2JS2A

Solution structure of first sh3 domain of adaptor nck
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
63
structure length
63
Chain Sequence
GSMAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic protein NCK1
publication title Specificity determinants of a novel Nck interaction with the juxtamembrane domain of the epidermal growth factor receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 7
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2js2A00
4Z89A 2J05A 2JM9A 1AWXA 5I11A 1YNZA 4J9IA 1UGVA 2FRYA 1M3CA 1GFCA 1TUCA 1T3SA 1WA7A 3UA6A 3O5ZA 1V1CA 4AFZC 4F14A 1BU1A 1W70A 5IXFA 5L23A 2JT4A 1UHCA 1AD5A 1QCFA 1VYVA 1YN8A 1AVZC 2C0IA 1RLQC 2LZ6B 1G2BA 2X3XD 5FWBA 2DRKA 2CH4W 1OOTA 1X2KA 1M8MA 4HXJA 4OMNA 2K9GA 2O31A 1U3OA 1N5ZA 1FMKA 5GJWB 4J9DA 4RTWA 3REAB 3EG3A 3FJ5A 2L2PA 2HBWA 3SEMA 2DE0X 4DEYA 3JV3A 1TG0A 1W6XA 1PKTA 3VRZA 2KRMA 3UF4A 2KYMA 2EGCA 1SPKA 2YSQA 1BB9A 2YDLA 2GGRA 2CT3A 1SHGA 2SRCA 1YCSB 2F2WA 2J7IA 2JTEA 1H3HA 2ED0A 2LMJA 1ABOA 1UJ0A 1WFWA 1AWJA 4HVUA 2K2MA 2OJ2A 4X1VA 2LQWA 2D8HA 2JS0A 1GCPA 2V1RA 2YUNA 1ARKA 1X27A 2FRWA 1GBRA 2EYZA 1AZGB 2O2OA 1LCKA 4JZ3A 3LH5A 1SEMA 2O9SA 2DBMA 1NEBA 1B07A 4JPBW 1ZUKA 2MCNA 2K7AA 3M0RA 1I1JA 3TVTA 2AKKA 4AFUC 4CC7A 1AEYA 2RN8A 3VS2A 1G83A 2RMOA 3RBBB 4D8DA 1S1NA 2D8JA 4D8KA 4J9GA 1YP5A 4RUGA 1GL5A 2LJ0A 2C0TA 2EPDA 2KRSA 2A08A 4CC4B 1E7OA 2LQNA 2HDAA 2RPNA 1M3BA 1UG1A 1BBZA 1KSWA 4DEXA 2LP5A 2B86A 1YWPA 1UE9A 1ZX6A 1UUEA 3CQTA 1B3QA 2L0AA 1JXOA 5ECAA 3PVLA 1JU5C 3EHRA 4IIMA 1GRIA 1TUDA 1GCQA 2KRNA 2RQTA 4AFSC 2W10A 4LN2A 3TSWA 2W0ZA 1WYXA 3M0PA 2RQUA 4GBQA 3NGPA 2J06A 4RTYA 2CSQA 4M4ZA 4CC3A 3I5SA 2C0OA 2MOXA 4OMLA 3M0TA 2F2VA 2DBKA 2KEAA 3PE0A 2EQIA 2OAWA 4ORZA 1X43A 4ESRA 2D0NA 1K76A 3EG1A 4FSSA 1M27C 2CUBA 3NPFA 2AZSA 5IXBA 1K0XA 3EG2A 4LE9A 2ED1A 1U5SA 2ESWA 2X3WD 3EHQA 1RUWA 2DL7A 2DL3A 3I9QA 5HCKA 3H0FA 3M0SA 4LUDA 4RTTA 2KBTA 2DL4A 1CKAA 1GBQA 2EW3A 4WCIA 3I5RA 2LCSA 1K0SA 1QWFA 3EG0A 1WXUA 4R0KA 2FPDA 1CSKA 2HEQA 1X69A 2BZYA 3VS1A 4J9HA 2EGAA 1I07A 2O9VA 5IHNA 1WDXA 1AOJA 1J3TA 2KXCA 2DL5A 2JXBA 4Y92A 3IQLA 2M51A 3VS7A 4J9CA 3KFVA 2H8HA 3M0UA 2FPFA 1AZEA 1ZSGA 1Y0MA 2PNIA 4CC2A 4E6RA 1WIEA 4GLMA 1Z9ZA 4RTUA 2IIMA 2AKLA 4Z88A 2YT6A 1WX6A 2RQVA 2RNAA 1VYUA 2RF0A 4AFQC 4A63B 2ECZA 2GQIA 1YWOA 1K4US 1ZLMA 3THKA 1WXTA 2LJ1A 1EFNA 2A28A 2MIOA 1NEGA 4JJCA 3C0CA 2OI3A 4OMPA 2BZ8A 2DX1A 2K79A 2BTTA 2KROA 3EGUA 1K1ZA 2L3QA 2P4RA 2DMOA 3A98A 2HCKA 4KRTA 4RTXA 1NLPC 2K6DA 4JZ4A 2VKNA 1CKBA 1NYFA 4F16A 2FG0A 2EGEA 2A36A 2A37A 1QWEA 1IO6A 1JQQA 2I0NA 3PVQA 1OV3A 2J6OA 1SHFA 1H92A 2JM8A 4J9FA 1A0NB 1OPLA 2NUZA 4JJDA 3R6NA 4HVVA 1OPKA 1ABQA 2EYXA 1UFFA 1I0CA 2DA9A 2DVJA 1NG2A 2QDLA 2DM1A 4LUEA 2ENMA 1WXBA 1KFZA 2D1XA 1RI9A 4K11A 2AK5A 1FYNA 1UECA 2KR3A 2EBPA 2DILA 1ZUUA 1QLYA 1MUZA 3H0HA 2DRMA 1T0HA 2EYWA 2DJQA 1WLPB 3ZL7C 4AG2C 4LNPA 1PKSA 5FW9A 4J9EA 1Y57A 2KXDA 3H41A 2CUDA 2CSIA 1K9AA 1HD3A 2EVRA 1OEBA 2AZVA 2GBQA 1SRMA 5IH2A 4OMMA 3SHWA 1HSQA 1NYGA 2ABLA 2NWMA 2DF6A 1Z9QA 1HJDA 2DLPA 4EIKA 2GTJA 1PRMC 2KGTA 2YUOA 4OMOA 2ROTA 1QKXA 1BK2A 2JW4A 3VS6A 3U23A 1KIKA 2G6FX 3H0IA 2V1QA 2EYYA 1T0JA 2KT8A 2RQRA 1AWOA 1X6BA 2VWFA 2JMCA 1JXMA 1U06A 1X6GA 1WI7A 2K3BA 2F2XA 2PZ1A 4F17A 5I22A 3NMZC 1XOVA 2XMFA 3UA7A 2CREA 4Z8AA 4IIOA 2CDTA 2ROLA 3M0QA 1MV0B 2GTOA 1ZBJA 4OMQA 1M3AA 1PHTA 4QT7A 1PRLC 2YUPA 3VS3A 1X2QA 2J6KA 1AWWA 1E6HA 2HSPA 2CT4A 1E6GA 4ZNXA 1GCQC 3ULRB 1UHFA 4RTVA 3VS4A 1PWTA 1UTIA 1T3LA 1UDLA 2VVKA 4RTZA 2JS2A 3RNJA 5IHKA 4AG1C 2PTKA 3I35A 2BZXA 2CH4A 5IHIA 3GBQA 1VYTA 1PNJA 2RQWA 2KE9A 2GNCA 2L3PA 1ZUYA 4HVWA 2LJ3A 4JJBA 5GJVB 1JEGA 2FEIA 1RLPC 2DYBA 2KT1A 1NLOC 1QKWA 2DL8A 2YUQA 1GFDA 2DNUA 3QWYA 4HCKA 1MV3A 2J6FA 1H8KA 2L3SA 4J9BA 1KJWA 2FO0A 3VRYA 3NHNA 2FPEA 3QWXX 2E5KA 3VS0A 2M0YA 2SEMA 2O88A 1UJYA 5EC7A 2JMAA 2KNBB 2KYBA 1JO8A 1W1FA 1NM7A 5FWCA 1SSHA 2LX7A 3TSZA 3VS5A 3REBB 1SRLA 3UATA 2EKHA 1M30A 2LNHB 1VA7A
chains in the Genus database with same CATH superfamily
1Q82R 4Z89A 4M78D 3I55A 3SWNB 5I11A 2IVWA 4ME7A 1NJIR 3CD6T 3MEUA 1R0BG 1WA7A 2BE7D 3UA6A 1V1CA 4AFZC 5IXFA 2A7YA 1UHCA 1VYVA 2DD4A 1AVZC 4MDWA 2FVUA 1FX7A 4EMKA 1G2BA 4BACA 1C6VX 3A8GB 1H3ZA 2VV5A 4C8QD 4OB0B 2RK1A 1Q81R 1U3OA 1N5ZA 4XTXA 2FZCB 3EG3A 4LXCA 2DE0X 4M78F 4DEYA 3QYHB 4E2FB 3VRZA 2KRMA 5AT1B 3CCRA 1N27A 3X24B 1IREB 5GAOl 1BB9A 4DQ2A 3SB2A 2DD5A 2IPOB 1PSEA 2SRCA 2LQKA 1VQ5T 2ED0A 5CKEA 5LJ3g 1D09B 2RM4A 3CCLA 2D6FA 4RCCA 4HVUA 2X4WA 4QQ6A 2JS0A 1GCPA 4M7AB 3OMGA 3BFMA 5GANe 1X27A 2L3RA 2P0QA 1K9MR 2X4JA 1GBRA 3L2WA 4JZ3A 5LJ3f 3LH5A 1SEMA 4M7AD 2DBMA 1NJIU 2EJGA 3OYCA 1MMNA 4JPBW 2K7AA 3G71A 4JS5A 3OSSC 1N8RR 5LJ5e 5KYXA 1G83A 4M7DC 5GMKe 1KD1R 4F7UE 5KCHA 3OBWA 1I5LA 1YJWT 2C0TA 1Q81U 2EPDA 4RCBA 2A08A 2XDPA 1QP2A 4CC4B 1OQKA 2R5MA 2RPNA 2F5KA 2OTJT 2ZPIB 1FMWA 4A53A 4M7AF 1KSWA 1KQSP 1W2BS 3FDRA 1Y71A 1XJWB 1TH7A 4C92B 2MPXC 1ZX6A 4FL6A 4N4GA 3PVLA 1JU5C 3M56A 1I81A 1GRIA 5KYUB 2WSEE 4PKCC 1TUDA 1GCQA 2QK0A 1QVFP 2RJFA 3TSWA 4KT0E 4HA8A 2QQ9A 2ZPFB 3NGPA 2MI6A 2J06A 2K3XA 1MHNA 1D0YA 1D1AA 1VQLQ 3RIRA 4OMLA 1M1KR 2DBKA 3VV0A 3LLRA 2EYQA 2KEAA 2EQIA 3M4GA 4WF2A 1WHJA 1K76A 1R8OB 4V2SA 2DIGA 1KG1A 1K0XA 2X3WD 2ESWA 4C92F 1OI1A 1ZHIA 4OGEA 2E3HA 5HCKA 2OAUA 3M0SA 2KQWA 4LUDA 4KUIA 2DXTA 1RABB 3PMTA 3MP6A 2Y4YA 4WCIA 2COZA 1WXUA 2DYIA 3E19A 1M9SA 2E3IA 5GAOp 3HSBA 3CXCS 2NLUA 2EGAA 1PD0A 1YJNT 4M78C 1AOJA 2BUDA 2GF7A 2JXBA 1G3TA 2HL3A 3VS7A 4J9CA 3KFVA 2H8HA 3M0UA 1WZOA 3SWNC 3OYJA 2PUKB 3VU3C 6AT1B 1WIEA 3ME9A 4F7UB 3M53A 2IIMA 1VQMT 2PUOB 3CCQT 2HNIA 2RF0A 3EGDA 2QEXQ 1YHQA 3TQ7P 2DXBA 5KH6A 4PFPA 3S6WA 4LDYA 2E70A 4JLGA 4ELYC 2MIOA 3QBYA 3FC3A 1OU9A 3P8DA 3C0CA 2OI3A 4M75E 3INZA 4A54A 2DX1A 2BTTA 4ELZC 1K1ZA 3G6EA 2V8IA 3CCQA 1VQOA 2BE9B 4JZ4A 5D6WA 2O01E 4FW2A 1U1SA 4MZMA 2OTLT 1IGQA 4OMFB 1Y7XA 1QWEA 4F7UF 4IKFA 2I0NA 2JJ9A 1OV3A 3SWNA 4O5VA 1VOMA 3NTKA 4A4HA 1OPLA 2QA4A 5LJ3h 4RG2A 4HT8A 4M7AC 3CCVT 1PG5B 2MYSA 2EWNA 4C8QA 2NUTB 3JCMQ 2QQBA 4VUBA 1X01A 2DA9A 2PQWA 2QDLA 2HMAA 3M57A 4LDVA 2DM1A 2HQHA 4Q5WA 2LDMA 4FIBA 3VUBA 1WXBA 3CMEA 1F1BB 