2JS3A

Nmr structure of protein q6n9a4_rhopa. northeast structural genomics consortium target rpt8
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
96
structure length
96
Chain Sequence
b'MGSSHHHHHHSSGRENLYFQGMTDTAAEDVRKIATALLKTAIEIVSEEDGGAHNQCKLCGASVPWLQTGDEIKHADDCPVVIAKQILSSRPKLHAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title NMR structure of protein Q6N9A4_RHOPA.
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
total genus 14
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11519 DUF3222 Protein of unknown function (DUF3222)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.780 Mainly Alpha Orthogonal Bundle Helix Hairpins ITPase-like domains 2js3A01
2JS3A
chains in the Genus database with same CATH superfamily
4UCOA 3CRQA 4FM1A 4JI0B 3STLC 4HBNA 3RYFB 1NKDA 3SJBC 4UUJC 5L3DA 4X65B 3RYIB 1VQ5V 3WG7C 3AG7A 4LFAO 1E79G 3BCCH 1HDJA 3ZMTA 1ZUQA 4FJCC 2BTOA 4DR7B 4JI2B 2C2AA 4O2AA 3SPHA 1JA8A 1JJOA 2ZCEA 4IHJB 4BW5A 3K9AA 1D2DA 1AR5A 5K1XA 3ABKB 5CBGA 5CA0A 5KX5B 4OPAA 4BR6A 3AK2A 2UUCB 3OTOO 4CS4A 4AI8A 1NR7A 2IJHA 5H9CA 3UO2A 4EEQA 5IYZA 4PDVA 2HG5C 3C90A 2B1GA 1V54C 4HAMA 3D8CA 4UFZA 2HEPA 1MSWD 1AI6A 3JATB 3IAYA 4DR5B 5EZYB 2DWDC 4CS3A 3EHBB 1F23A 3RVYA 4BAYA 1HR0O 3OMIB 3E8FA 4I5SA 4FM2A 3OTFA 4BIUA 5B1NA 5H6QA 3OM3B 2PGGA 1Q3EA 1XREA 3UKMA 2H94A 3EXAA 3ETDA 1NU1H 5EBMC 4DW0A 1AVMA 3AG4B 2EJ7A 1QHTA 3ABTA 3T1CA 5IYCO 1N32O 2OTJV 3QTCA 3QO5A 1VQ9V 1JR9A 5CB4A 4O4IB 3LDCA 1WNSA 1YSCA 3K03A 3WB0A 2QWPB 1R3LC 4I55B 1BHAA 1E1RG 4H33A 3H1IH 4JAVA 3J7AU 1AR1B 2W0FC 1FFXB 3ZMVA 1IBLO 4KXRA 4MTOA 4U3JB 4DV4B 4LFBB 3UCSC 4EFBA 1L1FA 2CTQA 2X7RB 3Q4HA 1N36O 1WA8B 4UCUA 1VARA 3AG4C 3ZHTA 2XHBA 3ZRSA 3HKCA 2H3OA 1AI4A 4K0KB 3N2KB 2E5LO 4MT8A 3GWKC 3SPCA 3P30A 1JJ2U 2EIJC 2ZR2A 1KBHA 4X66B 1NBMG 1S77D 4IL6Z 2IU3A 4JI0O 4QNHB 3SPIA 3A2FA 4X65O 2HJFC 4HNAB 5ITZB 5KUMA 2Z0AA 3JAMN 4DUZB 2Q6AA 5DN6G 1TA8A 1Z5WA 4L8JA 3HKBA 3EFFK 2YUAA 2YDEA 4DR7O 1Y76A 4JI2O 4MTGA 5KMGA 1Q6UA 3VQWA 1N33B 4QPKA 3ZRXA 4O4LB 1B04A 4X1IA 1WB7A 5FNVB 1Q7YW 3BA8A 2UUCO 3CC7V 2KB1A 3J80N 2DW4A 3JAKA 4X1YB 1VQOV 3E89A 4X9QA 4LF9B 2N05A 3X2QB 2GUZA 2ZE6A 3CCJV 2AZ0A 4JYYA 4DR5O 2QJ1A 2RDCA 1HP8A 2QM4A 2IBZH 2HLDG 4Q6GA 1H2LA 5L3EA 3G4SV 1VQ6V 3FFQA 2DOSA 5CBFA 3JARA 1NS1A 4RUFA 1FS0G 3U11A 1SQPH 4Q20A 3E86A 2ZINA 5FL7G 2Q9LA 3LSUA 2YS8A 5EYPB 5CMUA 2R70A 5JVDA 3G67A 2MK3A 4HZ3A 3ETGA 2A9HA 2P5OA 2E75B 3TXSA 3RGBA 4GT1A 4FZ0A 1N8RW 5B1OA 3A0BZ 5IYDO 1XILA 1DGSA 4ASUG 4BWAA 3PJSK 4J10A 5L3FA 2R9IA 4XBFA 1M93A 5B1BB 1XL6A 4RO2A 4JGSA 4ZI7A 4RQEA 4DV4O 2V7QG 2WLLB 4LFBO 3ZMSA 1TUBA 3ZHQA 3S3WA 4TT3G 3P32A 2QTOA 3JYCA 4PA6A 4N23A 4EKWA 3KCYA 1QLEB 2PYLA 4U7NA 1PNLA 3FB5C 3TETA 1SA0A 5H5NA 5LOVB 4K0KO 3FB8C 4FLVA 1KP3A 5KA6A 2P06A 1KYOF 4X66O 4ZHQB 5GONA 5FPOA 1X59A 2B5UA 1EN5A 1XL4A 1GTOA 1YTFB 2MW2B 2PF4E 4DUZO 4LF8B 3WU2Z 3AK3A 3OAAG 4ZBMA 3CCEV 4R8CA 2QWOB 3K0GA 1I94B 1SQVH 2Z5UA 4I0XA 4YJ3B 2VWJA 3EVKA 4LC1A 1BT8A 2QSAA 1NJIW 2CK3G 1N33O 4F6RA 1BHBA 3OR7C 1QLEC 3BY6A 4YJ2B 4IYHA 2QDOA 5KHKA 4KL1A 5JQGB 1JPXA 5LYJA 1FKAO 2UUAB 1RM1B 2ZE8A 3IJ4A 1VQKV 3FX7A 4PD4F 1XMOB 3UT5A 2OYQA 4LF9O 2EZPA 1FXKC 1KKCA 1M57B 5F2VO 3RYHA 1HNXB 4JV5B 4W4LA 5EK0A 5E79Z 3F5WC 1Q43A 1H8HG 4O4JB 2RMKB 3E22A 1H2MA 3F7YC 3JD4A 1GRJA 1B06A 4G27B 1K33A 4JI5B 4X1KB 4CC5A 2ILMA 1JFFA 1XNRO 3JALA 4A5UB 2IW5A 3B09A 3ETQA 3W7TA 3ETEA 3GB7C 1VQPV 5E1AC 1JVMA 2W6IG 1YI2V 4DV7B 2P90A 2PY5A 4LWSB 4TUYA 1GN3A 3CXCU 3CRRA 1QQCA 2WAMA 4OX9B 2XAFA 1M57C 5LGNA 3CWBH 1K92A 3I55V 1NTKH 5J2UA 3JD2A 4DV1B 4JI4B 1M4UA 1SQGA 3JSLA 2QWRB 5LA6B 1BQ0A 1GM8A 1BL8A 3CPWU 1Z5VA 2QWNB 5IY5B 3OEEG 4J41A 1R3IC 1OCOB 4CS2A 4BW9A 5C93A 1G8MA 1Q82W 4GYCB 1VQ7V 4J9ZB 1VEWA 5KAIZ 2BTQA 