2JS3A

Nmr structure of protein q6n9a4_rhopa. northeast structural genomics consortium target rpt8
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
96
structure length
96
Chain Sequence
MGSSHHHHHHSSGRENLYFQGMTDTAAEDVRKIATALLKTAIEIVSEEDGGAHNQCKLCGASVPWLQTGDEIKHADDCPVVIAKQILSSRPKLHAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title NMR structure of protein Q6N9A4_RHOPA.
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
total genus 14
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11519 DUF3222 Protein of unknown function (DUF3222)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.780 Mainly Alpha Orthogonal Bundle Helix Hairpins ITPase-like domains 2js3A01
2JS3A
chains in the Genus database with same CATH superfamily
4RUEA 2RQ6A 4HZ3A 4UB8Z 1NH2B 1YCIA 4G28B 1BE3H 5EIBC 2QWPB 4GX5A 4FLUA 4JTCB 2PYJA 3ZHUA 1XI1A 1NTKH 1OCOC 4FVMA 3L70H 2JEXA 4LF7B 1Z5WA 1XOUA 3F7YC 5LOVA 3QG5A 1PL0A 5FPRA 3RYIA 5IY5C 1XL4A 3L72H 3OEHG 5H2FZ 3SJBC 1J5EB 4E4EA 5KHJA 1YSCA 4WBNB 1H2NA 5EYPB 1OCZB 2Z0AA 2AGAA 1Y4MA 2B9ZA 3SYOA 5LXTB 3BPZA 4X66O 3LNNA 5EIBD 4WF9V 3U10A 3A0RA 3R66A 1S5HC 2E5LO 2ETNA 4I50B 3DXRA 3BA8A 2YIAA 5BR8O 3CJHA 4ABMA 5JQGB 2CTWA 4UCRA 4P9PA 3F7VC 1XUQA 1H2LA 2R9RB 4J9YB 4DV3B 3UT5A 3HB3B 1RP3B 4J7ZA 1HW7A 1YJ9V 1XHXA 5LGNA 3TK1A 3B77A 2ADQB 4FIPC 3AK2A 1SKVA 5IYDO 2E3CA 5E1AC 1IXBA 4DXWA 4XDLA 1M56B 4O4IB 4J80A 4PDMA 3GB7C 1AR4A 4TV9A 4GUNA 5JJJB 1AI5A 4W4LA 1VQLV 4LWSB 1MMMA 1AR1B 3WG7C 2Y4UA 3ZMZA 2IJKA 4MVOA 2WLLB 3WB0A 1IBMO 3E8GA 3W7SA 2M7WA 2ZT9B 1NTZH 4IYHA 3K08A 4J7JA 1WP7A 3JD4A 2CAZC 1GKFA 5EBMC 5BXZA 2DN9A 2QR4A 1V9PA 2F4VO 3Q4HB 4DR5B 1H8HG 4DV2O 5B1BB 1PNMA 2KB1A 1TGOA 3LUTB 1BZKA 3E22A 4GKKB 2EX3A 3CCMV 3JATA 5K1PA 4GKJB 4OGQB 3JALA 2R9AA 1AVMA 5KMGA 3ML0A 3BA9A 1XMQB 