1VQPQ 4JDSA 2DILA 1ZUUA 1QLYA 4L59A 2RO0A 2V8KA 4JRIA 3OS1A 2Y4XA 2M16A 2EYWA 3SFMA 3ZL7C 3N5BB 1TTHB 1QVGP 1VUBA 1Y57A 1VQNQ 1G8XA 4J6XA 3L2VA 4IUTA 1HD3A 5A0DA 4KH0B 4ZGDB 3SDZA 3I55Q 2ZPEB 4QQGA 3JCMe 1NYGA 1LNXA 4FM4B 4II1A 2X9HA 1Z9QA 3CC4A 4RMOA 4IUPA 3BE3A 4EIKA 1BI3A 3ASKA 3V7RA 4D6WA 1PRMC 4OMOA 4OGCA 3U23A 3E9FA 2G6FX 2DEQA 2EYYA 1T0JA 3ZFJA 1NZ9A 1AWOA 3AHUA 1JXMA 1O75A 5GAOm 2EQJA 4C5IA 8AT1B 3WVDB 1KQ2A 1WGSA 3UA7A 2CREA 4M75D 4PJNA 3LH0A 1LPLA 5CKFA 2ROLA 1I5OB 1MV0B 2GTOA 1FXXA 3JB9J 3CCRQ 1PHTA 5HY6A 2DAQA 1WHKA 4BE1A 3VS3A 1AWWA 3TREA 2LNVA 2HSPA 3CCLQ 2JN0A 4ZNXA 3OW2S 4JUVA 2PVGB 4ZGJB 1KHIA 4RTVA 1VQ9A 4AT1B 3CBMA 4M75F 3EFOB 3RNJA 5C0MA 5IHKA 3UT1A 3JCMX 1YITT 1JBMA 1B7TA 3I35A 4PFOA 2BZXA 3CCUQ 1P92A 1VYTA 3JCMh 1PNJA 2QYZA 2RQWA 3CCJA 1JJ2A 3G71Q 3GNFB 2ATCB 2FEIA 3URGA 1YFNA 2LC4A 4OB3B 1Y96A 3PTAA 1NLOC 1GFDA 2YUQA 3VJPA 1W4SA 2L3SA 3OS5A 5GAMh 2PVDB 3NHNA 2FPEA 2Y90A 2DO3A 2ZGWA 3QWXX 1SG5A 1BI1A 3CPWS 5C6SA 2E65A 1PM3A 4J6WA 1YI2T 1VQ6T 2ZAEA 2HKQB 2FL7A 4OB2B 5FWCA 3CCET 3TSZA 3VS5A 3RDVA 1FWZA 1M30A 3L2ZA 2E41A 2J05A 2LX9A 1R0CB 1YNZA 2DPPB 4J9IA 1TXQA 4E47A 1GFCA 1TUCA 3O5ZA 5L23A 1YJ9T 1QCFA 5DLQE 3GOXA 1RLQC 2LZ6B 3H9NA 1B34A 1OOTA 4GLKA 1X2KA 1M8MA 2K9GA 2O31A 4HCZA 1FMKA 3REAB 2L2PA 3SEMA 1VQ7T 5CR2A 5LJ3d 1TSFA 1PKTA 1IZ6A 5IT9E 3RR6A 3X20B 2QEXT 1XQHA 2KYMA 1SPKA 4KULA 2CT3A 5D6XA 1SHGA 3SD4A 5A0LA 3V8KA 4E7KA 4JRQA 1Q82C 3RUXA 3C4SA 2LMJA 1ZSZB 1UJ0A 2QASA 1AWJA 1H641 2DJZA 2YHTA 3GNGA 2K2MA 2OJ2A 4PFZA 3CCSQ 4IURA 2H3EB 2RD1A 4CI0C 4BE2A 2YWWA 3CMAT 3EFRA 1NEBA 1ZUKA 4QVDA 1W2BA 4AFUC 5FRNA 2O4XA 4R55A 2WSCE 2RN8A 4BI3A 2RHIA 1YHQQ 1HYOA 5CQXA 5LJ5g 4D8KA 1YP5A 1Y07A 4RUGA 1MMGA 1VIFA 1GL5A 4N4IA 2DZ9A 1K8AR 2KRSA 4M75C 2HQXA 4HCBA 1E7OA 2HDAA 3MEVA 5FU6C 1M3BA 4QKUA 3RKWA 1K73U 1R77A 1BBZA 1VQOQ 2GCXA 5LJ5f 1EX4A 1UB4A 3KUFA 2NUPA 2GFAA 1UUEA 1B3QA 2L0AA 2L8DA 1JXOA 4BD3A 3OQ5A 1K9MC 2KVQG 4IIMA 1IB8A 4J8OA 2CS7A 4DBQA 4FU6A 3LWHA 1S72A 2KRNA 2RQTA 1VQNT 8ATCB 2VC8A 1OZ2A 3HTRA 1RAGB 4C92E 1N8RC 3HFNA 3QYGB 1WQ7A 1RI0A 3A1PA 1UEBA 3J80E 2OAWA 4ORZA 2D9TA 1KD1C 1YIJA 1X43A 1ZA2B 3EG1A 2CUBA 4M75A 2AZSA 5GAN8 1SSFA 3CMEQ 4LE9A 1U5SA 3EHQA 1U8RA 3CXCA 1G3YA 3O8VA 2DL3A 3I9QA 3CD6A 5FU7B 3H0FA 4RTTA 2LCLA 3VUZA 4E7IA 3D7SB 1D0XA 3DLMA 2DEUA 4L6V5 2KBTA 2CZ1B 4ATOA 4M77A 2EW3A 3JB9D 1K0SA 3I5RA 1M5Q1 4XK8E 1KQ1A 3EG0A 1OZ3A 4C5HA 3E2UA 1MMDA 3OSVA 1CSKA 3EGXA 5CQYA 1X69A 3META 3JCMJ 1RL2A 4ZTJA 4J9HA 2F5TX 1I07A 2CP5A 3LGLA 3CC4Q 1WDXA 2RHUA 1VQ8T 1M1KC 1VQ4Q 3IQLA 5DM7R 2DZCA 1AZEA 2PNIA 4E6RA 3L42A 5KYWB 1Z9ZA 1TUGB 4X34A 2YT6A 1WX6A 1Q82U 2RQVA 3JB9F 4C0DC 1VYUA 3BY7A 2ZPBB 2ZPGB 4QVZA 4C5GA 1VQ5A 4XTVA 1WXTA 3MPUB 2A28A 1Q86R 4OMPA 5IN1A 3CC7T 3P8BB 3L1AA 3HRUA 5GAOn 2AIRB 4KRTA 4RTXA 2V8JA 5CKHA 2VKNA 4E7ZA 3CCMQ 2A36A 3ZEHA 2RHYA 4PLIA 1VQ9Q 1AHJB 2J6OA 4ZGEB 2CP6A 3CBOA 1YJWA 1SHFA 4J9FA 2X4YA 1A0NB 2NUZA 4C92D 1IRXA 2OTJA 2K5FA 3OB9A 2P0PA 4LD6A 4HVVA 4KGXB 3CCJQ 3S3NA 1UFFA 4P5NA 3PFSA 5GAOq 3JRZA 3QXEB 4A4FA 2ENMA 4OB1B 1K9MU 2D1XA 5GANh 4C8QG 4JLIA 4M7DA 2F69A 1WQWA 2EJFA 1C0MA 2RH2A 3H0HA 5LJ3j 2DRMA 5FROA 2I2LA 2DJQA 1UGSB 1N8RU 1WLPB 4QW2A 3HP9A 5LJ5h 4J9EA 2KXDA 5GMKh 1KD1U 3H41A 2E4HA 2CSIA 1K9AA 3EH1A 3WXMB 1PC0A 1Q7YR 2EVRA 1SRMA 3I56T 5IH2A 3OYDA 1UGQB 3QJYA 3SHWA 3AT1B 2ABLA 2K5IA 1WHMA 1HJDA 3JCMg 2KGTA 1AT1B 2A3LA 2ROTA 4DOWA 1VQKT 2BKDN 5KCOA 3VS6A 2MK5A 3CCST 2V1QA 2GQVA 5FLXE 2KT8A 4O6JA 2VWFA 5J26A 4JRKA 4B9WA 4GY5A 3OYBA 2LTOA 1WI7A 3JCMf 3PGGA 2F2XA 1N9SA 1XOVA 4RKUE 5GAMg 2XMFA 3OW2A 3OYGA 2CP3A 1YJNA 3M0QA 1M1KU 3P8HA 3EG9B 4OMQA 1VIEA 3M58A 4QT7A 1PRLC 3A8MB 4HT9A 5GAMf 1M90C 1GXIE 5FU7C 5GAOr 1FMVA 1KC8R 1VQMA 2H3JA 2CT4A 3CC2T 2L5QA 3G4ST 2RJEA 3MJXA 1LVKA 1UHFA 3VS4A 1PWTA 4DBRA 3V8JA 4RTZA 4M78A 4FYXB 4NL2A 3PIPA 5HKCA 1MNEA 4J7IA 5GAN6 2CH4A 5IHIA 3GBQA 5D7UA 4IUVA 3CPWA 3CC2A 1BIAA 2KE9A 2GNCA 3G4SA 1LJOA 1JEGA 4DA4A 2EFIA 2DTHA 1RLPC 1KQSS 2DYBA 3OYNA 2Z0WA 2YLCA 2DL8A 2OTLA 1KHCA 2EQUA 1KJWA 1ACMB 1TU0B 2FO0A 2QGFB 3VS0A 2SEMA 2RJDA 5KYYB 1QVFS 1D1CA 2E10A 5EC7A 3S3OA 5GAN7 2X4XA 5CAIA 2KNBB 2KYBA 3CCVA 2XU8A 1NM7A 3JAME 1SSHA 2LX7A 3LX7A 3FB9A 1SRLA 3MKDA 3UATA 4EPCA 5GAN5 5CKBA 4PJOB 2LNHB 3JB9I 4KGZB 5HK3A 1D3BB 2JM9A 2E5QA 1AWXA 2D0QB 5GAMj 2VXFA 4FYWB 3BDLA 1UGVA 1M2VB 4TVRA 1M3CA 3OYKA 2JTMA 1WJSA 4AMCA 1M90R 1NPRA 3MEAA 4LDWA 1BU1A 1AD5A 2C0IA 4C92C 3EH2A 5J3BA 2X3XD 4M7AA 5AYFA 2DRKA 3DLLA 5KYWA 2R5AA 1QMCA 2CH4W 2YXYA 4MMLA 1VQ4T 4HXJA 4OMNA 5GJWB 4J9DA 4RTWA 2VUBA 4C0FA 3OYAA 3FJ5A 2RI5A 4XTZA 1TG0A 4ANJA 4NOYA 5HK0A 4ZN1A 3G7ZA 2HSEB 4YTLA 3PMIA 5EG2A 5A2QE 2YDLA 5CCAA 2K5LA 4MMKA 4PJMA 1YCSB 2EKOA 2J7IA 2M0OA 2NYSA 2VXEA 1UGPB 4X1VA 4EMKB 2D8HA 2RI3A 2V1RA 1ARKA 2EIFA 4LDXA 4HCCA 4XTYA 4FYVB 2FRWA 4C92A 2EYZA 4J7FA 1AZGB 4C5EA 5LJ5d 1LCKA 2KY9A 1MGQA 3FJPA 5KYUA 5KE3A 4A4KA 1U1TA 3M0RA 1I1JA 3TVTA 4CC7A 2MMPA 3GIBA 3VS2A 3CBPA 3J7AF 2RMOA 2XKOC 1VQ5Q 4DOVA 2D8JA 3HKSA 3HL8A 2LJ0A 3JCMb 2MWPA 4PJOG 1M1GA 2LQNA 1RAAB 1OU8A 1VQLT 1YITA 2P0KA 4DEXA 2B86A 4Y91A 2XG8D 3CQTA 4JRPA 2PU9B 3H6ZA 3EHRA 1TWBA 4MZTA 1JJ2P 2W10A 3JCMc 2V26A 3QUIA 5KYXB 3JB9H 2RQUA 4MDXA 5L8RE 4GBQA 1OYXA 4M4ZA 2OTJQ 2EQKA 1BCMA 1V29B 3M0TA 3DB4A 1YI2A 3PE0A 1VQ6A 1C1AA 2DETA 1Q95G 4ESRA 4LD9K 1M27C 2KSSA 3CCEA 1QVGS 1RAHB 7AT1B 1K8AC 3TU4K 3EG2A 2ZZDA 3V7CA 3EAEA 4F7UA 1D1BA 5KE2A 3GPLA 4M75G 2YRDA 3L2RA 4XU2A 1DJ7B 5CVIA 2JOYA 2WACA 1YJ9A 2DL4A 1GBQA 2DK3A 2DXCA 1QWFA 1YCYA 1MNDA 3RMQA 2WSFE 4R0KA 2E6NA 3VYGA 2FPDA 5CO7A 2HEQA 3MCAB 4M77G 1OX9A 3NFCA 4KUDK 3QDRB 3KXTA 2O9VA 5IHNA 1VQ7A 1J3TA 2KXCA 2DL5A 3RERA 4XU1A 1V76A 2QEXA 2ZPHB 4C8QE 3Q1JA 1ZSGA 1Y0MA 4GLMA 3V7SA 3BDUA 4Z88A 9ATCB 2KAFA 2DFUA 5GANg 1IHVA 1SKUB 4AFQC 2ECZA 2JNGA 4XAXB 1MMAA 3LGFA 2HD0A 3QZ9B 3THKA 2IG0A 2OX7A 3EFSA 4NS5A 2NUTA 2BZ8A 2K3YA 2K57A 5I21A 5GANf 4E7JA 3CMAA 3EGUA 2L3QA 3T9NA 2LCCA 3UWNA 2DMOA 2HCKA 1NLPC 2KK4A 2QQAA 1VQMQ 4F16A 2FG0A 3G6EQ 1VQPT 3CCQQ 2EGEA 1N9RA 1IO6A 2FZGB 1M8VA 1W2BP 3EGDB 1NE8A 3M55A 1WHLA 3C94A 2CP7A 4PL6A 2CZ6B 3GF5A 2FYKA 4JJDA 1BIBA 1I8FA 4B6MA 