1WP8A 1K4CC 1GM7A 4PDLA 2DMXA 3CYOA 3HKEB 2QWQB 2ZDIC 1W2BU 1PKXA 3OMAB 3BA9A 1GK9A 5D5PA 3SYQA 1GN2A 4DK1A 4N21A 1HNZB 3UO3A 4LF6B 4QPJA 3IC7A 4JAAA 2LJ2A 2DE0X 4K8XA 5L3GA 3CJHB 4I50A 4PA9A 2QEXV 2ADQB 2F66C 4ZKIA 1I94O 5FLXN 2IM9A 3AG1B 3B40A 1MZEA 3OGIB 1VF7A 2KG7A 4PA7A 2ODMA 1AJNA 1WAZA 4JI1B 1JX9A 5IY5C 3S3XA 3U0ZA 3HKDA 3H1JH 1OCOC 3P3NA 1KC8W 3SJCC 1N0NA 1X4TA 2UUAO 1KP2A 3ZX6A 4O2AB 1FXVA 2CAZC 1M1KW 4DV3B 1TVKA 5KAFZ 1IX9A 1XMOO 5J2TB 1R3JC 3CHXA 3CX5F 3CEIA 4FK5C 3ZRWA 4MVRA 2Y48A 1FPOA 2YIAA 5BMVB 1PM9A 1JOYA 2UXDB 1PNMA 4I7ZB 2JS5A 3FYEB 1IDSA 1Q6IA 4ABMA 4Z1MG 1HNXO 4JV5O 4DUYB 1ZAUA 3H1KH 2OT5A 5CN0A 5IYZB 3ZEDA 4DV5B 5DEDA 4FLZA 3LNMB 1JMKC 2IH3C 3F5TA 1SQQH 3OUSA 4JI5O 4Z1VA 4TOIA 4R6ZA 4P9PA 4CH3A 1US6A 2BOBC 2ZQMA 1M90W 1FJGB 1OV9A 2JRIA 1P84F 4WF9V 4KHPB 3SYOA 4FPPA 3AEIA 2N74A 3MHHC 2HR3A 3TXQA 4DV7O 2B1IA 3B2EE 1W0JG 4F6EA 1ZX3A 2K9PA 1RFYA 2XAQA 5B1AC 3QVNA 2YI8A 4OX9O 2AW9A 2ZM6B 1WP7A 1BGYH 1YIJV 2ZR3A 1OCZB 2JVDA 3SYAA 2WLJA 1AI7A 4LFCB 5K1PA 1NVPD 4DV1O 5BY1A 4JI4O 4NTWA 3CB2A 1K8AW 2P7TC 4JI8B 2CH7B 1S76D 1MG1A 5IWAB 2F1MA 2UXNA 4C7UA 3K06A 1UFIA 4DR1B 2K1EA 4O4HA 2LO1A 2Q8VA 3JASA 1IBMB 2ZE5A 3MD0A 5KHGA 3MDSA 2UXBB 3J81N 2O57A 2BE3A 3JCUZ 2H8PC 3KKYA 1NT2B 4B7KA 3OD4A 1I7FA 4AILC 3Q4HB 4X62B 5IJ9A 3LDEA 1TGOA 1DK1A 4IIJA 1ZL8B 2XT9A 2WPDG 3D3QA 3L75H 1OCZC 3OMNB 3ABKC 4LF5B 1HNZO 3HKCB 5KHHA 4LF6O 2EZOA 1K4DC 4FIPC 1H2GA 1LUWA 1EFRG 1M5IA 1A32A 2R72A 3F7VC 4B7EA 2YC0A 2CTRA 5EIBC 3E83A 2PI4A 2Q0OC 3SYPA 1RP3B 5KHIA 1PP9H 4JI1O 1BSMA 2Q67A 4GX0A 1GMGA 1AJQA 4QE7A 3HKBB 4MVUA 3ABMB 2IJIA 2E76B 4UXNA 1KMIZ 1Y76B 3M8AA 3QO8A 4JTDB 4YXWG 4JPRA 4DV3O 5KMGB 2HJDA 2WLMA 1QR8A 2RN9A 4TQDA 1S3JA 2UXDO 3HB3B 3G6BA 4OPHA 4X1IB 3BHPA 2X0LA 2CGOA 4WFGA 2PZSA 1DF4A 3K5MA 4NXMB 3DXRA 1YZBA 4DUYO 3D36C 3JATA 2F93B 3VQXA 3JAKB 2N04A 4DV5O 2M7WA 2P4VA 3I56V 1F7YA 3SDLA 2WLNA 1Q90D 3T1YO 2GUZB 2VS0A 1T5EA 2Q73A 4H44B 2EJRA 1FJGO 2A79B 5LP6A 3ABMC 4KHPO 1K97A 4FVMA 4WFBV 1EBOA 1G6UA 3LDDA 2DYRB 4UVCA 1PV0A 3JARB 4ZIBA 2XOKG 4PI0A 2LFSA 4PELA 1FFTB 1Y67A 2CGNA 2DN9A 1K73W 1H38A 4PHZA 2G38A 1AJPA 4U3FH 5DECA 2ZM6O 1N34B 4O4IA 2QTSA 4EB6A 1GN6A 5AG2A 4LFCO 4G28B 1N4CA 2JK5C 3FKSG 4I55A 4ZOLA 2YXHA 3G6EV 4E2LA 1VQMV 4PI2A 4JI8O 5IWAO 4YIPA 1OZ0A 4DR1O 3CD6V 4WBNB 1IBMO 1SESA 5DM6V 2FB5A 2UXBO 4NB5A 5LHHA 1I5YA 1VF5B 4ZI7B 3JAWA 2EBOA 2F95B 3BABA 1TUBB 1NH2D 1WN7A 2FL4A 2PYJA 1ZWIC 3N2KA 4X62O 4TV9B 1SS3A 4LF5O 3L73H 4MVOA 1XNRB 3M99B 1SA0B 1UJWB 1PD3A 3U10A 1DLBA 3N27A 2E74B 2AHYA 5GONB 1QLNA 3IGAC 1XNQB 3B8MA 4BIOA 4X89A 3ZHSA 3O9OA 4B3RB 3K9SA 3ZMUA 1WPBA 5JWPA 5H2FZ 2IJJA 2LW7A 3X2QC 1E1QG 3BFRA 2DYSB 4KFMA 1WPXA 4K35A 1H2NA 5LGTA 3DTUB 3FAVA 1OJHA 1XHXA 1W0KG 5FNVA 4PV1B 4F6RB 1MA1A 4DO2A 3CRCA 2ZIOA 3G71V 3D3IA 3AK1A 3OUFA 5LXTA 1ZLZA 4X20A 1G4YB 4NXMO 2VQFO 2RQ6A 3ZJZA 2L6LA 3UT5B 3CMAV 2GHYA 1OCCB 1GAXA 3SJQC 5GW7A 4I4TB 1BCCH 2ZD9A 4D7SA 4D7TA 1QVFU 4J7KA 1I5XA 2LP7A 4JI3B 1SZXA 5A9GA 2Q69A 3VQVA 1K7DA 1IZ3A 1S5HC 3DGEA 3ZN1A 1QNMA 1D5AA 3E22B 4B08A 4J7JA 2V4DA 5B1BC 1AB3A 5EYPA 3NR7A 3ABLB 5LMNB 2YSUB 2YIBD 1BS3A 4FLTA 1JFFB 5IJ0A 5JH7A 1R6KA 4UV9A 1G1XB 3W7SA 1NZ6A 3RYCB 5B66Z 1N34O 3JD1A 3CE2A 1XEQA 4GKKO 2JEUA 3RFRA 4TUYB 4O2BB 2ZIMA 4MTXA 3K5OA 5LMUB 3VQYA 2GBOA 4NXNB 1XUQA 5BXZA 4LF7B 1M56B 5J2UB 4MW8A 4MS2A 1I0HA 1VF6C 5JJEB 4TV8A 2M6YA 4G2KA 1L0NH 1SC5B 2UUBB 1AILA 1QR9A 1XQ8A 4E4EA 4MVQA 3KCXA 2XASA 1RSOA 4ICGA 4NKGB 2YICA 4R7CA 3VBBA 4DV0B 2FMLA 2YXLA 2BTQB 2ATKC 1FXKA 4B3MB 2WLIA 2B9ZA 4YY3B 3ZHVA 2WWWA 4JI7O 2A3QA 1XNQO 1RM1C 2VQEB 1V9PA 4IGGA 3L74H 2Y4TA 4JZGA 4B3RO 2FTKA 2YXYA 1WJZA 5KA5A 2DWEC 1M56C 3CCUV 4JZ2A 3RW0A 3H01A 1VQ8V 2FYUH 4LNUA 2HKOA 3TJTA 3N2GB 2XNDG 2YEVA 4UCVA 1COWG 