A;  1SRL A;  1RAH B;  4DEY A;  2BZY A;  2ED0 A;  3AHU A;  4C92 G;  1QVG S;  2RF0 A;  1X27 A;  5KYU B;  2BTT A;  3KFV A;  2DMO A;  4V2S A;  2QQS A;  2X9H A;  1S72 Q;  3NHN A;  2XDB A;  1RAI B;  1UHF A;  1Y0M A;  3S3N A;  3JCM h;  5CKB A;  3CC2 T;  5LJ3 h;  5GAM d;  1WPY A;  4IIM A;  2XK0 A;  4C0G A;  2B8A A;  5GAO r;  1SHG A;  4Z8A A;  3CC7 A;  3ZL7 C;  2LVM A;  5LJ3 g;  2RHX A;  4WCI A;  4X1V A;  1LOJ A;  3OA6 A;  2ROL A;  3C95 A;  3NMZ C;  2A08 A;  2KSS A;  2QEX T;  4LUE A;  4LDU A;  3BY7 A;  3A5Z B;  2EWN A;  4XTY A;  2IIM A;  1YHQ Q;  4M78 D;  1ABO A;  5ECA A;  1D0Y A;  1UB4 A;  2DJZ A;  4EMH A;  4JJD A;  3CCR T;  1NEG A;  1B34 B;  2PU9 B;  5GAN d;  1UHC A;  4RTV A;  4ATO A;  1W70 A;  1N8R C;  2L3S A;  1WJR A;  2DL8 A;  4M77 D;  4KUD K;  5CKE A;  2AKL A;  3TVT A;  3HL8 A;  3SFM A;  1VQM A;  4R56 A;  5KYY B;  4F16 A;  3X20 B;  1V76 A;  4UC4 A;  2DNU A;  1YFN A;  3QWY A;  3EG3 A;  5J3B A;  3EG0 A;  3P8H A;  3M0Q A;  4GLM A;  3TSW A;  4KGX B;  3X26 B;  1VQN A;  4DEX A;  5GAM f;  2FO0 A;  2HQH A;  2QEX Q;  2CP7 A;  5DLO A;  1UJ0 A;  2QAZ A;  1K8A U;  3WXM B;  3S3O A;  3OW2 S;  4HCC A;  1WQW A;  2CT4 A;  4F7U A;  3QUI A;  2DER A;  3RDV A;  4JLI A;  1UDL A;  4C8Q E;  1D3B B;  1U5S A;  4OML A;  4XQ3 A;  1OV3 A;  4N4H A;  4F7U B;  1VIE A;  2K3Y A;  3OYB A;  2MWO A;  4K11 A;  4J7F A;  1E7O A;  2E65 A;  1BU1 A;  3EGD B;  4B9W A;  2ROT A;  4OGC A;  3LGF A;  1RLQ C;  1WHG A;  2IPO B;  4JLG A;  1H3H A;  4E7I A;  1VQ5 A;  2LC4 A;  1SG5 A;  4M7A F;  3X24 B;  4MDW A;  4XTW A;  2ZPI B;  1FX7 A;  2AK5 A;  2CP0 A;  2QGF B;  3VU3 C;  4A63 B;  4C92 D;  3QYH B;  3SWN A;  4CC3 A;  3RUX A;  2M1H A;  4JDS A;  1MMG A;  2ZPG B;  3TCJ A;  1IXD A;  5FU7 B;  2K5I A;  4IUV A;  4HCB A;  4JS4 A;  4BD3 A;  1H92 A;  3OYM A;  1G3W A;  4AFU C;  2DE0 X;  5LJ3 j;  2MMP A;  4IKF A;  2E41 A;  2NUP A;  5IHK A;  3G4S A;  1BB9 A;  2GF7 A;  1K73 R;  2P0P A;  3I55 A;  3MET A;  2KQW A;  4OMP A;  2G6F X;  1WIE A;  4C8Q C;  1N8R U;  4PKC C;  3P8B B;  3CCR A;  4IIO A;  3EGU A;  3QPH A;  5HKC A;  2L89 A;  1D1C A;  2E5Q A;  3HKS A;  1HJD A;  1G3T A;  2RJC A;  1PRL C;  2EJ9 A;  3QSU A;  1M5Q 1;  1YJW Q;  2HNI A;  2PVO B;  1B3Q A;  1YBY A;  2DL7 A;  2LCL A;  1ZSZ C;  1KQ1 A;  3OYC A;  2CP3 A;  2RA2 A;  2I0N A;  2HD0 A;  2AT1 B;  3OS2 A;  2KDS A;  2OX7 A;  4FW1 A;  3M54 A;  4FW2 A;  5GMK h;  3NPF A;  4RTU A;  2WAC A;  3CME A;  1OZ2 A;  5I21 A;  2VGN A;  4M7A B;  1VQK Q;  4XTX A;  1FMV A;  3JCM c;  3OB9 A;  2DEQ A;  3CC2 A;  5FLX E;  3OS1 A;  2VB6 A;  