3R6NA 1VQPA 3A8OB 1OPKA 3H8ZA 2EYXA 1I0CA 1TOVA 2DVJA 5D6YA 2QA4Q 2E6ZA 2X51A 4ZTFA 3I55T 1X75C 4QQDA 4K11A 1Q86C 2AK5A 1FYNA 2QG9B 3OY9A 3OYLA 4FCYA 3R6OA 1MUZA 3HRSA 1LOJA 2FHDA 1VQNA 4M7DG 1T0HA 2CP2A 4BY6B 2FZKB 2KMTA 4AG2C 5DLOA 1PKSA 2LT4A 5FW9A 4XU3A 3CCVQ 3JCMd 4N0AC 3MP8A 1XTDA 3OBYA 5GANj 3MHXA 3LW5E 2HBPA 1K8AU 5GAN2 2AZVA 2GBQA 5GMKi 4OMMA 4C8QB 2MAMA 1HSQA 3OYHA 4JJNK 2NWMA 2DF6A 2LRQA 3CCRT 5M9OA 2DLPA 3F70A 4F04B 5LJ5j 5GAMd 1WPYA 2DKGA 3JCMW 1YBYA 5GMKj 4CRIA 1KIKA 3QZ5B 2RQRA 4UC4A 3CXCP 2JMCA 5GAN4 3CCLT 1U06A 3EFOA 1X6GA 2PZ1A 1M1FA 4PJLA 5I22A 3CEYA 2VB6A 2CDTA 3M54A 3CCUT 1IXDA 1G3WA 2E64A 1ZBJA 2XD0A 1RAFB 4N0AA 4C8QF 1VQ8A 3X25B 3WVEB 3G71T 3VYHB 1XNIA 1WJQA 1Q7YC 3FIFA 3RMSA 2J6KA 2DVEA 3NTIA 3OYEA 1KQSA 1GCQC 3ULRB 3CCUA 1UGRB 1UTIA 1T3LA 1UDLA 1M4ZA 3HPWA 4AG1C 1WJRA 1X6OA 3VKIA 4BDYA 3CC7A 1ZA1B 4M78G 1QVFA 2L3PA 3DB3A 4HVWA 1ZSZC 4JJBA 2RK2A 2RJCA 3RKXA 2L89A 2MWOA 1QCOA 4E7LA 2QAZA 2DNUA 3QWYA 4HCKA 1MV3A 2XICA 5KYNA 1H8KA 4EMGA 5J39A 2COYA 4FYYB 3QSUA 3JSCA 2XIDA 3QHSA 2VASA 4ZN3A 2E5KA 1YITQ 2M0YA 2O88A 1BI0A 2QGGA 1QCNA 4DBFA 1KC8C 1ZBXA 2JMAA 1G5VA 1IHWA 1W1FA 1O9SA 3JB9G 2EKHA 1Q86U 1VA7A 3UPUA 2FRYA 3KBGA 3OS0A 1T3SA 4MZPA 1Y96B 4F14A 1W70A 1ZSZA 2JT4A 1YN8A 4XTUA 3BW1A 4KGVB 4EDUA 4BI4A 1PSFA 1YI2Q 5FWBA 4BB7A 1VQ6Q 3FLGA 2CZ0B 3X26B 4PJOE 3CCEQ 2DXUA 4R56A 4M7AG 2RHXA 2HBWA 3I56A 3JV3A 1W6XA 4FT4A 3S3MA 5IAYA 4KH1B 3UF4A 1PD1A 2EGCA 2YSQA 1YJ9Q 1VQKA 2GGRA 3OS2A 2QQRA 2M9UA 5LJ3e 2K4YA 3CCSA 2RHZA 2XHCA 2F2WA 2HL5C 1NPPA 2JTEA 1YHQT 1H3HA 4OF1A 1SF9A 4BY6C 2CGHA 1ABOA 1WFWA 5GAN3 4DBHA 2LQWA 3MO8A 2YUNA 2XDBA 2CZ7B 1B34B 4FT2A 1VQ7Q 2O2OA 3G6ET 1VQOT 2RA2A 2O9SA 3FRNA 3OYFA 4C8QC 5LL6S 1B07A 3JCMV 4C92G 1Q7YU 2MCNA 1D0ZA 3OW2P 2AKKA 1AEYA 1BI2A 5DY9A 4N4HA 3DKMA 2MF2A 3QDFA 3RBBB 4D8DA 1S1NA 4J9GA 2QDYB 3MEWA 3OYYA 2M02A 2QA4T 2EJ9A 1UG1A 3CMAQ 4XU0A 4M77E 2COWA 4HKEA 4E7HA 2LP5A 1G3SA 1YWPA 4IUQA 5GMKl 1EZZB 1UE9A 4A4GA 3CMET 5ECAA 2LQ8A 2QTVA 1QVGA 3QIIA 3CPWP 5FRMA 4AFSC 4LN2A 2W0ZA 2O4XB 1WYXA 3M0PA 3MP1A 4RTYA 2CSQA 4CC3A 2KDSA 1KC8U 3I5SA 3GLXA 1OX8A 2CYZB 1HXDA 2C0OA 1S72Q 2MOXA 2F2VA 4PJOD 2EAYA 2D0NA 4FSSA 3NPFA 5IXBA 2ED1A 3CC4T 1RUWA 3QO3A 2NUPB 1M2OA 2DL7A 1YIJQ 4WTOB 1IGUA 3RESA 1OULA 2RB6A 2RI2A 2YLBA 3TCJA 4F7UG 1CKAA 3FEOA 3C12A 1WNLA 2LCSA 1NBEB 4XTWA 4PJOF 3CD6Q 3PIOA 1WHGA 1WHHA 4OVAA 1VQ4A 3RKYA 3UDCA 2BZYA 3OMCA 3VS1A 5GANd 4LDUA 4Z02A 2CP0A 4PNOA 2E12A 4PK4A 4Y92A 4M75B 2M51A 5GAMe 2FPFA 2VGNA 5FU6B 2GFUA 4CC2A 4EMHA 1BYMA 4RTUA 2QXFA 2AKLA 3E1SA 2RNAA 3OYMA 2X35A 3CCMT 3ZBDA 4A63B 4M7DE 5CIUA 2XDDA 2GQIA 2DTOA 4BI8B 3QJ6A 1YWOA 2R58A 1K4US 1RAIB 1VQ9T 1M90U 1ZLMA 4M77B 2JTFA 2LJ1A 4Y28E 1EFNA 1NEGA 3ER0A 4JJCA 1RAEB 3EGXB 3E9GA 4M77D 2K79A 2KROA 2BIVA 1VQ8Q 3CCMA 3CCJT 3X28B 2P4RA 4OP0A 3A98A 2CKKA 2K6DA 5I2MA 1CKBA 1NYFA 2A37A 2HKNA 1JQQA 2K2VA 4PLLA 1K73C 3PVQA 2AT1B 2KI7A 2XK0A 4PJJA 1H92A 2JM8A 5CK9A 3HHTB 1BCOA 4M77F 1VQLA 3M59A 4IUUA 3CC7Q 2QTXA 3L2QA 4KBMB 1RADB 1ABQA 1YJWQ 2LT1A 1NG2A 3PT9A 4LUEA 3HRTA 1KFZA 4E7SA 1RI9A 4B9XA 1UECA 2KR3A 2EBPA 4JS4A 2DTIA 2PVOB 4J5YA 4X9DA 1KK7A 4A4EA 3LYIA 2P4TA 1QW1A 2ZCFB 3L2UA 2YRCA 4LNPA 5A0GA 4J6YA 2CUDA 2HZYA 2A0FB 3EG9A 4C0DB 1OEBA 2YRVA 2JUFA 3LWIA 4M78E 2R57A 4FSXA 2GTJA 1I4K1 2YUOA 4RG8A 1QKXA 1BK2A 2JW4A 4C0GA 4M7DB 4QVCA 3H0IA 1X6BA 1K73R 4M7DD 4PJOC 4BE0A 2K3BA 1TS9A 2E1HA 3OYIA 4F17A 3NMZC 1EIFA 2QI2A 3I56Q 4Z8AA 3PNWC 2F1LA 4IIOA 2QQSA 2P84A 3HFOA 2VYTA 4BUGA 1M3AA 1N6AA 2FB7A 1NJIC 2YUPA 1VQKQ 1JRIA 3QKJA 4C0ZA 1YJNQ 1X2QA 3C95A 1E6HA 1QP3A 4M7DF 3M5AA 1E6GA 4X9CA 2AHJB 2JVVA 2DIQA 5KYYA 1QVPA 1QQJA 4XQ3A 2VVKA 1Q81C 2JS2A 2M1HA 4NL3A 1PCXA 2PTKA 2B8AA 4PJOA 4M7AE 3M9QA 2C06A 3M4YA 1D3BA 1ZQ1A 2HAXA 1ZUYA 3QG1A 2LJ3A 1M2VA 5GJVB 2KT1A 2DERA 3V8LA 4EMKC 2JZ2A 1QKWA 3CC2Q 1S72T 3CPFA 3G4SQ 2J6FA 5GMKm 4FW1A 3A8LB 4J9BA 3QPHA 2HQEA 3A8HB 3G1JA 3VRYA 2XI9A 1BKBA 2OTLQ 3NTHA 4J83A 2EQMA 5I2SA 3TEEA 5CKDA 1JJ2S 3OA6A 4M77C 4BDZA 1UJYA 2LVMA 3GP8A 1JO8A 1YIJT 4L5GA 1JB0E 2G3RA 4M78B 1HK9A 3JCMP 3J81E 3A5ZB 2VGMA 3REBB 1RACB
chains in the Genus database with same CATH topology
4Z89A 2J05A 2JM9A 1AWXA 5I11A 1YNZA 4J9IA 1UGVA 2FRYA 1M3CA 1GFCA 1TUCA 1T3SA 1WA7A 3UA6A 3O5ZA 1V1CA 4AFZC 4F14A 1BU1A 1W70A 5IXFA 5L23A 2JT4A 1UHCA 1AD5A 1QCFA 1VYVA 1YN8A 1AVZC 2C0IA 1RLQC 2LZ6B 1G2BA 2X3XD 5FWBA 2DRKA 2CH4W 1OOTA 1X2KA 1M8MA 4HXJA 4OMNA 2K9GA 2O31A 1U3OA 1N5ZA 1FMKA 5GJWB 4J9DA 4RTWA 3REAB 3EG3A 3FJ5A 2L2PA 2HBWA 3SEMA 2DE0X 4DEYA 3JV3A 1TG0A 1W6XA 1PKTA 3VRZA 2KRMA 3UF4A 2KYMA 2EGCA 1SPKA 2YSQA 1BB9A 2YDLA 2GGRA 2CT3A 1SHGA 2SRCA 1YCSB 2F2WA 2J7IA 2JTEA 1H3HA 2ED0A 2LMJA 1ABOA 1UJ0A 1WFWA 1AWJA 4HVUA 2K2MA 2OJ2A 4X1VA 2LQWA 2D8HA 2JS0A 1GCPA 2V1RA 2YUNA 1ARKA 1X27A 2FRWA 1GBRA 2EYZA 1AZGB 2O2OA 1LCKA 4JZ3A 3LH5A 1SEMA 2O9SA 2DBMA 1NEBA 1B07A 4JPBW 1ZUKA 2MCNA 2K7AA 3M0RA 1I1JA 3TVTA 2AKKA 4AFUC 4CC7A 1AEYA 2RN8A 3VS2A 1G83A 2RMOA 3RBBB 4D8DA 1S1NA 2D8JA 4D8KA 4J9GA 1YP5A 4RUGA 1GL5A 2LJ0A 2C0TA 2EPDA 2KRSA 2A08A 4CC4B 1E7OA 2LQNA 2HDAA 2RPNA 1M3BA 1UG1A 1BBZA 1KSWA 4DEXA 2LP5A 2B86A 1YWPA 1UE9A 1ZX6A 1UUEA 3CQTA 1B3QA 2L0AA 1JXOA 5ECAA 3PVLA 1JU5C 3EHRA 4IIMA 1GRIA 1TUDA 1GCQA 2KRNA 2RQTA 4AFSC 2W10A 4LN2A 3TSWA 2W0ZA 1WYXA 3M0PA 2RQUA 4GBQA 3NGPA 2J06A 4RTYA 2CSQA 4M4ZA 4CC3A 3I5SA 2C0OA 2MOXA 4OMLA 3M0TA 2F2VA 2DBKA 2KEAA 3PE0A 2EQIA 2OAWA 4ORZA 1X43A 4ESRA 2D0NA 1K76A 3EG1A 4FSSA 1M27C 2CUBA 3NPFA 2AZSA 5IXBA 1K0XA 3EG2A 4LE9A 2ED1A 1U5SA 2ESWA 2X3WD 3EHQA 1RUWA 2DL7A 2DL3A 3I9QA 5HCKA 3H0FA 3M0SA 4LUDA 4RTTA 2KBTA 2DL4A 1CKAA 1GBQA 2EW3A 4WCIA 3I5RA 2LCSA 1K0SA 1QWFA 3EG0A 1WXUA 4R0KA 2FPDA 1CSKA 2HEQA 1X69A 2BZYA 3VS1A 4J9HA 2EGAA 1I07A 2O9VA 5IHNA 1WDXA 1AOJA 1J3TA 2KXCA 2DL5A 2JXBA 4Y92A 3IQLA 2M51A 3VS7A 4J9CA 3KFVA 2H8HA 3M0UA 2FPFA 1AZEA 1ZSGA 1Y0MA 2PNIA 4CC2A 4E6RA 1WIEA 4GLMA 1Z9ZA 4RTUA 2IIMA 2AKLA 4Z88A 2YT6A 1WX6A 2RQVA 2RNAA 1VYUA 2RF0A 4AFQC 4A63B 2ECZA 2GQIA 1YWOA 1K4US 1ZLMA 3THKA 1WXTA 2LJ1A 1EFNA 2A28A 2MIOA 1NEGA 4JJCA 3C0CA 2OI3A 4OMPA 2BZ8A 2DX1A 2K79A 2BTTA 2KROA 3EGUA 1K1ZA 