5JQGA 3LNNA 1JQ0A 1JCHA 2KKWA 2KG7B 2X6CA 1BQZA 1H2SB 5CA1A 5A2QN 4B3TB 2UXCB 5IT9N 1I08A 4PA3A 3CRAA 1Y74A 4QGPA 5JJNB 3W7WA 1YVWA 1TVKB 4LBEC 4I9WA 4JASA 2CDYA 4FLUA 3ZIAG 3MAQA 4J9YB 3BEHA 1IBKB 5B3SB 4PA4A 3W7XA 4D6TH 2EILB 3K58A 1K5SA 4JI3O 3M7MX 4PJ0Z 1EN6A 1ROPA 3K04A 1WLEA 2DQ3A 2ZXWB 5LMNO 4CBCA 3FD9A 5B5EZ 1FYJA 3SYCA 1P7GA 3HR0A 3ZS8C 2EX3A 2QKCA 5C8YA 2V1DA 2X6BA 5LBQA 2PUSA 4FZ1A 4LWSA 5KHJA 4WFEA 3CCLV 3E8HA 2ZDIA 4DV6B 2D2CB 2EULA 1S72V 3K79A 3SJAC 3TCUA 4GUNA 4DV2B 5LMUO 5EBLC 4NXNO 2ZE7A 4JI6B 2W6JG 5B3SC 4JTAB 1YJWV 2EINB 1D5NA 2ZNJA 2EILC 4LF7O 2VRZA 5CA0B 2OTLV 5JCOC 4GX2A 2EIKB 2EIMB 2OCHA 1QBZA 2LGQA 2UUBO 3A0RA 2ZXWC 5EC2C 2JGDA 3APQA 3HPLC 4UVAA 1Q5OA 5LHGA 3CCQV 3AG1C 3WFVA 5IE9A 2YIDA 3JCZA 4O4HB 3T1YB 1H8EG 2AGAA 1J95A 1SETA 1P4RA 2LGWA 4DV0O 4KP4A 4FM0A 4B3MO 4YY3O 3TK1A 2VQEO 1O9GA 3OE7G 2Y0IA 2P67A 1YJNV 4TSFG 2QM8A 4H13B 1OHHG 4IIJB 2EINC 1P49A 4IT5A 3E2EA 3B77A 3QG5A 1V54B 4XDJA 4MVSA 2EIKC 4NYKA 5FPRA 1H2KA 2F23A 2BSKA 2EIMC 1YHQV 3SPGA 4Z2WA 1URFA 2JIZG 5HFMA 5CA3A 1Z2GA 4DR4B 3BVOA 1LNQA 5TISZ 2F43G 2NN4A 5CB4B 3E8BA 3L70H 1F4MA 4FFBA 4B3TO 4K8ZA 1PL0A 4GKJB 4DRXA 2UXCO 4LF4B 5J2TA 2PTMA 4MW3A 2QGNA 1SQXH 2BOCC 1S0VA 5BMVA 1BZKA 4P30A 4RWUA 4H0LB 2KQXA 2JJ1G 1Q8IA 2YIBA 2F4VB 2ARHA 3SGIA 3W7UA 1IBKO 5LGUA 3E35A 4JTCB 1Q81W 3C3TA 3FYIB 1HW7A 3DXRB 1RPRA 4UV8A 3RYFA 3DC6A 3ML0A 4R50A 4CC6A 4U7OA 3FB7C 3RYIA 5L3BA 2NNUA 1KU9A 1R6TA 1RPOA 1YJ9V 1EN4A 3ZN0A 5LP6B 1KECA 2WLKA 2UU9B 3G80A 4X88A 1NQTA 2HVKC 4IHJA 4DV6O 2CE4A 2Q0AA 1YTFD 2AXTZ 4OGQB 3ZHRA 1VP7A 1QU7A 1YDXA 5KX5A 4DV2O 3CC4V 2EIJB 2YI9A 2W0XA 1XMQB 4JI6O 2KSDA 2CH7A 4EB6B 2Y69B 2XAJA 1N0JA 2Q4PA 3FB6C 4ZOLB 4GX1A 3K57A 2VQFB 4CH4A 4LR3A 4QJFB 1K34A 1L0LH 1KKDA 1S5JA 5EZYA 1K3EA 4GX5A 1Y6XA 1GH6A 5LP6C 2QR4A 4DR3B 2QKAA 3A0HZ 3K5NA 3JAWB 1ZL8A 4LCUC 1VQ4V 5H6RA 2DJVA 3D36A 1GN4A 3RBZA 2Y69C 2VWKA 1KQSU 1KD1W 1R6NA 4UVBA 3CP1A 3T4DA 2HP8A 4XDKA 5JVDB 5LHIA 4I9QA 2Q7GA 4GKKB 2ZKOA 1EZJA 4DR4O 3CCMV 2A06H 1YXBA 4RQFA 5D5QA 3ZMZA 1V55B 4GLXA 4TWKA 1FFXA 3STZC 3VOUA 4GKJO 4B3SB 4U3JA 4LF4O 4WFHA 4NTXA 4X64B 2GDSA 3CMEV 2CTWA 5IDJA 3ASOB 3BPZA 3CCSV 2GTAA 3FAVB 4DR6B 1AP6A 1WA8A 2DYRC 1FAFA 1ORQC 3R65A 1XBLA 4DR2B 2F4VO 1Y4MA 2E3CA 5LXTB 3H1HH 3H1LH 4UB8Z 2WLHA 2A7WA 4X20B 3I5DA 1Q86W 4HYOA 3THOA 3IFXA 1BMFG 1J5EB 1MNGA 4HNAA 4P9OA 5ITZA 3ZHUA 2R9RB 1L8DA 4UB6Z 3AG3B 1HNWB 3QO7A 1V55C 2CUGA 4JI7B 4UCRA 3SPJA 3DC5A 4DW1A 3ASNB 1CXZB 2JDIG 2GTSA 3K3WA 5KLVH 2UU9O 2HFEC 3CC2V 1PNKA 3ASOC 5CBHA 4WFAV 3CXHF 1NVPB 1ZSPA 1VQLV 2RNBA 5IYBO 4DK0A 1DTOA 3H9VA 4EFEA 4FLYA 4O4LA 5JH7B 5IJ0B 4YHHB 4I0XB 1XMQO 2Q7HA 1PPJH 2HHHB 2Q68A 2IH1C 2LFRA 5LL6Y 3CCVV 2LQTA 4X1YA 4GZRB 5LYJB 4WBNA 4NTYA 1R3KC 1THZA 2QE7G 3AG3C 2HVJC 3K59A 3A8TA 3T4ZA 3ASNC 2ITCC 4MVMA 4DR3O 5L3CA 4TV8B 1VQNV 1SRYA 1GKFA 3RYHB 4J80A 4TV9A 2DYSC 2QM7A 1QCEA 4DYLA 2JJ2G 5JJJB 4J11A 4L87A 3K5LA 2X6AA 1RSOB 1R73A 4H37A 1VIBA 1F4NA 1KB9F 1GO3F 1XOUA 3JALB 2WA3A 2R9AA 3E8GA 2A0LA 3WB2A 1ENVA 5J9PC 1EM1A 5EBWC 1NTZH 1O9HA 1FXKB 2WLIB 1NTMH 4NVPA 3JD3A 3UM7A 2Z3YA 3ABUA 2Q7EA 4MVZA 1CEZA 1XDCA 2RCVA 4FLXA 4AQYB 2IJKA 1OCCC 4B3SO 3OR6C 2WLLA 4LNUB 4X64O 4IYIA 1IXBA 3C3SA 3DSQA 4RAIA 2YEVB 2XTAA 4PDRA 4DR6O 1MZFA 3T1HB 4UCSA 1M9NA 3ABLC 2GSMB 3AG2B 2WSSG 1W59A 3APOA 3PN1A 4DR2O 1NR1A 5CA1B 3CCRV 5LOVA 3ZRVA 3KG2A 4RUEA 5BR8B 4JYAB 1Y74B 5EIBD 4ZHQA 1AP5A 2QA4V 2FKXA 2Y0PA 4I4TA 4J42A 1FXHA 3RVZA 4FLWA 1IVSA 2PI5A 2DQ0A 1DF5A 2BCCH 1K9MW 2OIEA 2XAGA 2ZT9B 1LUVA 1SKVA 1J5EO 5HFLA 1Y66A 1ZTEA 2OCCB 3UQ8A 1VF6A 1HNWO 2QKSA 4YIOA 2ZNIA 4NR1A 1XI1A 1WB8A 3L9DA 1SQFA 1SQBH 4JAUA 3IC9A 1S5LZ 2LW1A 2L35A 2P4KA 2P6JA 4YJ3A 1SF9A 3BAAA 1HWYA 3K08A 3QF7A 1K5QA 1AR4A 3WB1A 3RYCA 5GTHZ 4I50B 