1HSQ A;  4J9I A;  1YWP A;  1AZG B;  4FM4 B;  3V7R A;  2KT8 A;  2LJ3 A;  5D6X A;  3FJ5 A;  4M78 F;  2VWF A;  4O6J A;  4ANJ A;  2L8D A;  2LDM A;  2ZGW A;  3E19 A;  3UA6 A;  1GBQ A;  2YRD A;  4FYW B;  3JCM g;  1UGS B;  1D0Z A;  3I5R A;  2MYS A;  4PJO E;  3QG1 A;  4C0D B;  3M57 A;  1ZLM A;  3GPL A;  3VS6 A;  1ZX6 A;  2XKO C;  3MEA A;  3RKW A;  1I5L A;  1WXU A;  1YIJ T;  2KXD A;  1VQ8 Q;  4FYX B;  3J80 E;  1UTI A;  1QW1 A;  4FYV B;  3CME T;  4Z88 A;  2KMT A;  4PFO A;  3OS0 A;  3CQT A;  1YIT A;  5FU7 C;  3VS7 A;  2O9S A;  2JT4 A;  3QO3 A;  2EIF A;  1FYN A;  2DVJ A;  1YIJ A;  5GAN g;  1D1A A;  1I1J A;  2QQA A;  2K3B A;  3EG2 A;  2NWM A;  2JS2 A;  4C0D C;  5DLQ E;  1T3L A;  2MI6 A;  2SRC A;  1H64 1;  3OYI A;  1M90 U;  5KYU A;  2P0Q A;  4C8Q D;  3RKX A;  3I56 T;  1KJW A;  4J6X A;  2BUD A;  2P0K A;  2VGM A;  3CCE A;  1AVZ C;  2DA9 A;  5FWB A;  2CP2 A;  1Y07 A;  2ZAE A;  4M77 E;  2M51 A;  1ZBJ A;  3LX7 A;  1MV3 A;  3X28 B;  1PM3 A;  3KBG A;  2ZPE B;  4ME7 A;  2GTO A;  1C0M A;  1IB8 A;  4OVA A;  3CCL T;  2QQB A;  1YI2 Q;  4M75 B;  2X51 A;  2DYI A;  1Q7Y R;  4E7S A;  1VQ7 Q;  2FPD A;  5HK3 A;  2OTL A;  5FRM A;  4A53 A;  2E10 A;  1V29 B;  1OOT A;  2PTK A;  3JCM b;  4J9F A;  2XDP A;  2K7A A;  1Z9Q A;  1OPK A;  3V8K A;  2COY A;  3M59 A;  2EKO A;  2DL4 A;  3QZ9 B;  4QKU A;  3A8H B;  5LL6 S;  2CDT A;  1D09 B;  1N8R R;  4LXC A;  4PJM A;  2CSI A;  3VS0 A;  1O9S A;  2E4H A;  3G4S Q;  1WHL A;  4JZ3 A;  4CC2 A;  4J9E A;  5GAM h;  2VAS A;  4JJC A;  5IHN A;  1PD1 A;  3BW1 A;  2R5A A;  1YJW T;  1X6B A;  5IHI A;  4QVD A;  2M0O A;  3I55 T;  1VOM A;  4M7D D;  3CC7 Q;  3G4S T;  2PVG B;  1YI2 T;  4A4E A;  2X35 A;  2LNV A;  4Y28 E;  4L6V 5;  2K79 A;  5GMK j;  1Q82 R;  1G2B A;  2DAQ A;  5HY6 A;  4EMG A;  5GAO p;  1AWW A;  4M77 A;  1UEB A;  2L3R A;  3JB9 G;  2KYB A;  2RJF A;  3E1S A;  2F5K A;  2AHJ B;  1BCM A;  5GAN 5;  4C5H A;  3CC4 Q;  4EIK A;  1HYO A;  2YUN A;  1UUE A;  1NJI R;  5KCO A;  4HXJ A;  1G5V A;  4D8K A;  2LZ6 B;  4C92 C;  5I2M A;  3TU4 K;  4TVR A;  3N5B B;  2DF6 A;  5GAN 4;  4QVZ A;  3F70 A;  4RUG A;  1Q82 U;  2MCN A;  2A36 A;  3SWN B;  2QYZ A;  2CZ7 B;  4DBH A;  2A3L A;  3I9Q A;  1K8A R;  2ZPB B;  1UGR B;  5GAM e;  4AFZ C;  1VQN Q;  2CZ6 B;  1WXB A;  1Q81 C;  1VQ9 A;  2QEX A;  1W2B A;  3VV0 A;  2K57 A;  1NJI U;  1VQ8 T;  1RAA B;  2OJ2 A;  3UDC A;  1IO6 A;  1OQK A;  3A8O B;  1GCP A;  4M75 F;  3E9G A;  1LPL A;  1WLP B;  4EMK C;  2P4T A;  2RQT A;  3MCA B;  1Q86 R;  3M56 A;  2LJ1 A;  1RAF B;  2DTH A;  3UAT A;  3TRE A;  4N0A