2L3QA 2P4RA 2DMOA 3A98A 2HCKA 4KRTA 4RTXA 1NLPC 2K6DA 4JZ4A 2VKNA 1CKBA 1NYFA 4F16A 2FG0A 2EGEA 2A36A 2A37A 1QWEA 1IO6A 1JQQA 2I0NA 3PVQA 1OV3A 2J6OA 1SHFA 1H92A 2JM8A 4J9FA 1A0NB 1OPLA 2NUZA 4JJDA 3R6NA 4HVVA 1OPKA 1ABQA 2EYXA 1UFFA 1I0CA 2DA9A 2DVJA 1NG2A 2QDLA 2DM1A 4LUEA 2ENMA 1WXBA 1KFZA 2D1XA 1RI9A 4K11A 2AK5A 1FYNA 1UECA 2KR3A 2EBPA 2DILA 1ZUUA 1QLYA 1MUZA 3H0HA 2DRMA 1T0HA 2EYWA 2DJQA 1WLPB 3ZL7C 4AG2C 4LNPA 1PKSA 5FW9A 4J9EA 1Y57A 2KXDA 3H41A 2CUDA 2CSIA 1K9AA 1HD3A 2EVRA 1OEBA 2AZVA 2GBQA 1SRMA 5IH2A 4OMMA 3SHWA 1HSQA 1NYGA 2ABLA 2NWMA 2DF6A 1Z9QA 1HJDA 2DLPA 4EIKA 2GTJA 1PRMC 2KGTA 2YUOA 4OMOA 2ROTA 1QKXA 1BK2A 2JW4A 3VS6A 3U23A 1KIKA 2G6FX 3H0IA 2V1QA 2EYYA 1T0JA 2KT8A 2RQRA 1AWOA 1X6BA 2VWFA 2JMCA 1JXMA 1U06A 1X6GA 1WI7A 2K3BA 2F2XA 2PZ1A 4F17A 5I22A 3NMZC 1XOVA 2XMFA 3UA7A 2CREA 4Z8AA 4IIOA 2CDTA 2ROLA 3M0QA 1MV0B 2GTOA 1ZBJA 4OMQA 1M3AA 1PHTA 4QT7A 1PRLC 2YUPA 3VS3A 1X2QA 2J6KA 1AWWA 1E6HA 2HSPA 2CT4A 1E6GA 4ZNXA 1GCQC 3ULRB 1UHFA 4RTVA 3VS4A 1PWTA 1UTIA 1T3LA 1UDLA 2VVKA 4RTZA 2JS2A 3RNJA 5IHKA 4AG1C 2PTKA 3I35A 2BZXA 2CH4A 5IHIA 3GBQA 1VYTA 1PNJA 2RQWA 2KE9A 2GNCA 2L3PA 1ZUYA 4HVWA 2LJ3A 4JJBA 5GJVB 1JEGA 2FEIA 1RLPC 2DYBA 2KT1A 1NLOC 1QKWA 2DL8A 2YUQA 1GFDA 2DNUA 3QWYA 4HCKA 1MV3A 2J6FA 1H8KA 2L3SA 4J9BA 1KJWA 2FO0A 3VRYA 3NHNA 2FPEA 3QWXX 2E5KA 3VS0A 2M0YA 2SEMA 2O88A 1UJYA 5EC7A 2JMAA 2KNBB 2KYBA 1JO8A 1W1FA 1NM7A 5FWCA 1SSHA 2LX7A 3TSZA 3VS5A 3REBB 1SRLA 3UATA 2EKHA 1M30A 2LNHB 1VA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z89 A;  2J05 A;  2JM9 A;  1AWX A;  5I11 A;  1YNZ A;  4J9I A;  1UGV A;  2FRY A;  1M3C A;  1GFC A;  1TUC A;  1T3S A;  1WA7 A;  3UA6 A;  3O5Z A;  1V1C A;  4AFZ C;  4F14 A;  1BU1 A;  1W70 A;  5IXF A;  5L23 A;  2JT4 A;  1UHC A;  1AD5 A;  1QCF A;  1VYV A;  1YN8 A;  1AVZ C;  2C0I A;  1RLQ C;  2LZ6 B;  1G2B A;  2X3X D;  5FWB A;  2DRK A;  2CH4 W;  1OOT A;  1X2K A;  1M8M A;  4HXJ A;  4OMN A;  2K9G A;  2O31 A;  1U3O A;  1N5Z A;  1FMK A;  5GJW B;  4J9D A;  4RTW A;  3REA B;  3EG3 A;  3FJ5 A;  2L2P A;  2HBW A;  3SEM A;  2DE0 X;  4DEY A;  3JV3 A;  1TG0 A;  1W6X A;  1PKT A;  3VRZ A;  2KRM A;  3UF4 A;  2KYM A;  2EGC A;  1SPK A;  2YSQ A;  1BB9 A;  2YDL A;  2GGR A;  2CT3 A;  1SHG A;  2SRC A;  1YCS B;  2F2W A;  2J7I A;  2JTE A;  1H3H A;  2ED0 A;  2LMJ A;  1ABO A;  1UJ0 A;  1WFW A;  1AWJ A;  4HVU A;  2K2M A;  2OJ2 A;  4X1V A;  2LQW A;  2D8H A;  2JS0 A;  1GCP A;  2V1R A;  2YUN A;  1ARK A;  1X27 A;  2FRW A;  1GBR A;  2EYZ A;  1AZG B;  2O2O A;  1LCK A;  4JZ3 A;  3LH5 A;  1SEM A;  2O9S A;  2DBM A;  1NEB A;  1B07 A;  4JPB W;  1ZUK A;  2MCN A;  2K7A A;  3M0R A;  1I1J A;  3TVT A;  2AKK A;  4AFU C;  4CC7 A;  1AEY A;  2RN8 A;  3VS2 A;  1G83 A;  2RMO A;  3RBB B;  4D8D A;  1S1N A;  2D8J A;  4D8K A;  4J9G A;  1YP5 A;  4RUG A;  1GL5 A;  2LJ0 A;  2C0T A;  2EPD A;  2KRS A;  2A08 A;  4CC4 B;  1E7O A;  2LQN A;  2HDA A;  2RPN A;  1M3B A;  1UG1 A;  1BBZ A;  1KSW A;  4DEX A;  2LP5 A;  2B86 A;  1YWP A;  1UE9 A;  1ZX6 A;  1UUE A;  3CQT A;  1B3Q A;  2L0A A;  1JXO A;  5ECA A;  3PVL A;  1JU5 C;  3EHR A;  4IIM A;  1GRI A;  1TUD A;  1GCQ A;  2KRN A;  2RQT A;  4AFS C;  2W10 A;  4LN2 A;  3TSW A;  2W0Z A;  1WYX A;  3M0P A;  2RQU A;  4GBQ A;  3NGP A;  2J06 A;  4RTY A;  2CSQ A;  4M4Z A;  4CC3 A;  3I5S A;  2C0O A;  2MOX A;  4OML A;  3M0T A;  2F2V A;  2DBK A;  2KEA A;  3PE0 A;  2EQI A;  2OAW A;  4ORZ A;  1X43 A;  4ESR A;  2D0N A;  1K76 A;  3EG1 A;  4FSS A;  1M27 C;  2CUB A;  3NPF A;  2AZS A;  5IXB A;  1K0X A;  3EG2 A;  4LE9 A;  2ED1 A;  1U5S A;  2ESW A;  2X3W D;  3EHQ A;  1RUW A;  2DL7 A;  2DL3 A;  3I9Q A;  5HCK A;  3H0F A;  3M0S A;  4LUD A;  4RTT A;  2KBT A;  2DL4 A;  1CKA A;  1GBQ A;  2EW3 A;  4WCI A;  3I5R A;  2LCS A;  1K0S A;  1QWF A;  3EG0 A;  1WXU A;  4R0K A;  2FPD A;  1CSK A;  2HEQ A;  1X69 A;  2BZY A;  3VS1 A;  4J9H A;  2EGA A;  1I07 A;  2O9V A;  5IHN A;  1WDX A;  1AOJ A;  1J3T A;  2KXC A;  2DL5 A;  2JXB A;  4Y92 A;  3IQL A;  2M51 A;  3VS7 A;  4J9C A;  3KFV A;  2H8H A;  3M0U A;  2FPF A;  1AZE A;  1ZSG A;  1Y0M A;  2PNI A;  4CC2 A;  4E6R A;  1WIE A;  4GLM A;  1Z9Z A;  4RTU A;  2IIM A;  2AKL A;  4Z88 A;  2YT6 A;  1WX6 A;  2RQV A;  2RNA A;  1VYU A;  2RF0 A;  4AFQ C;  4A63 B;  2ECZ A;  2GQI A;  1YWO A;  1K4U S;  1ZLM A;  3THK A;  1WXT A;  2LJ1 A;  1EFN A;  2A28 A;  2MIO A;  1NEG A;  4JJC A;  3C0C A;  2OI3 A;  4OMP A;  2BZ8 A;  2DX1 A;  2K79 A;  2BTT A;  2KRO A;  3EGU A;  1K1Z A;  2L3Q A;  2P4R A;  2DMO A;  3A98 A;  2HCK A;  4KRT A;  4RTX A;  1NLP C;  2K6D A;  4JZ4 A;  2VKN A;  1CKB A;  1NYF A;  4F16 A;  2FG0 A;  2EGE A;  2A36 A;  2A37 A;  1QWE A;  1IO6 A;  1JQQ A;  2I0N A;  3PVQ A;  1OV3 A;  2J6O A;  1SHF A;  1H92 A;  2JM8 A;  4J9F A;  1A0N B;  1OPL A;  2NUZ A;  4JJD A;  3R6N A;  4HVV A;  1OPK A;  1ABQ A;  2EYX A;  1UFF A;  1I0C A;  2DA9 A;  2DVJ A;  1NG2 A;  2QDL A;  2DM1 A;  4LUE A;  2ENM A;  1WXB A;  1KFZ A;  2D1X A;  1RI9 A;  4K11 A;  2AK5 A;  1FYN A;  1UEC A;  2KR3 A;  2EBP A;  2DIL A;  1ZUU A;  1QLY A;  1MUZ A;  3H0H A;  2DRM A;  1T0H A;  2EYW A;  2DJQ A;  1WLP B;  3ZL7 C;  4AG2 C;  4LNP A;  1PKS A;  5FW9 A;  4J9E A;  1Y57 A;  2KXD A;  3H41 A;  2CUD A;  2CSI A;  1K9A A;  1HD3 A;  2EVR A;  1OEB A;  2AZV A;  2GBQ A;  1SRM A;  5IH2 A;  4OMM A;  3SHW A;  1HSQ A;  1NYG A;  2ABL A;  2NWM A;  2DF6 A;  1Z9Q A;  1HJD A;  2DLP A;  4EIK A;  2GTJ A;  1PRM C;  2KGT A;  2YUO A;  4OMO A;  2ROT A;  1QKX A;  1BK2 A;  2JW4 A;  3VS6 A;  3U23 A;  1KIK A;  2G6F X;  3H0I A;  2V1Q A;  2EYY A;  1T0J A;  2KT8 A;  2RQR A;  1AWO A;  1X6B A;  2VWF A;  2JMC A;  1JXM A;  1U06 A;  1X6G A;  1WI7 A;  2K3B A;  2F2X A;  2PZ1 A;  4F17 A;  5I22 A;  3NMZ C;  1XOV A;  2XMF A;  3UA7 A;  2CRE A;  4Z8A A;  4IIO A;  2CDT A;  2ROL A;  3M0Q A;  1MV0 B;  2GTO A;  1ZBJ A;  4OMQ A;  1M3A A;  1PHT A;  4QT7 A;  1PRL C;  2YUP A;  3VS3 A;  1X2Q A;  2J6K A;  1AWW A;  1E6H A;  2HSP A;  2CT4 A;  1E6G A;  4ZNX A;  1GCQ C;  3ULR B;  1UHF A;  4RTV A;  3VS4 A;  1PWT A;  1UTI A;  1T3L A;  1UDL A;  2VVK A;  4RTZ A;  2JS2 A;  3RNJ A;  5IHK A;  4AG1 C;  2PTK A;  3I35 A;  2BZX A;  2CH4 A;  5IHI A;  3GBQ A;  1VYT A;  1PNJ A;  2RQW A;  2KE9 A;  2GNC A;  2L3P A;  1ZUY A;  4HVW A;  2LJ3 A;  4JJB A;  5GJV B;  1JEG A;  2FEI A;  1RLP C;  2DYB A;  2KT1 A;  1NLO C;  1QKW A;  2DL8 A;  2YUQ A;  1GFD A;  2DNU A;  3QWY A;  4HCK A;  1MV3 A;  2J6F A;  1H8K A;  2L3S A;  4J9B A;  1KJW A;  2FO0 A;  3VRY A;  3NHN A;  2FPE A;  3QWX X;  2E5K A;  3VS0 A;  2M0Y A;  2SEM A;  2O88 A;  1UJY A;  5EC7 A;  2JMA A;  2KNB B;  2KYB A;  1JO8 A;  1W1F A;  1NM7 A;  5FWC A;  1SSH A;  2LX7 A;  3TSZ A;  3VS5 A;  3REB B;  1SRL A;  3UAT A;  2EKH A;  1M30 A;  2LNH B;  1VA7 A; 