2JGUA 3B8NA 4F4LA 1AROP 3R66A 4YHHO 4YJ2A 3AG2C 3OEHG 4LFAB 4BIZA 2Q5ZA 3OW2U 1GM9A 5C8YB 3TGUH 2NR5A 4O2BA 1LR1A 4CH6A 2HHHO 1QVGU 1PL4A 4J7ZA 5BZBA 3GWOA 3CSXA 3ZCCA 3HKDB 3ICXA 1YITV 1F51A 1NI8A 2Y4UA 2OCCC 2AZ2A 1NH2B 3ZBHA 4LP8A 2IU0A 4QE9A 2OIGA 1OCRB 3OTOB 3RWRD 2NLJC 3ZRWB 4O4JA 4FMTA 3LSSA 4W4KA 4LH7A 4DXWA 1KUQA 1CP9A 1TUEB 3RN4A 4JYBA 3GVMA 3JD0A 1FD9A 4MTFA 4X1KA 1B3QA 1U96A 5GTIZ 1P7BA 2JGDB 3OT7A 3B4SA 1YF2A 3MHSC 1R1BA 1UPGA 2CTPA 1HR0B 2OWOA 3O65A 4WCEV 3CS5A 4XDLA 3CRMA 4P2ZA 4K3AA 4LF8O 1TAEA 3P3PA 2JEXA 1IXMA 3L71H 4TQFA 4QIWF 2AHZA 1OCRC 4AQYO 3OGCC 2UXXA 4PDMA 3N2GA 3QNEA 3RT3C 2XUMA 1N32B 3LSQA 2P22C 1IURA 4CZZA 2BSKB 3OFNG 2ADPA 1EZVH 5LA6A 2RJZA 4JYCA 2ITDC 1BE3H 3BRCA 3T1HO 2ETNA 3SR2C 3WG7B 2GV9A 4JF3A 1XHZA 1IBLB 4FFBB 4WFFA 3L72H 4DRXB 1MOFA 5KUKA 1YCIA 4X8AA 4OXSA 1MMMA 4KUMA 2WA4A 4CH5A 3KZIZ 5B1AB 5BR8O 2JS3A 4JYAO 4MSWC 2XAHA 3T2MA 4AHCA 1B6QA 3JASB 3HKEA 4FFKA 1SERA 1YEWA 3NXSA 2D3OW 1VMGA 4LH6A 3LUTB 1N36B 5JCOA 4UCTA 1CPYA 1Q6HA 5EC1C 1MSDA 4GCZA 1MABG 2E5LB 1SZTA 1AI5A 3CJHA 5IJ9B 1U97A 3K0DA 3JSNA
chains in the Genus database with same CATH topology
2JS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JS3 A; 
#chains in the Genus database with same CATH topology
 4UCO A;  3CRQ A;  4FM1 A;  4JI0 B;  3STL C;  4HBN A;  3RYF B;  1NKD A;  3SJB C;  4UUJ C;  5L3D A;  4X65 B;  3RYI B;  1VQ5 V;  3WG7 C;  3AG7 A;  4LFA O;  1E79 G;  3BCC H;  1HDJ A;  3ZMT A;  1ZUQ A;  4FJC C;  2BTO A;  4DR7 B;  4JI2 B;  2C2A A;  4O2A A;  3SPH A;  1JA8 A;  1JJO A;  2ZCE A;  4IHJ B;  4BW5 A;  3K9A A;  1D2D A;  1AR5 A;  5K1X A;  3ABK B;  5CBG A;  5CA0 A;  5KX5 B;  4OPA A;  4BR6 A;  3AK2 A;  2UUC B;  3OTO O;  4CS4 A;  4AI8 A;  1NR7 A;  2IJH A;  5H9C A;  3UO2 A;  4EEQ A;  5IYZ A;  4PDV A;  2HG5 C;  3C90 A;  2B1G A;  1V54 C;  4HAM A;  3D8C A;  4UFZ A;  2HEP A;  1MSW D;  1AI6 A;  3JAT B;  3IAY A;  4DR5 B;  5EZY B;  2DWD C;  4CS3 A;  3EHB B;  1F23 A;  3RVY A;  4BAY A;  1HR0 O;  3OMI B;  3E8F A;  4I5S A;  4FM2 A;  3OTF A;  4BIU A;  5B1N A;  5H6Q A;  3OM3 B;  2PGG A;  1Q3E A;  1XRE A;  3UKM A;  2H94 A;  3EXA A;  3ETD A;  1NU1 H;  5EBM C;  4DW0 A;  1AVM A;  3AG4 B;  2EJ7 A;  1QHT A;  3ABT A;  3T1C A;  5IYC O;  1N32 O;  2OTJ V;  3QTC A;  3QO5 A;  1VQ9 V;  1JR9 A;  5CB4 A;  4O4I B;  3LDC A;  1WNS A;  1YSC A;  3K03 A;  3WB0 A;  2QWP B;  1R3L C;  4I55 B;  1BHA A;  1E1R G;  4H33 A;  3H1I H;  4JAV A;  3J7A U;  1AR1 B;  2W0F C;  1FFX B;  3ZMV A;  1IBL O;  4KXR A;  4MTO A;  4U3J B;  4DV4 B;  4LFB B;  3UCS C;  4EFB A;  1L1F A;  2CTQ A;  2X7R B;  3Q4H A;  1N36 O;  1WA8 B;  4UCU A;  1VAR A;  3AG4 C;  3ZHT A;  2XHB A;  3ZRS A;  3HKC A;  2H3O A;  1AI4 A;  4K0K B;  3N2K B;  2E5L O;  4MT8 A;  3GWK C;  3SPC A;  3P30 A;  1JJ2 U;  2EIJ C;  2ZR2 A;  1KBH A;  4X66 B;  1NBM G;  1S77 D;  4IL6 Z;  2IU3 A;  4JI0 O;  4QNH B;  3SPI A;  3A2F A;  4X65 O;  2HJF C;  4HNA B;  5ITZ B;  5KUM A;  2Z0A A;  3JAM N;  4DUZ B;  2Q6A A;  5DN6 G;  1TA8 A;  1Z5W A;  4L8J A;  3HKB A;  3EFF K;  2YUA A;  2YDE A;  4DR7 O;  1Y76 A;  4JI2 O;  4MTG A;  5KMG A;  1Q6U A;  3VQW A;  1N33 B;  4QPK A;  3ZRX A;  4O4L B;  1B04 A;  4X1I A;  1WB7 A;  5FNV B;  1Q7Y W;  3BA8 A;  2UUC O;  3CC7 V;  2KB1 A;  3J80 N;  2DW4 A;  3JAK A;  4X1Y B;  1VQO V;  3E89 A;  4X9Q A;  4LF9 B;  2N05 A;  3X2Q B;  2GUZ A;  2ZE6 A;  3CCJ V;  2AZ0 A;  4JYY A;  4DR5 O;  2QJ1 A;  2RDC A;  1HP8 A;  2QM4 A;  2IBZ H;  2HLD G;  4Q6G A;  1H2L A;  5L3E A;  3G4S V;  1VQ6 V;  3FFQ A;  2DOS A;  5CBF A;  3JAR A;  1NS1 A;  4RUF A;  1FS0 G;  3U11 A;  1SQP H;  4Q20 A;  3E86 A;  2ZIN A;  5FL7 G;  2Q9L A;  3LSU A;  2YS8 A;  5EYP B;  5CMU A;  2R70 A;  5JVD A;  3G67 A;  2MK3 A;  4HZ3 A;  3ETG A;  2A9H A;  