C;  1X43 A;  2CS7 A;  1J3T A;  2MIO A;  1VQM T;  2RPN A;  4LDV A;  5GMK i;  1K1Z A;  1BI3 A;  2XID A;  4RKU E;  1TH7 A;  2OTL Q;  5CO7 A;  2MPX C;  5GMK m;  4GY5 A;  4C5G A;  1K4U S;  4M78 A;  5J39 A;  2VV5 A;  4C92 E;  1U8R A;  1OEB A;  3CCM T;  3RMS A;  2DXT A;  3TSZ A;  4E7L A;  3FRN A;  4LD9 K;  2YUO A;  3H9N A;  4AFQ C;  3FEO A;  3SDZ A;  3PNW C;  2EYY A;  2QTV A;  2V8K A;  2NUT A;  3JAM E;  3M4Y A;  3G71 Q;  2O9V A;  1TS9 A;  2B86 A;  1K73 U;  3CCE Q;  3V8J A;  3I5S A;  2DEU A;  5GAN h;  5AYF A;  1K0X A;  3QBY A;  2QA4 T;  4LDY A;  2DRM A;  2QA4 A;  2L2P A;  1M1K U;  3NFC A;  1U1T A;  4JRQ A;  4QW2 A;  1D1B A;  2KEA A;  2JMC A;  1QCF A;  5A0L A;  4RTW A;  2LCC A;  2PNI A;  3OYG A;  1KHI A;  1M3C A;  4QQD A;  1B7T A;  4BI8 B;  2KBT A;  3O5Z A;  4ZNX A;  3J81 E;  4JRK A;  1BK2 A;  1GRI A;  5IN1 A;  4JRP A;  2NYS A;  2CUB A;  3JB9 F;  2DVE A;  2QI2 A;  4F7U E;  4HT8 A;  3URG A;  1AZE A;  2CRE A;  2RM4 A;  2KYM A;  2HL5 C;  3JRZ A;  4HVV A;  1F1B B;  2FRY A;  5KE2 A;  1S72 T;  3MEV A;  3ZEH A;  1RAD B;  4MML A;  5IXF A;  4WTO B;  2HBP A;  1I5O B;  4JZ4 A;  2L3Q A;  3OYN A;  2RQV A;  4E2F B;  3OYD A;  3A8L B;  4M7D F;  2G3R A;  4OMF B;  2J06 A;  1JQQ A;  1M2O A;  2YXY A;  3JCM d;  3QZ5 B;  8ATC B;  1QP3 A;  1NPR A;  5LJ3 d;  1SPK A;  1FXX A;  1U06 A;  3QII A;  1YIJ Q;  2EYW A;  1K9M R;  1E6H A;  1R0B G;  2J6K A;  2QQ9 A;  1ACM B;  2LT1 A;  3H8Z A;  3CCS A;  4MDX A;  2KE9 A;  2YSQ A;  2EBP A;  2COW A;  2ESW A;  1H8K A;  1TOV A;  3VRY A;  2GBQ A;  2J7I A;  2K9G A;  3NGP A;  4J9G A;  2JMA A;  4JJN K;  3RER A;  1VQ9 T;  3I56 Q;  4IUU A;  3OS5 A;  1S1N A;  3P8D A;  2DKG A;  2LRQ A;  2JOY A;  3ULR B;  2CUD A;  4XTU A;  1VQ4 A;  2HSP A;  4PLI A;  4KGV B;  3KXT A;  3CC4 A;  2IVW A;  2LX7 A;  3JB9 H;  1BYM A;  5GAN 2;  1IRE B;  1I07 A;  2P4R A;  3PMI A;  2RI5 A;  2RHU A;  1KC8 U;  3VS3 A;  2KRS A;  2JM9 A;  1WHH A;  3H0H A;  2AKK A;  2FPF A;  3HSB A;  1OX9 A;  4DBR A;  1UEC A;  1GCQ A;  4A4F A;  1BBZ A;  2J6F A;  4PK4 A;  3L2V A;  4M7A A;  3BDU A;  1SSF A;  1NM7 A;  2WSC E;  1WZO A;  1ARK A;  4OB1 B;  1ZHI A;  3FJP A;  5I2S A;  2LP5 A;  1VQP T;  2XMF A;  2ABL A;  1UG1 A;  2H3E B;  4PJO F;  3L2R A;  1H3Z A;  3MP8 A;  5A2Q E;  5EG2 A;  2AZS A;  1MND A;  2E3I A;  3EG9 B;  2GTJ A;  4J9B A;  4RMO A;  1Q86 C;  2O2O A;  4AFS C;  2Y90 A;  3CCQ T;  3FIF A;  1IGU A;  3OY9 A;  4BE0 A;  3EG9 A;  2DIL A;  4C0Z A;  4HA8 A;  3CD6 Q;  4F14 A;  2L0A A;  2O4X A;  1YCY A;  1AEY A;  3MP6 A;  1X69 A;  2PQW A;  3CEY A;  4HVW