#chains in the Genus database with same CATH topology
 1Q82 R;  4Z89 A;  4M78 D;  3I55 A;  3SWN B;  5I11 A;  2IVW A;  4ME7 A;  1NJI R;  3CD6 T;  3MEU A;  1R0B G;  1WA7 A;  2BE7 D;  3UA6 A;  1V1C A;  4AFZ C;  5IXF A;  2A7Y A;  1UHC A;  1VYV A;  2DD4 A;  1AVZ C;  4MDW A;  2FVU A;  1FX7 A;  4EMK A;  1G2B A;  4BAC A;  1C6V X;  3A8G B;  1H3Z A;  2VV5 A;  4C8Q D;  4OB0 B;  2RK1 A;  1Q81 R;  1U3O A;  1N5Z A;  4XTX A;  2FZC B;  3EG3 A;  4LXC A;  2DE0 X;  4M78 F;  4DEY A;  3QYH B;  4E2F B;  3VRZ A;  2KRM A;  5AT1 B;  3CCR A;  1N27 A;  3X24 B;  1IRE B;  5GAO l;  1BB9 A;  4DQ2 A;  3SB2 A;  2DD5 A;  2IPO B;  1PSE A;  2SRC A;  2LQK A;  1VQ5 T;  2ED0 A;  5CKE A;  5LJ3 g;  1D09 B;  2RM4 A;  3CCL A;  2D6F A;  4RCC A;  4HVU A;  2X4W A;  4QQ6 A;  2JS0 A;  1GCP A;  4M7A B;  3OMG A;  3BFM A;  5GAN e;  1X27 A;  2L3R A;  2P0Q A;  1K9M R;  2X4J A;  1GBR A;  3L2W A;  4JZ3 A;  5LJ3 f;  3LH5 A;  1SEM A;  4M7A D;  2DBM A;  1NJI U;  2EJG A;  3OYC A;  1MMN A;  4JPB W;  2K7A A;  3G71 A;  4JS5 A;  3OSS C;  1N8R R;  5LJ5 e;  5KYX A;  1G83 A;  4M7D C;  5GMK e;  1KD1 R;  4F7U E;  5KCH A;  3OBW A;  1I5L A;  1YJW T;  2C0T A;  1Q81 U;  2EPD A;  4RCB A;  2A08 A;  2XDP A;  1QP2 A;  4CC4 B;  1OQK A;  2R5M A;  2RPN A;  2F5K A;  2OTJ T;  2ZPI B;  1FMW A;  4A53 A;  4M7A F;  1KSW A;  1KQS P;  1W2B S;  3FDR A;  1Y71 A;  1XJW B;  1TH7 A;  4C92 B;  2MPX C;  1ZX6 A;  4FL6 A;  4N4G A;  3PVL A;  1JU5 C;  3M56 A;  1I81 A;  1GRI A;  5KYU B;  2WSE E;  4PKC C;  1TUD A;  1GCQ A;  2QK0 A;  1QVF P;  2RJF A;  3TSW A;  4KT0 E;  4HA8 A;  2QQ9 A;  2ZPF B;  3NGP A;  2MI6 A;  2J06 A;  2K3X A;  1MHN A;  1D0Y A;  1D1A A;  1VQL Q;  3RIR A;  4OML A;  1M1K R;  2DBK A;  3VV0 A;  3LLR A;  2EYQ A;  2KEA A;  2EQI A;  3M4G A;  4WF2 A;  1WHJ A;  1K76 A;  1R8O B;  4V2S A;  2DIG A;  1KG1 A;  1K0X A;  2X3W D;  2ESW A;  4C92 F;  1OI1 A;  1ZHI A;  4OGE A;  2E3H A;  5HCK A;  2OAU A;  3M0S A;  2KQW A;  4LUD A;  4KUI A;  2DXT A;  1RAB B;  3PMT A;  3MP6 A;  2Y4Y A;  4WCI A;  2COZ A;  1WXU A;  2DYI A;  3E19 A;  1M9S A;  2E3I A;  5GAO p;  3HSB A;  3CXC S;  2NLU A;  2EGA A;  1PD0 A;  1YJN T;  4M78 C;  1AOJ A;  2BUD A;  2GF7 A;  2JXB A;  1G3T A;  2HL3 A;  3VS7 A;  4J9C A;  3KFV A;  2H8H A;  3M0U A;  1WZO A;  3SWN C;  3OYJ A;  2PUK B;  3VU3 C;  6AT1 B;  1WIE A;  3ME9 A;  4F7U B;  3M53 A;  2IIM A;  1VQM T;  2PUO B;  3CCQ T;  2HNI A;  2RF0 A;  3EGD A;  2QEX Q;  1YHQ A;  3TQ7 P;  2DXB A;  5KH6 A;  4PFP A;  3S6W A;  4LDY A;  2E70 A;  4JLG A;  4ELY C;  2MIO A;  3QBY A;  3FC3 A;  1OU9 A;  3P8D A;  3C0C A;  2OI3 A;  4M75 E;  3INZ A;  4A54 A;  2DX1 A;  2BTT A;  4ELZ C;  1K1Z A;  3G6E A;  2V8I A;  3CCQ A;  1VQO A;  2BE9 B;  4JZ4 A;  5D6W A;  2O01 E;  4FW2 A;  1U1S A;  4MZM A;  2OTL T;  1IGQ A;  4OMF B;  1Y7X A;  1QWE A;  4F7U F;  4IKF A;  2I0N A;  2JJ9 A;  1OV3 A;  3SWN A;  4O5V A;  1VOM A;  3NTK A;  4A4H A;  1OPL A;  2QA4 A;  5LJ3 h;  4RG2 A;  4HT8 A;  4M7A C;  3CCV T;  1PG5 B;  2MYS A;  2EWN A;  4C8Q A;  2NUT B;  3JCM Q;  2QQB A;  4VUB A;  1X01 A;  2DA9 A;  2PQW A;  2QDL A;  2HMA A;  3M57 A;  4LDV A;  2DM1 A;  2HQH A;  4Q5W A;  2LDM A;  4FIB A;  3VUB A;  1WXB A;  3CME A;  1F1B B;  1VQP Q;  4JDS A;  2DIL A;  1ZUU A;  1QLY A;  4L59 A;  2RO0 A;  2V8K A;  4JRI A;  3OS1 A;  2Y4X A;  2M16 A;  2EYW A;  3SFM A;  3ZL7 C;  3N5B B;  1TTH B;  1QVG P;  1VUB A;  1Y57 A;  1VQN Q;  1G8X A;  4J6X A;  3L2V A;  4IUT A;  1HD3 A;  5A0D A;  4KH0 B;  4ZGD B;  3SDZ A;  3I55 Q;  2ZPE B;  4QQG A;  3JCM e;  1NYG A;  1LNX A;  4FM4 B;  4II1 A;  2X9H A;  1Z9Q A;  3CC4 A;  4RMO A;  4IUP A;  3BE3 A;  4EIK A;  1BI3 A;  3ASK A;  3V7R A;  4D6W A;  1PRM C;  4OMO A;  4OGC A;  3U23 A;  3E9F A;  2G6F X;  2DEQ A;  2EYY A;  1T0J A;  3ZFJ A;  1NZ9 A;  1AWO A;  3AHU A;  1JXM A;  1O75 A;  5GAO m;  2EQJ A;  4C5I A;  8AT1 B;  3WVD B;  1KQ2 A;  1WGS A;  3UA7 A;  2CRE A;  4M75 D;  4PJN A;  3LH0 A;  1LPL A;  5CKF A;  2ROL A;  1I5O B;  1MV0 B;  2GTO A;  1FXX A;  3JB9 J;  3CCR Q;  1PHT A;  5HY6 A;  2DAQ A;  1WHK A;  4BE1 A;  3VS3 A;  1AWW A;  3TRE A;  2LNV A;  2HSP A;  3CCL Q;  2JN0 A;  4ZNX A;  3OW2 S;  4JUV A;  2PVG B;  4ZGJ B;  1KHI A;  4RTV A;  1VQ9 A;  4AT1 B;  3CBM A;  4M75 F;  3EFO B;  3RNJ A;  5C0M A;  5IHK A;  3UT1 A;  3JCM X;  1YIT T;  1JBM A;  1B7T A;  3I35 A;  4PFO A;  2BZX A;  3CCU Q;  1P92 A;  1VYT A;  3JCM h;  1PNJ A;  2QYZ A;  2RQW A;  3CCJ A;  1JJ2 A;  3G71 Q;  3GNF B;  2ATC B;  2FEI A;  3URG A;  1YFN A;  2LC4 A;  4OB3 B;  1Y96 A;  3PTA A;  1NLO C;  1GFD A;  2YUQ A;  3VJP A;  1W4S A;  2L3S A;  3OS5 A;  5GAM h;  2PVD B;  3NHN A;  2FPE A;  2Y90 A;  2DO3 A;  2ZGW A;  3QWX X;  1SG5 A;  1BI1 A;  3CPW S;  5C6S A;  2E65 A;  1PM3 A;  4J6W A;  1YI2 T;  1VQ6 T;  2ZAE A;  2HKQ B;  2FL7 A;  4OB2 B;  5FWC A;  3CCE T;  3TSZ A;  3VS5 A;  3RDV A;  1FWZ A;  1M30 A;  3L2Z A;  2E41 A;  2J05 A;  2LX9 A;  1R0C B;  1YNZ A;  2DPP B;  4J9I A;  1TXQ A;  4E47 A;  1GFC A;  1TUC A;  3O5Z A;  5L23 A;  1YJ9 T;  1QCF A;  5DLQ E;  3GOX A;  1RLQ C;  2LZ6 B;  3H9N A;  1B34 A;  1OOT A;  4GLK A;  1X2K A;  1M8M A;  2K9G A;  2O31 A;  4HCZ A;  1FMK A;  3REA B;  2L2P A;  3SEM A;  1VQ7 T;  5CR2 A;  5LJ3 d;  1TSF A;  1PKT A;  1IZ6 A;  5IT9 E;  3RR6 A;  3X20 B;  2QEX T;  1XQH A;  2KYM A;  1SPK A;  4KUL A;  2CT3 A;  5D6X A;  1SHG A;  3SD4 A;  5A0L A;  3V8K A;  4E7K A;  4JRQ A;  1Q82 C;  3RUX A;  3C4S A;  2LMJ A;  1ZSZ B;  1UJ0 A;  2QAS A;  1AWJ A;  1H64 1;  2DJZ A;  2YHT A;  3GNG A;  2K2M