2P5O A;  2E75 B;  3TXS A;  3RGB A;  4GT1 A;  4FZ0 A;  1N8R W;  5B1O A;  3A0B Z;  5IYD O;  1XIL A;  1DGS A;  4ASU G;  4BWA A;  3PJS K;  4J10 A;  5L3F A;  2R9I A;  4XBF A;  1M93 A;  5B1B B;  1XL6 A;  4RO2 A;  4JGS A;  4ZI7 A;  4RQE A;  4DV4 O;  2V7Q G;  2WLL B;  4LFB O;  3ZMS A;  1TUB A;  3ZHQ A;  3S3W A;  4TT3 G;  3P32 A;  2QTO A;  3JYC A;  4PA6 A;  4N23 A;  4EKW A;  3KCY A;  1QLE B;  2PYL A;  4U7N A;  1PNL A;  3FB5 C;  3TET A;  1SA0 A;  5H5N A;  5LOV B;  4K0K O;  3FB8 C;  4FLV A;  1KP3 A;  5KA6 A;  2P06 A;  1KYO F;  4X66 O;  4ZHQ B;  5GON A;  5FPO A;  1X59 A;  2B5U A;  1EN5 A;  1XL4 A;  1GTO A;  1YTF B;  2MW2 B;  2PF4 E;  4DUZ O;  4LF8 B;  3WU2 Z;  3AK3 A;  3OAA G;  4ZBM A;  3CCE V;  4R8C A;  2QWO B;  3K0G A;  1I94 B;  1SQV H;  2Z5U A;  4I0X A;  4YJ3 B;  2VWJ A;  3EVK A;  4LC1 A;  1BT8 A;  2QSA A;  1NJI W;  2CK3 G;  1N33 O;  4F6R A;  1BHB A;  3OR7 C;  1QLE C;  3BY6 A;  4YJ2 B;  4IYH A;  2QDO A;  5KHK A;  4KL1 A;  5JQG B;  1JPX A;  5LYJ A;  1FKA O;  2UUA B;  1RM1 B;  2ZE8 A;  3IJ4 A;  1VQK V;  3FX7 A;  4PD4 F;  1XMO B;  3UT5 A;  2OYQ A;  4LF9 O;  2EZP A;  1FXK C;  1KKC A;  1M57 B;  5F2V O;  3RYH A;  1HNX B;  4JV5 B;  4W4L A;  5EK0 A;  5E79 Z;  3F5W C;  1Q43 A;  1H8H G;  4O4J B;  2RMK B;  3E22 A;  1H2M A;  3F7Y C;  3JD4 A;  1GRJ A;  1B06 A;  4G27 B;  1K33 A;  4JI5 B;  4X1K B;  4CC5 A;  2ILM A;  1JFF A;  1XNR O;  3JAL A;  4A5U B;  2IW5 A;  3B09 A;  3ETQ A;  3W7T A;  3ETE A;  3GB7 C;  1VQP V;  5E1A C;  1JVM A;  2W6I G;  1YI2 V;  4DV7 B;  2P90 A;  2PY5 A;  4LWS B;  4TUY A;  1GN3 A;  3CXC U;  3CRR A;  1QQC A;  2WAM A;  4OX9 B;  2XAF A;  1M57 C;  5LGN A;  3CWB H;  1K92 A;  3I55 V;  1NTK H;  5J2U A;  3JD2 A;  4DV1 B;  4JI4 B;  1M4U A;  1SQG A;  3JSL A;  2QWR B;  5LA6 B;  1BQ0 A;  1GM8 A;  1BL8 A;  3CPW U;  1Z5V A;  2QWN B;  5IY5 B;  3OEE G;  4J41 A;  1R3I C;  1OCO B;  4CS2 A;  4BW9 A;  5C93 A;  1G8M A;  1Q82 W;  4GYC B;  1VQ7 V;  4J9Z B;  1VEW A;  5KAI Z;  2BTQ A;  1WP8 A;  1K4C C;  1GM7 A;  4PDL A;  2DMX A;  3CYO A;  3HKE B;  2QWQ B;  2ZDI C;  1W2B U;  1PKX A;  3OMA B;  3BA9 A;  1GK9 A;  5D5P A;  3SYQ A;  1GN2 A;  4DK1 A;  4N21 A;  1HNZ B;  3UO3 A;  4LF6 B;  4QPJ A;  3IC7 A;  4JAA A;  2LJ2 A;  2DE0 X;  4K8X A;  5L3G A;  3CJH B;  4I50 A;  4PA9 A;  2QEX V;  2ADQ B;  2F66 C;  4ZKI A;  1I94 O;  5FLX N;  2IM9 A;  3AG1 B;  3B40 A;  1MZE A;  3OGI B;  1VF7 A;  2KG7 A;  4PA7 A;  2ODM A;  1AJN A;  1WAZ A;  4JI1 B;  1JX9 A;  5IY5 C;  3S3X A;  3U0Z A;  3HKD A;  3H1J H;  1OCO C;  3P3N A;  1KC8 W;  3SJC C;  1N0N A;  1X4T A;  2UUA O;  1KP2 A;  3ZX6 A;  4O2A B;  1FXV A;  2CAZ C;  1M1K W;  4DV3 B;  1TVK A;  5KAF Z;  1IX9 A;  1XMO O;  5J2T B;  1R3J C;  3CHX A;  3CX5 F;  3CEI A;  4FK5 C;  3ZRW A;  4MVR A;  2Y48 A;  1FPO A;  2YIA A;  5BMV B;  1PM9 A;  1JOY A;  2UXD B;  1PNM A;  4I7Z B;  2JS5 A;  3FYE B;  1IDS A;  1Q6I A;  4ABM A;  4Z1M G;  1HNX O;  4JV5 O;  4DUY B;  1ZAU A;  3H1K H;  2OT5 A;  5CN0 A;  5IYZ B;  3ZED A;  4DV5 B;  5DED A;  4FLZ A;  3LNM B;  1JMK C;  2IH3 C;  3F5T A;  1SQQ H;  3OUS A;  4JI5 O;  4Z1V A;  4TOI A;  4R6Z A;  4P9P A;  4CH3 A;  1US6 A;  2BOB C;  2ZQM A;  1M90 W;  1FJG B;  1OV9 A;  2JRI A;  1P84 F;  4WF9 V;  4KHP B;  3SYO A;  4FPP A;  3AEI A;  2N74 A;  3MHH C;  2HR3 A;  3TXQ A;  4DV7 O;  2B1I A;  3B2E E;  1W0J G;  4F6E A;  1ZX3 A;  2K9P A;  1RFY A;  2XAQ A;  5B1A C;  3QVN A;  2YI8 A;  4OX9 O;  2AW9 A;  2ZM6 B;  1WP7 A;  1BGY H;  1YIJ V;  2ZR3 A;  1OCZ B;  2JVD A;  3SYA A;  2WLJ A;  1AI7 A;  4LFC B;  5K1P A;  1NVP D;  4DV1 O;  5BY1 A;  4JI4 O;  4NTW A;  3CB2 A;  1K8A W;  2P7T C;  4JI8 B;  2CH7 B;  1S76 D;  1MG1 A;  5IWA B;  2F1M A;  2UXN A;  4C7U A;  3K06 A;  1UFI A;  4DR1 B;  2K1E A;  4O4H A;  2LO1 A;  2Q8V A;  3JAS