A;  5LJ5 j;  3CPW A;  1PHT A;  2BKD N;  5C0M A;  2LQN A;  4ZTJ A;  4AMC A;  2K6D A;  3CMA A;  4RTY A;  3EAE A;  3CME Q;  2OTJ A;  2YHT A;  1NPP A;  4F7U G;  3DB3 A;  2V1R A;  3HRU A;  1U3O A;  4BI3 A;  3CXC S;  3A8G B;  1KK7 A;  4C8Q B;  2JXB A;  3L42 A;  3GLX A;  1NJI C;  2QG9 B;  4L5G A;  2DK3 A;  2K5F A;  5GJW B;  4JJB A;  3LGL A;  4OMO A;  2JTM A;  4YTL A;  4J8O A;  3H0I A;  4PL6 A;  3CCJ A;  1MGQ A;  2EVR A;  1LCK A;  2C0O A;  1ZSZ A;  3UF4 A;  2BE7 D;  1KIK A;  1BI2 A;  2EYX A;  1LJO A;  1BKB A;  1ZA2 B;  2JW4 A;  4FCY A;  2M0Y A;  2OAU A;  2EKH A;  1KFZ A;  3I56 A;  5HCK A;  2RQW A;  1YP5 A;  4J6W A;  1E6G A;  3HFN A;  3UPU A;  1NG2 A;  4O5V A;  2YRV A;  4OP0 A;  1TUG B;  4C92 F;  4A4H A;  4II1 A;  4VUB A;  4ZGE B;  1T3S A;  2EGE A;  1YIT Q;  2W0Z A;  2RHY A;  3AT1 B;  1JO8 A;  4WF2 A;  1JJ2 A;  1JB0 E;  2ECZ A;  1YIT T;  2AIR B;  4FT2 A;  4Y92 A;  4D8D A;  1JJ2 S;  2DTO A;  2FVU A;  2V8I A;  3A1P A;  5KYX B;  2L3P A;  1WHJ A;  5GAO q;  1SEM A;  2EQI A;  2A0F B;  3REB B;  5IAY A;  2LX9 A;  4LDX A;  4ELZ C;  4M75 E;  1CSK A;  2GCX A;  4JRI A;  3L2Z A;  4EMK A;  1I4K 1;  4C8Q G;  1BCO A;  5FU6 B;  4J83 A;  1VQK T;  1RAC B;  4P5N A;  2I2L A;  1JXO A;  2VYT A;  3EFR A;  3JCM e;  2FHD A;  2BIV A;  2RN8 A;  2AZV A;  2FZC B;  5GAM g;  1FMK A;  5FRN A;  1EX4 A;  2QK0 A;  2FZG B;  3GNF B;  1YJ9 A;  1M9S A;  2JS0 A;  2ZPH B;  4FL6 A;  3SB2 A;  1RI0 A;  1WFW A;  4A4K A;  1W2B S;  3EGD A;  2QGG A;  4M78 C;  2JTF A;  3G71 A;  1BI1 A;  2PUO B;  4NS5 A;  1QVF A;  3HFO A;  2NUZ A;  5CVI A;  2O4X B;  2WSF E;  2DM1 A;  1EIF A;  2MOX A;  4BE2 A;  4E6R A;  4OB0 B;  2QDY B;  2KRO A;  2GQI A;  4ZTF A;  1M1G A;  2YDL A;  3UT1 A;  1YHQ T;  2QXF A;  3R6N A;  2JJ9 A;  8AT1 B;  4X34 A;  3C4S A;  1KSW A;  3CCV T;  1VQP Q;  5LJ5 f;  1UE9 A;  3ZBD A;  4BY6 C;  5HK0 A;  4M75 C;  4PJL A;  1UFF A;  4ZN1 A;  3J7A F;  1AWX A;  3VYG A;  2MK5 A;  1ZUK A;  1GBR A;  4IUT A;  3OSS C;  2ZCF B;  2HEQ A;  4C92 B;  3JCM Q;  1SF9 A;  5L8R E;  1VA7 A;  3PFS A;  2DL5 A;  3JCM W;  3OQ5 A;  4XU3 A;  4DOV A;  4C92 A;  1X2K A;  2CSQ A;  1QVF P;  4BDZ A;  2EQU A;  3M53 A;  5D7U A;  1M27 C;  2EW3 A;  3OYK A;  5FU6 C;  3M0S A;  1OUL A;  2GQV A;  5C6S A;  1VQM Q;  4M4Z A;  4M77 F;  2EJF A;  4JPB W;  3M0U A;  1OX8 A;  4M7D C;  4B6M A;  4XU2 A;  1WJS A;  4QT7 A;  1YWO A;  1JRI A;  2DTI A;  4A4G A;  1KQS S;  1HD3 A;  3V8L A;  5GAN 6;  1SRM A;  1TU0 B;  2GGR A;  2Y4X A;  1N9R A;  3BDL A;  3CCJ Q;  2X4X A;  4BI4 A;  1PRM C;  4Q5W A;  4E7K A;  1GXI E;  