A;  2OJ2 A;  4PFZ A;  3CCS Q;  4IUR A;  2H3E B;  2RD1 A;  4CI0 C;  4BE2 A;  2YWW A;  3CMA T;  3EFR A;  1NEB A;  1ZUK A;  4QVD A;  1W2B A;  4AFU C;  5FRN A;  2O4X A;  4R55 A;  2WSC E;  2RN8 A;  4BI3 A;  2RHI A;  1YHQ Q;  1HYO A;  5CQX A;  5LJ5 g;  4D8K A;  1YP5 A;  1Y07 A;  4RUG A;  1MMG A;  1VIF A;  1GL5 A;  4N4I A;  2DZ9 A;  1K8A R;  2KRS A;  4M75 C;  2HQX A;  4HCB A;  1E7O A;  2HDA A;  3MEV A;  5FU6 C;  1M3B A;  4QKU A;  3RKW A;  1K73 U;  1R77 A;  1BBZ A;  1VQO Q;  2GCX A;  5LJ5 f;  1EX4 A;  1UB4 A;  3KUF A;  2NUP A;  2GFA A;  1UUE A;  1B3Q A;  2L0A A;  2L8D A;  1JXO A;  4BD3 A;  3OQ5 A;  1K9M C;  2KVQ G;  4IIM A;  1IB8 A;  4J8O A;  2CS7 A;  4DBQ A;  4FU6 A;  3LWH A;  1S72 A;  2KRN A;  2RQT A;  1VQN T;  8ATC B;  2VC8 A;  1OZ2 A;  3HTR A;  1RAG B;  4C92 E;  1N8R C;  3HFN A;  3QYG B;  1WQ7 A;  1RI0 A;  3A1P A;  1UEB A;  3J80 E;  2OAW A;  4ORZ A;  2D9T A;  1KD1 C;  1YIJ A;  1X43 A;  1ZA2 B;  3EG1 A;  2CUB A;  4M75 A;  2AZS A;  5GAN 8;  1SSF A;  3CME Q;  4LE9 A;  1U5S A;  3EHQ A;  1U8R A;  3CXC A;  1G3Y A;  3O8V A;  2DL3 A;  3I9Q A;  3CD6 A;  5FU7 B;  3H0F A;  4RTT A;  2LCL A;  3VUZ A;  4E7I A;  3D7S B;  1D0X A;  3DLM A;  2DEU A;  4L6V 5;  2KBT A;  2CZ1 B;  4ATO A;  4M77 A;  2EW3 A;  3JB9 D;  1K0S A;  3I5R A;  1M5Q 1;  4XK8 E;  1KQ1 A;  3EG0 A;  1OZ3 A;  4C5H A;  3E2U A;  1MMD A;  3OSV A;  1CSK A;  3EGX A;  5CQY A;  1X69 A;  3MET A;  3JCM J;  1RL2 A;  4ZTJ A;  4J9H A;  2F5T X;  1I07 A;  2CP5 A;  3LGL A;  3CC4 Q;  1WDX A;  2RHU A;  1VQ8 T;  1M1K C;  1VQ4 Q;  3IQL A;  5DM7 R;  2DZC A;  1AZE A;  2PNI A;  4E6R A;  3L42 A;  5KYW B;  1Z9Z A;  1TUG B;  4X34 A;  2YT6 A;  1WX6 A;  1Q82 U;  2RQV A;  3JB9 F;  4C0D C;  1VYU A;  3BY7 A;  2ZPB B;  2ZPG B;  4QVZ A;  4C5G A;  1VQ5 A;  4XTV A;  1WXT A;  3MPU B;  2A28 A;  1Q86 R;  4OMP A;  5IN1 A;  3CC7 T;  3P8B B;  3L1A A;  3HRU A;  5GAO n;  2AIR B;  4KRT A;  4RTX A;  2V8J A;  5CKH A;  2VKN A;  4E7Z A;  3CCM Q;  2A36 A;  3ZEH A;  2RHY A;  4PLI A;  1VQ9 Q;  1AHJ B;  2J6O A;  4ZGE B;  2CP6 A;  3CBO A;  1YJW A;  1SHF A;  4J9F A;  2X4Y A;  1A0N B;  2NUZ A;  4C92 D;  1IRX A;  2OTJ A;  2K5F A;  3OB9 A;  2P0P A;  4LD6 A;  4HVV A;  4KGX B;  3CCJ Q;  3S3N A;  1UFF A;  4P5N A;  3PFS A;  5GAO q;  3JRZ A;  3QXE B;  4A4F A;  2ENM A;  4OB1 B;  1K9M U;  2D1X A;  5GAN h;  4C8Q G;  4JLI A;  4M7D A;  2F69 A;  1WQW A;  2EJF A;  1C0M A;  2RH2 A;  3H0H A;  5LJ3 j;  2DRM A;  5FRO A;  2I2L A;  2DJQ A;  1UGS B;  1N8R U;  1WLP B;  4QW2 A;  3HP9 A;  5LJ5 h;  4J9E A;  2KXD A;  5GMK h;  1KD1 U;  3H41 A;  2E4H A;  2CSI A;  1K9A A;  3EH1 A;  3WXM B;  1PC0 A;  1Q7Y R;  2EVR A;  1SRM A;  3I56 T;  5IH2 A;  3OYD A;  1UGQ B;  3QJY A;  3SHW A;  3AT1 B;  2ABL A;  2K5I A;  1WHM A;  1HJD A;  3JCM g;  2KGT A;  1AT1 B;  2A3L A;  2ROT A;  4DOW A;  1VQK T;  2BKD N;  5KCO A;  3VS6 A;  2MK5 A;  3CCS T;  2V1Q A;  2GQV A;  5FLX E;  2KT8 A;  4O6J A;  2VWF A;  5J26 A;  4JRK A;  4B9W A;  4GY5 A;  3OYB A;  2LTO A;  1WI7 A;  3JCM f;  3PGG A;  2F2X A;  1N9S A;  1XOV A;  4RKU E;  5GAM g;  2XMF A;  3OW2 A;  3OYG A;  2CP3 A;  1YJN A;  3M0Q A;  1M1K U;  3P8H A;  3EG9 B;  4OMQ A;  1VIE A;  3M58 A;  4QT7 A;  1PRL C;  3A8M B;  4HT9 A;  5GAM f;  1M90 C;  1GXI E;  5FU7 C;  5GAO r;  1FMV A;  1KC8 R;  1VQM A;  2H3J A;  2CT4 A;  3CC2 T;  2L5Q A;  3G4S T;  2RJE A;  3MJX A;  1LVK A;  1UHF A;  3VS4 A;  1PWT A;  4DBR A;  3V8J A;  4RTZ A;  4M78 A;  4FYX B;  4NL2 A;  3PIP A;  5HKC A;  1MNE A;  4J7I A;  5GAN 6;  2CH4 A;  5IHI A;  3GBQ A;  5D7U A;  4IUV A;  3CPW A;  3CC2 A;  1BIA A;  2KE9 A;  2GNC A;  3G4S A;  1LJO A;  1JEG A;  4DA4 A;  2EFI A;  2DTH A;  1RLP C;  1KQS S;  2DYB A;  3OYN A;  2Z0W A;  2YLC A;  2DL8 A;  2OTL A;  1KHC A;  2EQU A;  1KJW A;  1ACM B;  1TU0 B;  2FO0 A;  2QGF B;  3VS0 A;  2SEM A;  2RJD A;  5KYY B;  1QVF S;  1D1C A;  2E10 A;  5EC7 A;  3S3O A;  5GAN 7;  2X4X A;  5CAI A;  2KNB B;  2KYB A;  3CCV A;  2XU8 A;  1NM7 A;  3JAM E;  1SSH A;  2LX7 A;  3LX7 A;  3FB9 A;  1SRL A;  3MKD A;  3UAT A;  4EPC A;  5GAN 5;  5CKB A;  4PJO B;  2LNH B;  3JB9 I;  4KGZ B;  5HK3 A;  1D3B B;  2JM9 A;  2E5Q A;  1AWX A;  2D0Q B;  5GAM j;  2VXF A;  4FYW B;  3BDL A;  1UGV A;  1M2V B;  4TVR A;  1M3C A;  3OYK A;  2JTM A;  1WJS A;  4AMC A;  1M90 R;  1NPR A;  3MEA A;  4LDW A;  1BU1 A;  1AD5 A;  2C0I A;  4C92 C;  3EH2 A;  5J3B A;  2X3X D;  4M7A A;  5AYF A;  2DRK A;  3DLL A;  5KYW A;  2R5A A;  1QMC A;  2CH4 W;  2YXY A;  4MML A;  1VQ4 T;  4HXJ A;  4OMN A;  5GJW B;  4J9D A;  4RTW A;  2VUB A;  4C0F A;  3OYA A;  3FJ5 A;  2RI5 A;  4XTZ A;  1TG0 A;  4ANJ A;  4NOY A;  5HK0 A;  4ZN1 A;  3G7Z A;  2HSE B;  4YTL A;  3PMI A;  5EG2 A;  5A2Q E;  2YDL A;  5CCA A;  2K5L A;  4MMK A;  4PJM A;  1YCS B;  2EKO A;  2J7I A;  2M0O A;  2NYS A;  2VXE A;  1UGP B;  4X1V A;  4EMK B;  2D8H A;  2RI3 A;  2V1R A;  1ARK A;  2EIF A;  4LDX A;  4HCC A;  4XTY A;  4FYV B;  2FRW A;  4C92 A;  2EYZ A;  4J7F A;  1AZG B;  4C5E A;  5LJ5 d;  1LCK A;  2KY9 A;  1MGQ A;  3FJP A;  5KYU A;  5KE3 A;  4A4K A;  1U1T A;  3M0R A;  1I1J A;  3TVT A;  4CC7 A;  2MMP A;  3GIB A;  3VS2 A;  3CBP A;  3J7A F;  2RMO A;  2XKO C;  1VQ5 Q;  4DOV A;  2D8J A;  3HKS A;  3HL8 A;  2LJ0 A;  3JCM b;  2MWP A;  4PJO G;  1M1G A;  2LQN A;  1RAA B;  1OU8 A;  1VQL T;  1YIT A;  2P0K A;  4DEX A;  2B86 A;  4Y91 A;  2XG8 D;  3CQT A;  4JRP A;  2PU9 B;  3H6Z A;  3EHR A;  1TWB A;  4MZT A;  1JJ2 P;  2W10 A;  3JCM c;  2V26 A;  3QUI A;  5KYX B;  3JB9 H;  2RQU A;  4MDX A;  5L8R E;  4GBQ A;  1OYX A;  4M4Z A;  2OTJ Q;  2EQK A;  1BCM A;  1V29 B;  3M0T A;  3DB4 A;  1YI2 A;  3PE0 A;  1VQ6 A;  1C1A A;  2DET A;  1Q95 G;  4ESR A;  4LD9 K;  1M27 C;  2KSS A;  3CCE A;  1QVG S;  1RAH B;  7AT1 B;  1K8A C;  3TU4 K;  3EG2 A;  2ZZD A;  3V7C A;  3EAE A;  4F7U A;  1D1B A;  5KE2 A;  3GPL A;  4M75 G;  2YRD A;  3L2R A;  4XU2 A;  1DJ7 B;  5CVI A;  2JOY A;  2WAC A;  1YJ9 A;  2DL4 A;  1GBQ A;  2DK3 A;  2DXC A;  1QWF A;  1YCY A;  1MND A;  3RMQ A;  2WSF E;  4R0K A;  2E6N A;  3VYG A;  2FPD A;  5CO7 A;  2HEQ A;  3MCA B;  4M77 G;  1OX9 A;  3NFC A;  4KUD K;  3QDR B;  3KXT A;  2O9V