A;  1IBM B;  2ZE5 A;  3MD0 A;  5KHG A;  3MDS A;  2UXB B;  3J81 N;  2O57 A;  2BE3 A;  3JCU Z;  2H8P C;  3KKY A;  1NT2 B;  4B7K A;  3OD4 A;  1I7F A;  4AIL C;  3Q4H B;  4X62 B;  5IJ9 A;  3LDE A;  1TGO A;  1DK1 A;  4IIJ A;  1ZL8 B;  2XT9 A;  2WPD G;  3D3Q A;  3L75 H;  1OCZ C;  3OMN B;  3ABK C;  4LF5 B;  1HNZ O;  3HKC B;  5KHH A;  4LF6 O;  2EZO A;  1K4D C;  4FIP C;  1H2G A;  1LUW A;  1EFR G;  1M5I A;  1A32 A;  2R72 A;  3F7V C;  4B7E A;  2YC0 A;  2CTR A;  5EIB C;  3E83 A;  2PI4 A;  2Q0O C;  3SYP A;  1RP3 B;  5KHI A;  1PP9 H;  4JI1 O;  1BSM A;  2Q67 A;  4GX0 A;  1GMG A;  1AJQ A;  4QE7 A;  3HKB B;  4MVU A;  3ABM B;  2IJI A;  2E76 B;  4UXN A;  1KMI Z;  1Y76 B;  3M8A A;  3QO8 A;  4JTD B;  4YXW G;  4JPR A;  4DV3 O;  5KMG B;  2HJD A;  2WLM A;  1QR8 A;  2RN9 A;  4TQD A;  1S3J A;  2UXD O;  3HB3 B;  3G6B A;  4OPH A;  4X1I B;  3BHP A;  2X0L A;  2CGO A;  4WFG A;  2PZS A;  1DF4 A;  3K5M A;  4NXM B;  3DXR A;  1YZB A;  4DUY O;  3D36 C;  3JAT A;  2F93 B;  3VQX A;  3JAK B;  2N04 A;  4DV5 O;  2M7W A;  2P4V A;  3I56 V;  1F7Y A;  3SDL A;  2WLN A;  1Q90 D;  3T1Y O;  2GUZ B;  2VS0 A;  1T5E A;  2Q73 A;  4H44 B;  2EJR A;  1FJG O;  2A79 B;  5LP6 A;  3ABM C;  4KHP O;  1K97 A;  4FVM A;  4WFB V;  1EBO A;  1G6U A;  3LDD A;  2DYR B;  4UVC A;  1PV0 A;  3JAR B;  4ZIB A;  2XOK G;  4PI0 A;  2LFS A;  4PEL A;  1FFT B;  1Y67 A;  2CGN A;  2DN9 A;  1K73 W;  1H38 A;  4PHZ A;  2G38 A;  1AJP A;  4U3F H;  5DEC A;  2ZM6 O;  1N34 B;  4O4I A;  2QTS A;  4EB6 A;  1GN6 A;  5AG2 A;  4LFC O;  4G28 B;  1N4C A;  2JK5 C;  3FKS G;  4I55 A;  4ZOL A;  2YXH A;  3G6E V;  4E2L A;  1VQM V;  4PI2 A;  4JI8 O;  5IWA O;  4YIP A;  1OZ0 A;  4DR1 O;  3CD6 V;  4WBN B;  1IBM O;  1SES A;  5DM6 V;  2FB5 A;  2UXB O;  4NB5 A;  5LHH A;  1I5Y A;  1VF5 B;  4ZI7 B;  3JAW A;  2EBO A;  2F95 B;  3BAB A;  1TUB B;  1NH2 D;  1WN7 A;  2FL4 A;  2PYJ A;  1ZWI C;  3N2K A;  4X62 O;  4TV9 B;  1SS3 A;  4LF5 O;  3L73 H;  4MVO A;  1XNR B;  3M99 B;  1SA0 B;  1UJW B;  1PD3 A;  3U10 A;  1DLB A;  3N27 A;  2E74 B;  2AHY A;  5GON B;  1QLN A;  3IGA C;  1XNQ B;  3B8M A;  4BIO A;  4X89 A;  3ZHS A;  3O9O A;  4B3R B;  3K9S A;  3ZMU A;  1WPB A;  5JWP A;  5H2F Z;  2IJJ A;  2LW7 A;  3X2Q C;  1E1Q G;  3BFR A;  2DYS B;  4KFM A;  1WPX A;  4K35 A;  1H2N A;  5LGT A;  3DTU B;  3FAV A;  1OJH A;  1XHX A;  1W0K G;  5FNV A;  4PV1 B;  4F6R B;  1MA1 A;  4DO2 A;  3CRC A;  2ZIO A;  3G71 V;  3D3I A;  3AK1 A;  3OUF A;  5LXT A;  1ZLZ A;  4X20 A;  1G4Y B;  4NXM O;  2VQF O;  2RQ6 A;  3ZJZ A;  2L6L A;  3UT5 B;  3CMA V;  2GHY A;  1OCC B;  1GAX A;  3SJQ C;  5GW7 A;  4I4T B;  1BCC H;  2ZD9 A;  4D7S A;  4D7T A;  1QVF U;  4J7K A;  1I5X A;  2LP7 A;  4JI3 B;  1SZX A;  5A9G A;  2Q69 A;  3VQV A;  1K7D A;  1IZ3 A;  1S5H C;  3DGE A;  3ZN1 A;  1QNM A;  1D5A A;  3E22 B;  4B08 A;  4J7J A;  2V4D A;  5B1B C;  1AB3 A;  5EYP A;  3NR7 A;  3ABL B;  5LMN B;  2YSU B;  2YIB D;  1BS3 A;  4FLT A;  1JFF B;  5IJ0 A;  5JH7 A;  1R6K A;  4UV9 A;  1G1X B;  3W7S A;  1NZ6 A;  3RYC B;  5B66 Z;  1N34 O;  3JD1 A;  3CE2 A;  1XEQ A;  4GKK O;  2JEU A;  3RFR A;  4TUY B;  4O2B B;  2ZIM A;  4MTX A;  3K5O A;  5LMU B;  3VQY A;  2GBO A;  4NXN B;  1XUQ A;  5BXZ A;  4LF7 B;  1M56 B;  5J2U B;  4MW8 A;  4MS2 A;  1I0H A;  1VF6 C;  5JJE B;  4TV8 A;  2M6Y A;  4G2K A;  1L0N H;  1SC5 B;  2UUB B;  1AIL A;  1QR9 A;  1XQ8 A;  4E4E A;  4MVQ A;  3KCX A;  2XAS A;  1RSO A;  4ICG A;  4NKG B;  2YIC A;  4R7C A;  3VBB A;  4DV0 B;  2FML A;  2YXL A;  2BTQ B;  2ATK C;  1FXK A;  4B3M B;  2WLI A;  2B9Z A;  4YY3 B;  3ZHV A;  2WWW A;  4JI7 O;  2A3Q A;  1XNQ O;  1RM1 C;  2VQE B;  1V9P A;  4IGG A;  3L74 H;  2Y4T A;  4JZG A;  4B3R O;  2FTK A;  2YXY A;  1WJZ A;  5KA5 A;  2DWE C;  1M56 C;  3CCU V;  4JZ2 A;  3RW0 A;  