5CQX A;  2V26 A;  3NTI A;  1IGQ A;  2RH2 A;  4MMK A;  4PJO C;  2Y4Y A;  4B9X A;  3M58 A;  1KD1 R;  5GAN 8;  5LJ5 g;  1EZZ B;  1M8M A;  2RI3 A;  5GAO n;  1VQ4 Q;  3CCS Q;  2V8J A;  2D1X A;  4HKE A;  4AG2 C;  3CCL Q;  4F04 B;  5GAO l;  1MNE A;  2YUP A;  2HSE B;  4XTZ A;  4E47 A;  2X3W D;  1ABQ A;  5CQY A;  1D0X A;  5LJ3 e;  1KQ2 A;  4E7H A;  1LVK A;  1RUW A;  2KRN A;  1W2B P;  2D8H A;  3MEU A;  2DXC A;  1YI2 A;  2EFI A;  2E5K A;  7AT1 B;  3GP8 A;  4CRI A;  2CGH A;  3L1A A;  3GBQ A;  3JB9 I;  2CZ0 B;  1JU5 C;  1ZSG A;  5CKH A;  2WSE E;  2PVD B;  2VC8 A;  3Q1J A;  4ESR A;  5KYW B;  2LMJ A;  2XDD A;  1GL5 A;  4M78 G;  4M77 C;  2EQJ A;  1RAG B;  2FZK B;  3NTK A;  2EQM A;  1M90 R;  4EMK B;  4M7A G;  3I55 Q;  2DFU A;  4OMQ A;  2HQE A;  4ELY C;  3H0F A;  3RMQ A;  3HTR A;  3A8M B;  4BB7 A;  4RCB A;  1RL2 A;  4E7Z A;  5GMK e;  2QA4 Q;  1D3B A;  3MO8 A;  3QYG B;  3LH0 A;  3VS1 A;  2K3X A;  2KK4 A;  1VQO A;  1VIF A;  5GJV B;  2A7Y A;  1HK9 A;  4QQ6 A;  3DLM A;  2J6O A;  3PVQ A;  1JEG A;  1NZ9 A;  1QVG A;  5DM7 R;  2D0N A;  1JBM A;  3CBP A;  1SKU B;  1Q7Y U;  1NLP C;  4PJO A;  1KQS P;  1VQ6 Q;  1NLO C;  5CK9 A;  2ZZD A;  3T9N A;  5KYN A;  3G1J A;  3VUZ A;  4DBF A;  4PJN A;  2MF2 A;  2MAM A;  2DIQ A;  1CKA A;  2YUQ A;  1MUZ A;  2NUP B;  3S6W A;  3UWN A;  1XNI A;  2M9U A;  2KAF A;  2LT4 A;  4EPC A;  5DY9 A;  5EC7 A;  1Q95 G;  2LQ8 A;  1QLY A;  2E70 A;  2HDA A;  4CC4 B;  1VQK A;  5IXB A;  4HCZ A;  4M77 G;  2GFU A;  1KD1 U;  3LWH A;  2KY9 A;  1R8O B;  1K73 C;  2L5Q A;  4PJO D;  4R0K A;  4HCK A;  3MJX A;  3VS5 A;  3DB4 A;  2EGC A;  3EGX B;  2F2W A;  3LH5 A;  3SD4 A;  3ZFJ A;  1M8V A;  1VQL A;  4RTZ A;  4J7I A;  4BAC A;  2BZX A;  1M3A A;  4D6W A;  3HRS A;  2F5T X;  5GAO m;  3CCQ Q;  2O31 A;  2YWW A;  1YN8 A;  3MKD A;  4N4I A;  2DXU A;  2A28 A;  1R0C B;  1QKX A;  1M90 C;  1PSF A;  1ZA1 B;  3V7C A;  1BI0 A;  4KRT A;  1G3Y A;  2RMO A;  2HKQ B;  4F7U F;  2CP6 A;  2CH4 W;  5CIU A;  1X01 A;  3JCM f;  3OYH A;  2DLP A;  5A0D A;  3M55 A;  1XQH A;  5LJ3 f;  1YJN Q;  4KT0 E;  2DD4 A;  3EHR A;  4OMN A;  3S3M A;  3JV3 A;  2EYZ A;  3REA B;  4MZP A;  4Z89 A;  3OBW A;  3LYI A;  3RES A;  1WHM A;  2FPE A;  4LNP A;  4DA4 A;  1JJ2 P;  4C5E A;  1TSF A;  1RLP C;  1X6G A;  2CYZ B;  2YLC A;  2OAW A;  4PNO A;  2RHI A;  3O8V A;  4J9C A;  1QMC A;  2EJG A;  4LD6 A;  4C5I A;  2HQX A;  3OSV A;  2HZY A;  1B34 A;  2EAY A;  4PFP A;  2JUF A;  4MZT A;  1OPL A;  2RQR A;  1NBE B;  2VVK A;  4KGZ B;  2FL7 A;  3QDR B;  2VUB A;  2HCK A;  2A37 A;  3H6Z A;  1M4Z