A;  5IHN A;  1VQ7 A;  1J3T A;  2KXC A;  2DL5 A;  3RER A;  4XU1 A;  1V76 A;  2QEX A;  2ZPH B;  4C8Q E;  3Q1J A;  1ZSG A;  1Y0M A;  4GLM A;  3V7S A;  3BDU A;  4Z88 A;  9ATC B;  2KAF A;  2DFU A;  5GAN g;  1IHV A;  1SKU B;  4AFQ C;  2ECZ A;  2JNG A;  4XAX B;  1MMA A;  3LGF A;  2HD0 A;  3QZ9 B;  3THK A;  2IG0 A;  2OX7 A;  3EFS A;  4NS5 A;  2NUT A;  2BZ8 A;  2K3Y A;  2K57 A;  5I21 A;  5GAN f;  4E7J A;  3CMA A;  3EGU A;  2L3Q A;  3T9N A;  2LCC A;  3UWN A;  2DMO A;  2HCK A;  1NLP C;  2KK4 A;  2QQA A;  1VQM Q;  4F16 A;  2FG0 A;  3G6E Q;  1VQP T;  3CCQ Q;  2EGE A;  1N9R A;  1IO6 A;  2FZG B;  1M8V A;  1W2B P;  3EGD B;  1NE8 A;  3M55 A;  1WHL A;  3C94 A;  2CP7 A;  4PL6 A;  2CZ6 B;  3GF5 A;  2FYK A;  4JJD A;  1BIB A;  1I8F A;  4B6M A;  3R6N A;  1VQP A;  3A8O B;  1OPK A;  3H8Z A;  2EYX A;  1I0C A;  1TOV A;  2DVJ A;  5D6Y A;  2QA4 Q;  2E6Z A;  2X51 A;  4ZTF A;  3I55 T;  1X75 C;  4QQD A;  4K11 A;  1Q86 C;  2AK5 A;  1FYN A;  2QG9 B;  3OY9 A;  3OYL A;  4FCY A;  3R6O A;  1MUZ A;  3HRS A;  1LOJ A;  2FHD A;  1VQN A;  4M7D G;  1T0H A;  2CP2 A;  4BY6 B;  2FZK B;  2KMT A;  4AG2 C;  5DLO A;  1PKS A;  2LT4 A;  5FW9 A;  4XU3 A;  3CCV Q;  3JCM d;  4N0A C;  3MP8 A;  1XTD A;  3OBY A;  5GAN j;  3MHX A;  3LW5 E;  2HBP A;  1K8A U;  5GAN 2;  2AZV A;  2GBQ A;  5GMK i;  4OMM A;  4C8Q B;  2MAM A;  1HSQ A;  3OYH A;  4JJN K;  2NWM A;  2DF6 A;  2LRQ A;  3CCR T;  5M9O A;  2DLP A;  3F70 A;  4F04 B;  5LJ5 j;  5GAM d;  1WPY A;  2DKG A;  3JCM W;  1YBY A;  5GMK j;  4CRI A;  1KIK A;  3QZ5 B;  2RQR A;  4UC4 A;  3CXC P;  2JMC A;  5GAN 4;  3CCL T;  1U06 A;  3EFO A;  1X6G A;  2PZ1 A;  1M1F A;  4PJL A;  5I22 A;  3CEY A;  2VB6 A;  2CDT A;  3M54 A;  3CCU T;  1IXD A;  1G3W A;  2E64 A;  1ZBJ A;  2XD0 A;  1RAF B;  4N0A A;  4C8Q F;  1VQ8 A;  3X25 B;  3WVE B;  3G71 T;  3VYH B;  1XNI A;  1WJQ A;  1Q7Y C;  3FIF A;  3RMS A;  2J6K A;  2DVE A;  3NTI A;  3OYE A;  1KQS A;  1GCQ C;  3ULR B;  3CCU A;  1UGR B;  1UTI A;  1T3L A;  1UDL A;  1M4Z A;  3HPW A;  4AG1 C;  1WJR A;  1X6O A;  3VKI A;  4BDY A;  3CC7 A;  1ZA1 B;  4M78 G;  1QVF A;  2L3P A;  3DB3 A;  4HVW A;  1ZSZ C;  4JJB A;  2RK2 A;  2RJC A;  3RKX A;  2L89 A;  2MWO A;  1QCO A;  4E7L A;  2QAZ A;  2DNU A;  3QWY A;  4HCK A;  1MV3 A;  2XIC A;  5KYN A;  1H8K A;  4EMG A;  5J39 A;  2COY A;  4FYY B;  3QSU A;  3JSC A;  2XID A;  3QHS A;  2VAS A;  4ZN3 A;  2E5K A;  1YIT Q;  2M0Y A;  2O88 A;  1BI0 A;  2QGG A;  1QCN A;  4DBF A;  1KC8 C;  1ZBX A;  2JMA A;  1G5V A;  1IHW A;  1W1F A;  1O9S A;  3JB9 G;  2EKH A;  1Q86 U;  1VA7 A;  3UPU A;  2FRY A;  3KBG A;  3OS0 A;  1T3S A;  4MZP A;  1Y96 B;  4F14 A;  1W70 A;  1ZSZ A;  2JT4 A;  1YN8 A;  4XTU A;  3BW1 A;  4KGV B;  4EDU A;  4BI4 A;  1PSF A;  1YI2 Q;  5FWB A;  4BB7 A;  1VQ6 Q;  3FLG A;  2CZ0 B;  3X26 B;  4PJO E;  3CCE Q;  2DXU A;  4R56 A;  4M7A G;  2RHX A;  2HBW A;  3I56 A;  3JV3 A;  1W6X A;  4FT4 A;  3S3M A;  5IAY A;  4KH1 B;  3UF4 A;  1PD1 A;  2EGC A;  2YSQ A;  1YJ9 Q;  1VQK A;  2GGR A;  3OS2 A;  2QQR A;  2M9U A;  5LJ3 e;  2K4Y A;  3CCS A;  2RHZ A;  2XHC A;  2F2W A;  2HL5 C;  1NPP A;  2JTE A;  1YHQ T;  1H3H A;  4OF1 A;  1SF9 A;  4BY6 C;  2CGH A;  1ABO A;  1WFW A;  5GAN 3;  4DBH A;  2LQW A;  3MO8 A;  2YUN A;  2XDB A;  2CZ7 B;  1B34 B;  4FT2 A;  1VQ7 Q;  2O2O A;  3G6E T;  1VQO T;  2RA2 A;  2O9S A;  3FRN A;  3OYF A;  4C8Q C;  5LL6 S;  1B07 A;  3JCM V;  4C92 G;  1Q7Y U;  2MCN A;  1D0Z A;  3OW2 P;  2AKK A;  1AEY A;  1BI2 A;  5DY9 A;  4N4H A;  3DKM A;  2MF2 A;  3QDF A;  3RBB B;  4D8D A;  1S1N A;  4J9G A;  2QDY B;  3MEW A;  3OYY A;  2M02 A;  2QA4 T;  2EJ9 A;  1UG1 A;  3CMA Q;  4XU0 A;  4M77 E;  2COW A;  4HKE A;  4E7H A;  2LP5 A;  1G3S A;  1YWP A;  4IUQ A;  5GMK l;  1EZZ B;  1UE9 A;  4A4G A;  3CME T;  5ECA A;  2LQ8 A;  2QTV A;  1QVG A;  3QII A;  3CPW P;  5FRM A;  4AFS C;  4LN2 A;  2W0Z A;  2O4X B;  1WYX A;  3M0P A;  3MP1 A;  4RTY A;  2CSQ A;  4CC3 A;  2KDS A;  1KC8 U;  3I5S A;  3GLX A;  1OX8 A;  2CYZ B;  1HXD A;  2C0O A;  1S72 Q;  2MOX A;  2F2V A;  4PJO D;  2EAY A;  2D0N A;  4FSS A;  3NPF A;  5IXB A;  2ED1 A;  3CC4 T;  1RUW A;  3QO3 A;  2NUP B;  1M2O A;  2DL7 A;  1YIJ Q;  4WTO B;  1IGU A;  3RES A;  1OUL A;  2RB6 A;  2RI2 A;  2YLB A;  3TCJ A;  4F7U G;  1CKA A;  3FEO A;  3C12 A;  1WNL A;  2LCS A;  1NBE B;  4XTW A;  4PJO F;  3CD6 Q;  3PIO A;  1WHG A;  1WHH A;  4OVA A;  1VQ4 A;  3RKY A;  3UDC A;  2BZY A;  3OMC A;  3VS1 A;  5GAN d;  4LDU A;  4Z02 A;  2CP0 A;  4PNO A;  2E12 A;  4PK4 A;  4Y92 A;  4M75 B;  2M51 A;  5GAM e;  2FPF A;  2VGN A;  5FU6 B;  2GFU A;  4CC2 A;  4EMH A;  1BYM A;  4RTU A;  2QXF A;  2AKL A;  3E1S A;  2RNA A;  3OYM A;  2X35 A;  3CCM T;  3ZBD A;  4A63 B;  4M7D E;  5CIU A;  2XDD A;  2GQI A;  2DTO A;  4BI8 B;  3QJ6 A;  1YWO A;  2R58 A;  1K4U S;  1RAI B;  1VQ9 T;  1M90 U;  1ZLM A;  4M77 B;  2JTF A;  2LJ1 A;  4Y28 E;  1EFN A;  1NEG A;  3ER0 A;  4JJC A;  1RAE B;  3EGX B;  3E9G A;  4M77 D;  2K79 A;  2KRO A;  2BIV A;  1VQ8 Q;  3CCM A;  3CCJ T;  3X28 B;  2P4R A;  4OP0 A;  3A98 A;  2CKK A;  2K6D A;  5I2M A;  1CKB A;  1NYF A;  2A37 A;  2HKN A;  1JQQ A;  2K2V A;  4PLL A;  1K73 C;  3PVQ A;  2AT1 B;  2KI7 A;  2XK0 A;  4PJJ A;  1H92 A;  2JM8 A;  5CK9 A;  3HHT B;  1BCO A;  4M77 F;  1VQL A;  3M59 A;  4IUU A;  3CC7 Q;  2QTX A;  3L2Q A;  4KBM B;  1RAD B;  1ABQ A;  1YJW Q;  2LT1 A;  1NG2 A;  3PT9 A;  4LUE A;  3HRT A;  1KFZ A;  4E7S A;  1RI9 A;  4B9X A;  1UEC A;  2KR3 A;  2EBP A;  4JS4 A;  2DTI A;  2PVO B;  4J5Y A;  4X9D A;  1KK7 A;  4A4E A;  3LYI A;  2P4T A;  1QW1 A;  2ZCF B;  3L2U A;  2YRC A;  4LNP A;  5A0G A;  4J6Y A;  2CUD A;  2HZY A;  2A0F B;  3EG9 A;  4C0D B;  1OEB A;  2YRV A;  2JUF A;  3LWI A;  4M78 E;  2R57 A;  4FSX A;  2GTJ A;  1I4K 1;  2YUO A;  4RG8 A;  1QKX A;  1BK2 A;  2JW4 A;  4C0G A;  4M7D B;  4QVC A;  3H0I A;  1X6B A;  1K73 R;  4M7D D;  4PJO C;  4BE0 A;  2K3B A;  1TS9 A;  2E1H A;  3OYI A;  4F17 A;  3NMZ C;  1EIF A;  2QI2 A;  3I56 Q;  4Z8A A;  3PNW C;  2F1L A;  4IIO A;  2QQS A;  2P84 A;  3HFO A;  2VYT A;  4BUG A;  1M3A A;  1N6A A;  2FB7 A;  1NJI C;  2YUP A;  1VQK Q;  1JRI A;  3QKJ A;  4C0Z A;  1YJN Q;  1X2Q A;  3C95 A;  1E6H A;  1QP3 A;  4M7D F;  3M5A A;  1E6G A;  4X9C A;  2AHJ B;  2JVV A;  2DIQ A;  5KYY A;  1QVP A;  1QQJ A;  4XQ3 A;  2VVK A;  1Q81 C;  2JS2 A;  2M1H A;  4NL3 A;  1PCX A;  2PTK A;  2B8A A;  4PJO A;  4M7A E;  3M9Q A;  2C06 A;  3M4Y A;  1D3B A;  1ZQ1 A;  2HAX A;  1ZUY A;  3QG1 A;  2LJ3 A;  1M2V A;  5GJV B;  2KT1 A;  2DER A;  3V8L A;  4EMK C;  2JZ2 A;  1QKW A;  3CC2 Q;  1S72 T;  3CPF A;  3G4S Q;  2J6F A;  5GMK m;  4FW1 A;  3A8L B;  4J9B A;  3QPH A;  2HQE A;  3A8H B;  3G1J A;  3VRY A;  2XI9 A;  1BKB A;  2OTL Q;  3NTH A;  4J83 A;  2EQM A;  5I2S A;  3TEE A;  5CKD A;  1JJ2 S;  3OA6 A;  4M77 C;  4BDZ A;  1UJY A;  2LVM A;  3GP8 A;  1JO8 A;  1YIJ T;  4L5G A;  1JB0 E;  2G3R A;  4M78 B;  1HK9 A;  3JCM P;  3J81 E;  3A5Z B;  2VGM A;  3REB B;  1RAC B; 