3H01 A;  1VQ8 V;  2FYU H;  4LNU A;  2HKO A;  3TJT A;  3N2G B;  2XND G;  2YEV A;  4UCV A;  1COW G;  5JQG A;  3LNN A;  1JQ0 A;  1JCH A;  2KKW A;  2KG7 B;  2X6C A;  1BQZ A;  1H2S B;  5CA1 A;  5A2Q N;  4B3T B;  2UXC B;  5IT9 N;  1I08 A;  4PA3 A;  3CRA A;  1Y74 A;  4QGP A;  5JJN B;  3W7W A;  1YVW A;  1TVK B;  4LBE C;  4I9W A;  4JAS A;  2CDY A;  4FLU A;  3ZIA G;  3MAQ A;  4J9Y B;  3BEH A;  1IBK B;  5B3S B;  4PA4 A;  3W7X A;  4D6T H;  2EIL B;  3K58 A;  1K5S A;  4JI3 O;  3M7M X;  4PJ0 Z;  1EN6 A;  1ROP A;  3K04 A;  1WLE A;  2DQ3 A;  2ZXW B;  5LMN O;  4CBC A;  3FD9 A;  5B5E Z;  1FYJ A;  3SYC A;  1P7G A;  3HR0 A;  3ZS8 C;  2EX3 A;  2QKC A;  5C8Y A;  2V1D A;  2X6B A;  5LBQ A;  2PUS A;  4FZ1 A;  4LWS A;  5KHJ A;  4WFE A;  3CCL V;  3E8H A;  2ZDI A;  4DV6 B;  2D2C B;  2EUL A;  1S72 V;  3K79 A;  3SJA C;  3TCU A;  4GUN A;  4DV2 B;  5LMU O;  5EBL C;  4NXN O;  2ZE7 A;  4JI6 B;  2W6J G;  5B3S C;  4JTA B;  1YJW V;  2EIN B;  1D5N A;  2ZNJ A;  2EIL C;  4LF7 O;  2VRZ A;  5CA0 B;  2OTL V;  5JCO C;  4GX2 A;  2EIK B;  2EIM B;  2OCH A;  1QBZ A;  2LGQ A;  2UUB O;  3A0R A;  2ZXW C;  5EC2 C;  2JGD A;  3APQ A;  3HPL C;  4UVA A;  1Q5O A;  5LHG A;  3CCQ V;  3AG1 C;  3WFV A;  5IE9 A;  2YID A;  3JCZ A;  4O4H B;  3T1Y B;  1H8E G;  2AGA A;  1J95 A;  1SET A;  1P4R A;  2LGW A;  4DV0 O;  4KP4 A;  4FM0 A;  4B3M O;  4YY3 O;  3TK1 A;  2VQE O;  1O9G A;  3OE7 G;  2Y0I A;  2P67 A;  1YJN V;  4TSF G;  2QM8 A;  4H13 B;  1OHH G;  4IIJ B;  2EIN C;  1P49 A;  4IT5 A;  3E2E A;  3B77 A;  3QG5 A;  1V54 B;  4XDJ A;  4MVS A;  2EIK C;  4NYK A;  5FPR A;  1H2K A;  2F23 A;  2BSK A;  2EIM C;  1YHQ V;  3SPG A;  4Z2W A;  1URF A;  2JIZ G;  5HFM A;  5CA3 A;  1Z2G A;  4DR4 B;  3BVO A;  1LNQ A;  5TIS Z;  2F43 G;  2NN4 A;  5CB4 B;  3E8B A;  3L70 H;  1F4M A;  4FFB A;  4B3T O;  4K8Z A;  1PL0 A;  4GKJ B;  4DRX A;  2UXC O;  4LF4 B;  5J2T A;  2PTM A;  4MW3 A;  2QGN A;  1SQX H;  2BOC C;  1S0V A;  5BMV A;  1BZK A;  4P30 A;  4RWU A;  4H0L B;  2KQX A;  2JJ1 G;  1Q8I A;  2YIB A;  2F4V B;  2ARH A;  3SGI A;  3W7U A;  1IBK O;  5LGU A;  3E35 A;  4JTC B;  1Q81 W;  3C3T A;  3FYI B;  1HW7 A;  3DXR B;  1RPR A;  4UV8 A;  3RYF A;  3DC6 A;  3ML0 A;  4R50 A;  4CC6 A;  4U7O A;  3FB7 C;  3RYI A;  5L3B A;  2NNU A;  1KU9 A;  1R6T A;  1RPO A;  1YJ9 V;  1EN4 A;  3ZN0 A;  5LP6 B;  1KEC A;  2WLK A;  2UU9 B;  3G80 A;  4X88 A;  1NQT A;  2HVK C;  4IHJ A;  4DV6 O;  2CE4 A;  2Q0A A;  1YTF D;  2AXT Z;  4OGQ B;  3ZHR A;  1VP7 A;  1QU7 A;  1YDX A;  5KX5 A;  4DV2 O;  3CC4 V;  2EIJ B;  2YI9 A;  2W0X A;  1XMQ B;  4JI6 O;  2KSD A;  2CH7 A;  4EB6 B;  2Y69 B;  2XAJ A;  1N0J A;  2Q4P A;  3FB6 C;  4ZOL B;  4GX1 A;  3K57 A;  2VQF B;  4CH4 A;  4LR3 A;  4QJF B;  1K34 A;  1L0L H;  1KKD A;  1S5J A;  5EZY A;  1K3E A;  4GX5 A;  1Y6X A;  1GH6 A;  5LP6 C;  2QR4 A;  4DR3 B;  2QKA A;  3A0H Z;  3K5N A;  3JAW B;  1ZL8 A;  4LCU C;  1VQ4 V;  5H6R A;  2DJV A;  3D36 A;  1GN4 A;  3RBZ A;  2Y69 C;  2VWK A;  1KQS U;  1KD1 W;  1R6N A;  4UVB A;  3CP1 A;  3T4D A;  2HP8 A;  4XDK A;  5JVD B;  5LHI A;  4I9Q A;  2Q7G A;  4GKK B;  2ZKO A;  1EZJ A;  4DR4 O;  3CCM V;  2A06 H;  1YXB A;  4RQF A;  5D5Q A;  3ZMZ A;  1V55 B;  4GLX A;  4TWK A;  1FFX A;  3STZ C;  3VOU A;  4GKJ O;  4B3S B;  4U3J A;  4LF4 O;  4WFH A;  4NTX A;  4X64 B;  2GDS A;  3CME V;  2CTW A;  5IDJ A;  3ASO B;  3BPZ A;  3CCS V;  2GTA A;  3FAV B;  4DR6 B;  1AP6 A;  1WA8 A;  2DYR C;  1FAF A;  1ORQ C;  3R65 A;  1XBL A;  4DR2 B;  2F4V O;  1Y4M A;  2E3C A;  5LXT B;  3H1H H;  3H1L H;  4UB8 Z;  2WLH A;  2A7W A;  4X20 B;  3I5D A;  1Q86 W;  4HYO A;  3THO A;  3IFX A;  1BMF G;  1J5E B;  1MNG A;  4HNA A;  4P9O A;  5ITZ A;  3ZHU A;  2R9R B;  1L8D A;  4UB6 Z;  3AG3 B;  1HNW B;  3QO7 A;  1V55 C;  2CUG A;  4JI7 