A;  2D9T A;  1G83 A;  2RK1 A;  3DLL A;  4J9H A;  3MP1 A;  1NYF A;  4L59 A;  1BIA A;  4DOW A;  3L2W A;  1FMW A;  4X9C A;  4DBQ A;  2DZC A;  4ZGD B;  2RI2 A;  3CD6 A;  5A0G A;  1VQO T;  2D0Q B;  3M5A A;  5CKD A;  2E12 A;  5GAN 3;  1X2Q A;  2CT3 A;  2Z0W A;  1WYX A;  3QXE B;  1WA7 A;  2DXB A;  1N27 A;  1MMD A;  2LTO A;  2DD5 A;  1WHK A;  1TTH B;  1QCN A;  3GOX A;  3SWN C;  3DKM A;  3C0C A;  3EFO B;  2LNH B;  3OYL A;  5KYW A;  2X4J A;  3L2U A;  4FU6 A;  4XU0 A;  5LJ5 e;  1YJ9 Q;  2P84 A;  1QQJ A;  3QKJ A;  3EH1 A;  1G3S A;  1SHF A;  3A98 A;  1PKS A;  2LQW A;  1KQS A;  2JZ2 A;  4C8Q F;  2KXC A;  3G6E Q;  2C06 A;  3JB9 J;  3TEE A;  2RD1 A;  4C0F A;  4M75 A;  9ATC B;  3D7S B;  1RAE B;  1WJQ A;  3ME9 A;  4M75 G;  1Z9Z A;  3RBB B;  1VQP A;  3H41 A;  2FYK A;  2RB6 A;  4MZM A;  3BFM A;  3VUB A;  3GIB A;  4JS5 A;  1VYV A;  3EFS A;  4XAX B;  3NTH A;  4M75 D;  2KNB B;  5I11 A;  1VQ5 T;  3OBY A;  2QQR A;  3RIR A;  2PUK B;  1BIB A;  2DBM A;  3EHQ A;  4M7A C;  2EQK A;  4PLL A;  1X75 C;  1VQ9 Q;  2CH4 A;  1QWE A;  3QJ6 A;  5LJ5 d;  2KI7 A;  3OMG A;  2DO3 A;  3CPF A;  3FDR A;  2HAX A;  2FRW A;  1Y7X A;  3QJY A;  1KD1 C;  3M9Q A;  1QKW A;  2H8H A;  2DZ9 A;  3CCM Q;  4N0A A;  3PE0 A;  5IH2 A;  1N5Z A;  3CD6 T;  4PJO G;  2E6N A;  4M7D B;  1M1F A;  2E64 A;  2VKN A;  4M78 E;  4OMM A;  4PJJ A;  1PCX A;  2JTE A;  4PJO B;  1OU9 A;  2F2V A;  1UGP B;  1A0N B;  2BZ8 A;  4ZN3 A;  2OTL T;  1VQN T;  4LN2 A;  2KR3 A;  2V1Q A;  4HT9 A;  2C0T A;  1QVF S;  1XJW B;  2K5L A;  3CCL A;  5GAN j;  5I22 A;  2RO0 A;  2YT6 A;  4KUL A;  5KYY A;  3QDF A;  3CCU Q;  4BDY A;  1WDX A;  4N4G A;  2J05 A;  3VS4 A;  4ZGJ B;  3VYH B;  2DPP B;  4ORZ A;  2R5M A;  2QAS A;  3QWX X;  2X3X D;  4XTV A;  2HKN A;  1AHJ B;  2JNG A;  1S72 A;  1TUC A;  2GNC A;  1Y96 A;  1Y71 A;  1P92 A;  3CCE T;  2PZ1 A;  3JCM V;  3FB9 A;  5CAI A;  2H3J A;  4BY6 B;  4M7A E;  3MEW A;  1VQO Q;  3E2U A;  1YJN A;  3CCV A;  2F2X A;  1KC8 R;  2RQU A;  1OZ3 A;  2DYB A;  5D6Y A;  1RAB B;  1YHQ A;  3EH2 A;  1KC8 C;  1VQ7 A;  4KBM B;  3FLG A;  4IUQ A;  4NOY A;  3OMC A;  4EDU A;  2O01 E;  2KVQ G;  4M7D G;  1UGQ B;  5KYX A;  1VQ6 A;  1AWO A;  2IG0 A;  2R58 A;  2XG8 D;  1OYX A;  2LJ0 A;  2JVV A;  3RR6 A;  2X4Y A;  4QQG A;  4NL3 A;  1WGS A;  1PG5 B;  4OGE A;  3G71 T;  4M78 B;  1TXQ A;  1PSE A;  3BE3 A;  1Q86 U;  4J6Y A;  3JSC A;  2OTJ Q;  4M7D E;  1G8X A; 
#chains in the Genus database with same CATH homology