3K04A 1K9MW 2WA3A 2EINB 4MVQA 2VS0A 2UUAB 5LHIA 1P49A 5J2UA 4UUJC 1J5EO 1GN4A 3CCEV 2A0LA 4FFKA 2VQFB 4LF4B 2OCCB 1F51A 2QTOA 3RYFB 4WFHA 4O4LA 4MW8A 3T4DA 2A06H 2UUCO 5CBFA 2P22C 2L35A 2HR3A 3N2GA 2RMKB 1I7FA 4JPRA 4R7CA 3AG1C 2IW5A 4YJ2A 2CH7A 4O4HA 2ZNJA 4NYKA 4HNAA 4TV8A 1ZLZA 1QR8A 4DV3O 1GH6A 2V1DA 1FFTB 1A32A 1NKDA 1WA8B 1SQBH 4FLZA 2KG7A 5CMUA 1NR7A 3L71H 1SZTA 1FD9A 2FYUH 2ZIOA 3ABKB 3CB2A 4LP8A 5KA5A 5LYJB 2GHYA 5C8YA 2ADPA 1H2GA 5DEDA 4I4TB 2FKXA 4UVAA 4U3JA 2DYRB 1N32B 1XEQA 4OX9B 2HHHB 1NBMG 1KYOF 4CS3A 3ZJZA 5CB4B 2YUAA 3F5WC 1RM1B 2ILMA 2NNUA 4DUZB 1IXMA 3P3NA 5IYZB 2K9PA 3CC7V 3O65A 3TCUA 2M6YA 1JCHA 5H5NA 4WFGA 1M1KW 2XOKG 2EIKB 3SPIA 2D2CB 4UV8A 1M90W 4DR5O 3RN4A 3ZEDA 3RYHB 4Z1VA 5TISZ 5KA6A 4GKKO 1LUVA 2F23A 4WFAV 3FD9A 1FPOA 4GKJO 1E79G 1XDCA 1JA8A 3HKBB 3JASB 4MVMA 5KAFZ 4OXSA 5JH7B 1XMQO 2XASA 1BGYH 3ZRWB 2YDEA 2UUAO 3L74H 3E8BA 3EXAA 1K92A 4MW3A 1PNKA 2VQFO 4LF4O 1FXKC 2BOCC 4J7KA 4K35A 1B06A 1JQ0A 4DK0A 4OPHA 5DN6G 5IJ9A 1EZJA 3OEEG 4X20B 4D6TH 4Q20A 5EBLC 5JVDB 4PA9A 1MG1A 3OUFA 2BSKB 5LBQA 2LP7A 4DR6O 3H9VA 4PDVA 3QO5A 2RN9A 2E75B 3RWRD 3BRCA 3LSUA 1AILA 2YXHA 1S3JA 2PI5A 4RWUA 1L0LH 2PTMA 2HVKC 4GX0A 4ZOLA 4HBNA 1EZVH 4IT5A 1XHZA 4Q6GA 3WB2A 1Q7YW 4EB6A 3QTCA 2OTJV 2QSAA 3CMAV 1N8RW 1Z5VA 1SQFA 4UFZA 1KKDA 2ZDIA 4IHJA 1M93A 3AK3A 4X89A 5ITZB 1TAEA 2Z3YA 4X1IA 2QWNB 3ABMB 1IBLB 5EC2C 3K5NA 2GUZA 2QKAA 1N32O 4OX9O 2HHHO 4CS4A 3DTUB 1O9GA 2G38A 4I0XB 5L3FA 4JASA 3JSLA 2EULA 1U97A 2E76B 3OR6C 3DGEA 4DUZO 4JAUA 4JTDB 3ZMUA 5A2QN 3ZBHA 2KKWA 2XAFA 3ABTA 1XNQB 2WWWA 4LNUA 3OFNG 2QEXV 1SQVH 4UCSA 4I9WA 2HJDA 3K3WA 1NVPD 5LA6A 3T2MA 5BY1A 3OW2U 2W6JG 5CA1B 3ZRVA 4KL1A 4ZHQA 2P7TC 3CD6V 4PI0A 3D36C 4JI7B 4O2AA 1R6NA 1YITV 1NJIW 4FLXA 2WSSG 1Y74B 3CPWU 1HNZB 3UM7A 3ASOB 4NTXA 2PI4A 