#chains in the Genus database with same CATH homology
 4Z89 A;  2J05 A;  2JM9 A;  1AWX A;  5I11 A;  1YNZ A;  4J9I A;  1UGV A;  2FRY A;  1M3C A;  1GFC A;  1TUC A;  1T3S A;  1WA7 A;  3UA6 A;  3O5Z A;  1V1C A;  4AFZ C;  4F14 A;  1BU1 A;  1W70 A;  5IXF A;  5L23 A;  2JT4 A;  1UHC A;  1AD5 A;  1QCF A;  1VYV A;  1YN8 A;  1AVZ C;  2C0I A;  1RLQ C;  2LZ6 B;  1G2B A;  2X3X D;  5FWB A;  2DRK A;  2CH4 W;  1OOT A;  1X2K A;  1M8M A;  4HXJ A;  4OMN A;  2K9G A;  2O31 A;  1U3O A;  1N5Z A;  1FMK A;  5GJW B;  4J9D A;  4RTW A;  3REA B;  3EG3 A;  3FJ5 A;  2L2P A;  2HBW A;  3SEM A;  2DE0 X;  4DEY A;  3JV3 A;  1TG0 A;  1W6X A;  1PKT A;  3VRZ A;  2KRM A;  3UF4 A;  2KYM A;  2EGC A;  1SPK A;  2YSQ A;  1BB9 A;  2YDL A;  2GGR A;  2CT3 A;  1SHG A;  2SRC A;  1YCS B;  2F2W A;  2J7I A;  2JTE A;  1H3H A;  2ED0 A;  2LMJ A;  1ABO A;  1UJ0 A;  1WFW A;  1AWJ A;  4HVU A;  2K2M A;  2OJ2 A;  4X1V A;  2LQW A;  2D8H A;  2JS0 A;  1GCP A;  2V1R A;  2YUN A;  1ARK A;  1X27 A;  2FRW A;  1GBR A;  2EYZ A;  1AZG B;  2O2O A;  1LCK A;  4JZ3 A;  3LH5 A;  1SEM A;  2O9S A;  2DBM A;  1NEB A;  1B07 A;  4JPB W;  1ZUK A;  2MCN A;  2K7A A;  3M0R A;  1I1J A;  3TVT A;  2AKK A;  4AFU C;  4CC7 A;  1AEY A;  2RN8 A;  3VS2 A;  1G83 A;  2RMO A;  3RBB B;  4D8D A;  1S1N A;  2D8J A;  4D8K A;  4J9G A;  1YP5 A;  4RUG A;  1GL5 A;  2LJ0 A;  2C0T A;  2EPD A;  2KRS A;  2A08 A;  4CC4 B;  1E7O A;  2LQN A;  2HDA A;  2RPN A;  1M3B A;  1UG1 A;  1BBZ A;  1KSW A;  4DEX A;  2LP5 A;  2B86 A;  1YWP A;  1UE9 A;  1ZX6 A;  1UUE A;  3CQT A;  1B3Q A;  2L0A A;  1JXO A;  5ECA A;  3PVL A;  1JU5 C;  3EHR A;  4IIM A;  1GRI A;  1TUD A;  1GCQ A;  2KRN A;  2RQT A;  4AFS C;  2W10 A;  4LN2 A;  3TSW A;  2W0Z A;  1WYX A;  3M0P A;  2RQU A;  4GBQ A;  3NGP A;  2J06 A;  4RTY A;  2CSQ A;  4M4Z A;  4CC3 A;  3I5S A;  2C0O A;  2MOX A;  4OML A;  3M0T A;  2F2V A;  2DBK A;  2KEA A;  3PE0 A;  2EQI A;  2OAW A;  4ORZ A;  1X43 A;  4ESR A;  2D0N A;  1K76 A;  3EG1 A;  4FSS A;  1M27 C;  2CUB A;  3NPF A;  2AZS A;  5IXB A;  1K0X A;  3EG2 A;  4LE9 A;  2ED1 A;  1U5S A;  2ESW A;  2X3W D;  3EHQ A;  1RUW A;  2DL7 A;  2DL3 A;  3I9Q A;  5HCK A;  3H0F A;  3M0S A;  4LUD A;  4RTT A;  2KBT A;  2DL4 A;  1CKA A;  1GBQ A;  2EW3 A;  4WCI A;  3I5R A;  2LCS A;  1K0S A;  1QWF A;  3EG0 A;  1WXU A;  4R0K A;  2FPD A;  1CSK A;  2HEQ A;  1X69 A;  2BZY A;  3VS1 A;  4J9H A;  2EGA A;  1I07 A;  2O9V A;  5IHN A;  1WDX A;  1AOJ A;  1J3T A;  2KXC A;  2DL5 A;  2JXB A;  4Y92 A;  3IQL A;  2M51 A;  3VS7 A;  4J9C A;  3KFV A;  2H8H A;  3M0U A;  2FPF A;  1AZE A;  1ZSG A;  1Y0M A;  2PNI A;  4CC2 A;  4E6R A;  1WIE A;  4GLM A;  1Z9Z A;  4RTU A;  2IIM A;  2AKL A;  4Z88 A;  2YT6 A;  1WX6 A;  2RQV A;  2RNA A;  1VYU A;  2RF0 A;  4AFQ C;  4A63 B;  2ECZ A;  2GQI A;  1YWO A;  1K4U S;  1ZLM A;  3THK A;  1WXT A;  2LJ1 A;  1EFN A;  2A28 A;  2MIO A;  1NEG A;  4JJC A;  3C0C A;  2OI3 A;  4OMP A;  2BZ8 A;  2DX1 A;  2K79 A;  2BTT A;  2KRO A;  3EGU A;  1K1Z A;  2L3Q A;  2P4R A;  2DMO A;  3A98 A;  2HCK A;  4KRT A;  4RTX A;  1NLP C;  2K6D A;  4JZ4 A;  2VKN A;  1CKB A;  1NYF A;  4F16 A;  2FG0 A;  2EGE A;  2A36 A;  2A37 A;  1QWE A;  1IO6 A;  1JQQ A;  2I0N A;  3PVQ A;  1OV3 A;  2J6O A;  1SHF A;  1H92 A;  2JM8 A;  4J9F A;  1A0N B;  1OPL A;  2NUZ A;  4JJD A;  3R6N A;  4HVV A;  1OPK A;  1ABQ A;  2EYX A;  1UFF A;  1I0C A;  2DA9 A;  2DVJ A;  1NG2 A;  2QDL A;  2DM1 A;  4LUE A;  2ENM A;  1WXB A;  1KFZ A;  2D1X A;  1RI9 A;  4K11 A;  2AK5 A;  1FYN A;  1UEC A;  2KR3 A;  2EBP A;  2DIL A;  1ZUU A;  1QLY A;  1MUZ A;  3H0H A;  2DRM A;  1T0H A;  2EYW A;  2DJQ A;  1WLP B;  3ZL7 C;  4AG2 C;  4LNP A;  1PKS A;  5FW9 A;  4J9E A;  1Y57 A;  2KXD A;  3H41 A;  2CUD A;  2CSI A;  1K9A A;  1HD3 A;  2EVR A;  1OEB A;  2AZV A;  2GBQ A;  1SRM A;  5IH2 A;  4OMM A;  3SHW A;  1HSQ A;  1NYG A;  2ABL A;  2NWM A;  2DF6 A;  1Z9Q A;  1HJD A;  2DLP A;  4EIK A;  2GTJ A;  1PRM C;  2KGT A;  2YUO A;  4OMO A;  2ROT A;  1QKX A;  1BK2 A;  2JW4 A;  3VS6 A;  3U23 A;  1KIK A;  2G6F X;  3H0I A;  2V1Q A;  2EYY A;  1T0J A;  2KT8 A;  2RQR A;  1AWO A;  1X6B A;  2VWF A;  2JMC A;  1JXM A;  1U06 A;  1X6G A;  1WI7 A;  2K3B A;  2F2X A;  2PZ1 A;  4F17 A;  5I22 A;  3NMZ C;  1XOV A;  2XMF A;  3UA7 A;  2CRE A;  4Z8A A;  4IIO A;  2CDT A;  2ROL A;  3M0Q A;  1MV0 B;  2GTO A;  1ZBJ A;  4OMQ A;  1M3A A;  1PHT A;  4QT7 A;  1PRL C;  2YUP A;  3VS3 A;  1X2Q A;  2J6K A;  1AWW A;  1E6H A;  2HSP A;  2CT4 A;  1E6G A;  4ZNX A;  1GCQ C;  3ULR B;  1UHF A;  4RTV A;  3VS4 A;  1PWT A;  1UTI A;  1T3L A;  1UDL A;  2VVK A;  4RTZ A;  2JS2 A;  3RNJ A;  5IHK A;  4AG1 C;  2PTK A;  3I35 A;  2BZX A;  2CH4 A;  5IHI A;  3GBQ A;  1VYT A;  1PNJ A;  2RQW A;  2KE9 A;  2GNC A;  2L3P A;  1ZUY A;  4HVW A;  2LJ3 A;  4JJB A;  5GJV B;  1JEG A;  2FEI A;  1RLP C;  2DYB A;  2KT1 A;  1NLO C;  1QKW A;  2DL8 A;  2YUQ A;  1GFD A;  2DNU A;  3QWY A;  4HCK A;  1MV3 A;  2J6F A;  1H8K A;  2L3S A;  4J9B A;  1KJW A;  2FO0 A;  3VRY A;  3NHN A;  2FPE A;  3QWX X;  2E5K A;  3VS0 A;  2M0Y A;  2SEM A;  2O88 A;  1UJY A;  5EC7 A;  2JMA A;  2KNB B;  2KYB A;  1JO8 A;  1W1F A;  1NM7 A;  5FWC A;  1SSH A;  2LX7 A;  3TSZ A;  3VS5 A;  3REB B;  1SRL A;  3UAT A;  2EKH A;  1M30 A;  2LNH B;  1VA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...