 2JMC A;  1QCF A;  4LUD A;  4LE9 A;  1VYT A;  4RTW A;  2PNI A;  1M8M A;  3PVL A;  1M3C A;  1YCS B;  2D1X A;  4AG2 C;  2AK5 A;  2KBT A;  3O5Z A;  4ZNX A;  4A63 B;  2O88 A;  2YUP A;  1BK2 A;  1GRI A;  1YNZ A;  4CC3 A;  2CUB A;  2RNA A;  1AZE A;  2CRE A;  3M0P A;  2KYM A;  2X3W D;  1ABQ A;  4HVV A;  2DJQ A;  4CC7 A;  2FRY A;  5IXF A;  1H92 A;  1RUW A;  2KRN A;  4AFU C;  2DE0 X;  4JZ4 A;  2L3Q A;  5FWC A;  2RQV A;  2D8H A;  2E5K A;  5IHK A;  3SHW A;  1BB9 A;  1JQQ A;  2J06 A;  4J9D A;  1NEB A;  3GBQ A;  4OMP A;  1SPK A;  2G6F X;  1U06 A;  1WIE A;  1JU5 C;  1ZSG A;  2DL3 A;  2EYW A;  1E6H A;  4ESR A;  2J6K A;  1RI9 A;  4IIO A;  3EGU A;  2LMJ A;  1GL5 A;  1HJD A;  2KE9 A;  1XOV A;  2YSQ A;  4RTX A;  1SSH A;  4OMQ A;  1PRL C;  2EBP A;  3H0F A;  2ESW A;  1H8K A;  3VRY A;  1B3Q A;  2GBQ A;  2J7I A;  2K9G A;  3NGP A;  4J9G A;  2JMA A;  1PNJ A;  2DL7 A;  1S1N A;  2FG0 A;  3VS1 A;  3ULR B;  2CUD A;  5GJV B;  2HSP A;  1AD5 A;  2I0N A;  2J6O A;  2LX7 A;  2D8J A;  3PVQ A;  1JEG A;  1I07 A;  2P4R A;  3NPF A;  4RTU A;  2D0N A;  3VS3 A;  2KRS A;  2JM9 A;  1NLP C;  3H0H A;  2AKK A;  2FPF A;  3M0T A;  1NLO C;  1V1C A;  1UEC A;  1GCQ A;  1BBZ A;  1HSQ A;  4J9I A;  1YWP A;  2J6F A;  1AZG B;  1CKA A;  2YUQ A;  1MUZ A;  1TUD A;  2KT8 A;  2LJ3 A;  1NM7 A;  1ARK A;  3FJ5 A;  5EC7 A;  1QLY A;  1T0H A;  2VWF A;  2LP5 A;  2HDA A;  2HBW A;  2XMF A;  4CC4 B;  2ABL A;  1QWF A;  5IXB A;  1NYG A;  1UG1 A;  2JM8 A;  3UA6 A;  1GBQ A;  2ED1 A;  4R0K A;  2AZS A;  4HCK A;  2KRM A;  3VRZ A;  2SEM A;  1AWJ A;  3VS5 A;  1K76 A;  3I5R A;  2GTJ A;  2EGC A;  4J9B A;  2F2W A;  2O2O A;  4AFS C;  4F17 A;  1UGV A;  1ZLM A;  3LH5 A;  3VS6 A;  2LCS A;  1ZX6 A;  4RTZ A;  1WXU A;  2DIL A;  2KXD A;  5FW9 A;  2BZX A;  1PWT A;  2QDL A;  3I35 A;  2L0A A;  1UJY A;  1M3A A;  2C0I A;  4F14 A;  1AEY A;  1UTI A;  1X69 A;  4Z88 A;  4HVW A;  3CQT A;  2O31 A;  1YN8 A;  1K9A A;  2EGA A;  3VS7 A;  2O9S A;  2JT4 A;  1PHT A;  2A28 A;  1VYU A;  1FYN A;  2DVJ A;  1QKX A;  1I1J A;  2K3B A;  4KRT A;  2LQN A;  2RMO A;  3EG2 A;  1W1F A;  2K6D A;  4RTY A;  1JXM A;  2CH4 W;  2NWM A;  2JS2 A;  1AOJ A;  1GFD A;  1TG0 A;  2DLP A;  1T3L A;  1WI7 A;  2SRC A;  2V1R A;  1ZUU A;  3EHR A;  4OMN A;  1U3O A;  3JV3 A;  1KJW A;  2JXB A;  4AG1 C;  2EYZ A;  3REA B;  3EG1 A;  1AVZ C;  1PKT A;  2DA9 A;  5FWB A;  5GJW B;  4JJB A;  4Z89 A;  4OMO A;  2FPE A;  4LNP A;  4FSS A;  1EFN A;  3H0I A;  2M51 A;  2FEI A;  1M30 A;  1ZBJ A;  1T0J A;  1MV3 A;  1RLP C;  1X6G A;  2KGT A;  3THK A;  3UA7 A;  2OAW A;  1WXT A;  1LCK A;  2EVR A;  1W6X A;  2C0O A;  3UF4 A;  3U23 A;  1Y57 A;  4J9C A;  