B;  4UCR A;  3SPJ A;  3DC5 A;  4DW1 A;  3ASN B;  1CXZ B;  2JDI G;  2GTS A;  3K3W A;  5KLV H;  2UU9 O;  2HFE C;  3CC2 V;  1PNK A;  3ASO C;  5CBH A;  4WFA V;  3CXH F;  1NVP B;  1ZSP A;  1VQL V;  2RNB A;  5IYB O;  4DK0 A;  1DTO A;  3H9V A;  4EFE A;  4FLY A;  4O4L A;  5JH7 B;  5IJ0 B;  4YHH B;  4I0X B;  1XMQ O;  2Q7H A;  1PPJ H;  2HHH B;  2Q68 A;  2IH1 C;  2LFR A;  5LL6 Y;  3CCV V;  2LQT A;  4X1Y A;  4GZR B;  5LYJ B;  4WBN A;  4NTY A;  1R3K C;  1THZ A;  2QE7 G;  3AG3 C;  2HVJ C;  3K59 A;  3A8T A;  3T4Z A;  3ASN C;  2ITC C;  4MVM A;  4DR3 O;  5L3C A;  4TV8 B;  1VQN V;  1SRY A;  1GKF A;  3RYH B;  4J80 A;  4TV9 A;  2DYS C;  2QM7 A;  1QCE A;  4DYL A;  2JJ2 G;  5JJJ B;  4J11 A;  4L87 A;  3K5L A;  2X6A A;  1RSO B;  1R73 A;  4H37 A;  1VIB A;  1F4N A;  1KB9 F;  1GO3 F;  1XOU A;  3JAL B;  2WA3 A;  2R9A A;  3E8G A;  2A0L A;  3WB2 A;  1ENV A;  5J9P C;  1EM1 A;  5EBW C;  1NTZ H;  1O9H A;  1FXK B;  2WLI B;  1NTM H;  4NVP A;  3JD3 A;  3UM7 A;  2Z3Y A;  3ABU A;  2Q7E A;  4MVZ A;  1CEZ A;  1XDC A;  2RCV A;  4FLX A;  4AQY B;  2IJK A;  1OCC C;  4B3S O;  3OR6 C;  2WLL A;  4LNU B;  4X64 O;  4IYI A;  1IXB A;  3C3S A;  3DSQ A;  4RAI A;  2YEV B;  2XTA A;  4PDR A;  4DR6 O;  1MZF A;  3T1H B;  4UCS A;  1M9N A;  3ABL C;  2GSM B;  3AG2 B;  2WSS G;  1W59 A;  3APO A;  3PN1 A;  4DR2 O;  1NR1 A;  5CA1 B;  3CCR V;  5LOV A;  3ZRV A;  3KG2 A;  4RUE A;  5BR8 B;  4JYA B;  1Y74 B;  5EIB D;  4ZHQ A;  1AP5 A;  2QA4 V;  2FKX A;  2Y0P A;  4I4T A;  4J42 A;  1FXH A;  3RVZ A;  4FLW A;  1IVS A;  2PI5 A;  2DQ0 A;  1DF5 A;  2BCC H;  1K9M W;  2OIE A;  2XAG A;  2ZT9 B;  1LUV A;  1SKV A;  1J5E O;  5HFL A;  1Y66 A;  1ZTE A;  2OCC B;  3UQ8 A;  1VF6 A;  1HNW O;  2QKS A;  4YIO A;  2ZNI A;  4NR1 A;  1XI1 A;  1WB8 A;  3L9D A;  1SQF A;  1SQB H;  4JAU A;  3IC9 A;  1S5L Z;  2LW1 A;  2L35 A;  2P4K A;  2P6J A;  4YJ3 A;  1SF9 A;  3BAA A;  1HWY A;  3K08 A;  3QF7 A;  1K5Q A;  1AR4 A;  3WB1 A;  3RYC A;  5GTH Z;  4I50 B;  2JGU A;  3B8N A;  4F4L A;  1ARO P;  3R66 A;  4YHH O;  4YJ2 A;  3AG2 C;  3OEH G;  4LFA B;  4BIZ A;  2Q5Z A;  3OW2 U;  1GM9 A;  5C8Y B;  3TGU H;  2NR5 A;  4O2B A;  1LR1 A;  4CH6 A;  2HHH O;  1QVG U;  1PL4 A;  4J7Z A;  5BZB A;  3GWO A;  3CSX A;  3ZCC A;  3HKD B;  3ICX A;  1YIT V;  1F51 A;  1NI8 A;  2Y4U A;  2OCC C;  2AZ2 A;  1NH2 B;  3ZBH A;  4LP8 A;  2IU0 A;  4QE9 A;  2OIG A;  1OCR B;  3OTO B;  3RWR D;  2NLJ C;  3ZRW B;  4O4J A;  4FMT A;  3LSS A;  4W4K A;  4LH7 A;  4DXW A;  1KUQ A;  1CP9 A;  1TUE B;  3RN4 A;  4JYB A;  3GVM A;  3JD0 A;  1FD9 A;  4MTF A;  4X1K A;  1B3Q A;  1U96 A;  5GTI Z;  1P7B A;  2JGD B;  3OT7 A;  3B4S A;  1YF2 A;  3MHS C;  1R1B A;  1UPG A;  2CTP A;  1HR0 B;  2OWO A;  3O65 A;  4WCE V;  3CS5 A;  4XDL A;  3CRM A;  4P2Z A;  4K3A A;  4LF8 O;  1TAE A;  3P3P A;  2JEX A;  1IXM A;  3L71 H;  4TQF A;  4QIW F;  2AHZ A;  1OCR C;  4AQY O;  3OGC C;  2UXX A;  4PDM A;  3N2G A;  3QNE A;  3RT3 C;  2XUM A;  1N32 B;  3LSQ A;  2P22 C;  1IUR A;  4CZZ A;  2BSK B;  3OFN G;  2ADP A;  1EZV H;  5LA6 A;  2RJZ A;  4JYC A;  2ITD C;  1BE3 H;  3BRC A;  3T1H O;  2ETN A;  3SR2 C;  3WG7 B;  2GV9 A;  4JF3 A;  1XHZ A;  1IBL B;  4FFB B;  4WFF A;  3L72 H;  4DRX B;  1MOF A;  5KUK A;  1YCI A;  4X8A A;  4OXS A;  1MMM A;  4KUM A;  2WA4 A;  4CH5 A;  3KZI Z;  5B1A B;  5BR8 O;  2JS3 A;  4JYA O;  4MSW C;  2XAH A;  3T2M A;  4AHC A;  1B6Q A;  3JAS B;  3HKE A;  4FFK A;  1SER A;  1YEW A;  3NXS A;  2D3O W;  1VMG A;  4LH6 A;  3LUT B;  1N36 B;  5JCO A;  4UCT A;  1CPY A;  1Q6H A;  5EC1 C;  1MSD A;  4GCZ A;  1MAB G;  2E5L B;  1SZT A;  1AI5 A;  3CJH A;  5IJ9 B;  1U97 A;  3K0D A;  3JSN A; 
#chains in the Genus database with same CATH homology
 2JS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...