1KIK A;  2GTO A;  3M0R A;  2EYX A;  3SEM A;  1MV0 B;  4GBQ A;  1OPL A;  2RQR A;  2ENM A;  2JW4 A;  2VVK A;  2M0Y A;  2EKH A;  2DBK A;  1KFZ A;  2HCK A;  2A37 A;  2FPD A;  5HCK A;  1G83 A;  2RQW A;  1YP5 A;  4J9H A;  1GFC A;  1E6G A;  1NYF A;  1NG2 A;  1B07 A;  1OOT A;  2PTK A;  4J9F A;  2EPD A;  2K2M A;  1X2Q A;  2CT3 A;  1WYX A;  2K7A A;  1WA7 A;  1Z9Q A;  1OPK A;  1T3S A;  2EGE A;  2DL4 A;  2W0Z A;  2W10 A;  2OI3 A;  2KT1 A;  1JO8 A;  2CDT A;  3C0C A;  2ECZ A;  2LNH B;  2CSI A;  1M3B A;  3VS0 A;  3IQL A;  4Y92 A;  4JZ3 A;  4CC2 A;  4D8D A;  4J9E A;  3RNJ A;  4HVU A;  4JJC A;  5IHN A;  1WX6 A;  1X6B A;  2L3P A;  5IHI A;  1ZUY A;  2DRK A;  1SEM A;  2DX1 A;  2EQI A;  1GCQ C;  3REB B;  1SHF A;  3A98 A;  1I0C A;  3VS2 A;  1PKS A;  2LQW A;  1CSK A;  2KXC A;  2K79 A;  1K0S A;  1G2B A;  4RTT A;  1CKB A;  1AWW A;  5L23 A;  1SRL A;  4DEY A;  2BZY A;  2ED0 A;  2KYB A;  3RBB B;  1Z9Z A;  3H41 A;  2RF0 A;  1X27 A;  1JXO A;  2BTT A;  4EIK A;  3KFV A;  2RN8 A;  2DMO A;  2YUN A;  2AZV A;  1UUE A;  1VYV A;  3NHN A;  1UHF A;  1Y0M A;  4HXJ A;  1FMK A;  2KNB B;  5I11 A;  4D8K A;  2LZ6 B;  2DBM A;  3EHQ A;  4IIM A;  2JS0 A;  2DF6 A;  2CH4 A;  1WFW A;  1QWE A;  4RUG A;  1SHG A;  2MCN A;  4Z8A A;  2A36 A;  3ZL7 C;  2FRW A;  2NUZ A;  2DM1 A;  2MOX A;  4WCI A;  4X1V A;  3I9Q A;  2ROL A;  4E6R A;  3NMZ C;  4AFZ C;  2A08 A;  4LUE A;  1QKW A;  1WXB A;  2H8H A;  2KRO A;  2GQI A;  2YDL A;  3PE0 A;  5IH2 A;  1N5Z A;  3R6N A;  2OJ2 A;  2VKN A;  1KSW A;  4OMM A;  1IO6 A;  2JTE A;  1GCP A;  2IIM A;  1ABO A;  2F2V A;  1A0N B;  1UE9 A;  5ECA A;  2BZ8 A;  1WLP B;  4LN2 A;  2RQT A;  2KR3 A;  2V1Q A;  1UFF A;  1AWX A;  4JJD A;  1NEG A;  2C0T A;  2LJ1 A;  1UHC A;  4RTV A;  1W70 A;  1ZUK A;  1GBR A;  5I22 A;  3UAT A;  2L3S A;  2YT6 A;  2DL8 A;  1X43 A;  1WDX A;  2AKL A;  2HEQ A;  2MIO A;  2J05 A;  3VS4 A;  2RPN A;  1J3T A;  3TVT A;  1K1Z A;  1VA7 A;  4ORZ A;  2DL5 A;  3QWX X;  2X3X D;  4F16 A;  2DNU A;  3QWY A;  1X2K A;  3EG3 A;  1TUC A;  1K4U S;  2CSQ A;  2GNC A;  2PZ1 A;  3EG0 A;  3M0Q A;  1M27 C;  2EW3 A;  1OEB A;  4GLM A;  3TSW A;  3M0S A;  4DEX A;  2FO0 A;  3TSZ A;  4M4Z A;  1UJ0 A;  2YUO A;  4AFQ C;  2F2X A;  4JPB W;  2RQU A;  3M0U A;  2EYY A;  2DYB A;  2CT4 A;  4QT7 A;  1YWO A;  2O9V A;  2B86 A;  1UDL A;  1U5S A;  4OML A;  1HD3 A;  3I5S A;  1OV3 A;  1SRM A;  1AWO A;  2GGR A;  2LJ0 A;  4K11 A;  1E7O A;  1K0X A;  1BU1 A;  1PRM C;  2DRM A;  2ROT A;  2L2P A;  1RLQ C;  1H3H A;  2KEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...