5LHHA 2EIJC 4UCVA 3RVZA 4F6EA 1FS0G 3AG4C 2CDYA 4ICGA 4E2LA 3MHSC 3E89A 4JI4B 1OCRC 2ZIMA 1TA8A 2RNBA 3CP1A 4YIPA 1DK1A 1RSOB 5B1OA 5EBWC 3ETGA 1R3IC 2AW9A 4NXNB 1SF9A 2YEVA 3OMAB 1NZ6A 1V55C 1P7GA 1G4YB 3QNEA 4OPAA 3ZMTA 1FXVA 5IWAB 1Y67A 4LF6B 4DR3O 1QLEB 1D2DA 2ZE6A 4I9QA 3GVMA 3K9SA 3ZHRA 4LF8B 1SA0B 4LF5O 3T4ZA 3N2KB 1K7DA 4H13B 5J9PC 2W6IG 4HAMA 2WA4A 1IBLO 4LH7A 1VQ8V 3H1JH 2YI9A 3G80A 1QR9A 2VQEB 3UO2A 1L1FA 4I55A 2NN4A 4JI3B 3WG7B 1IDSA 3FB5C 2IU3A 1WPXA 2X6AA 4JYAO 2C2AA 2EJ7A 3EFFK 5LGUA 4B3TB 1WN7A 1XNQO 2YS8A 3IJ4A 4I7ZB 5EZYA 2LGWA 4BIZA 1HNWB 2OIGA 2X7RB 3GWKC 3JARA 4X64B 2PYLA 4K8XA 4UV9A 3MDSA 2UXNA 1R3JC 1KUQA 1FXKA 4JYYA 1VQ6V 1AJQA 3QF7A 3ASNB 1K5QA 2W0FC 4KHPB 4JAVA 1W2BU 2B1IA 4JI7O 2QGNA 1M57C 1NT2B 3RW0A 2JEUA 3ZMSA 3ZHTA 1K5SA 1N0NA 1HNZO 2Q68A 1VP7A 1T5EA 1R73A 3ZX6A 3JAWA 1GO3F 4JI6B 2QWOB 1M5IA 3KCXA 4WFEA 3LSSA 1IBKB 1YF2A 4NXMB 2P06A 4G2KA 2ITCC 2ZINA 4DV6B 4JI4O 1JJ2U 2EIMC 4LCUC 2JVDA 1FJGB 4TWKA 1PD3A 1BQ0A 5DECA 1K34A 1Y76B 3BEHA 2ODMA 4P2ZA 4NXNO 3TGUH 1TVKB 2QE7G 2DOSA 1N34B 1N0JA 5LP6C 5L3GA 1GK9A 3M7MX 1ENVA 2DWEC 3E86A 5L3CA 3ZN1A 5IWAO 4LF6O 2V7QG 3L73H 3N27A 1I0HA 2DE0X 2XNDG 4G27B 4LF8O 3K79A 3QO8A 4C7UA 4KXRA 1VIBA 2VQEO 1QU7A 4WFBV 2Y69B 3CS5A 2Q0AA 4KUMA 3SYAA 4YY3B 1HWYA 3UKMA 5L3EA 1HP8A 4HYOA 5KAIZ 1KB9F 3FB6C 1YJWV 3C90A 1FAFA 1V54C 4LF9B 4JI3O 5JJNB 3HKDA 1UFIA 1JMKC 2A7WA 3D36A 2HP8A 4B3TO 3SPCA 4O2BB 3E35A 4PI2A 5CBGA 1BHBA 1U96A 4DRXA 1SS3A 2CK3G 3FB7C 2UUBB 3W7UA 3W7WA 1HNWO 3HKEB 4JI8B 3BY6A 3H1LH 4NVPA 4X64O 3VQYA 3ABUA 3THOA 3I5DA 3JSNA 3WU2Z 4ZI7A 4X9QA 4FLYA 1QCEA 2P5OA 1BL8A 2QM7A 1KMIZ 3MAQA 5KUKA 4KHPO 2IBZH 4FZ1A 1KP3A 4QIWF 5FNVA 1DLBA 3AG3C 2ZDIC 4CH6A 1KECA 4O4JB 3RT3C 1SZXA 1W59A 3S3XA 5IYBO 3EHBB 4FFBB 1PV0A 2ZE5A 2AZ0A 4CH3A 2YSUB 4JI6O 4FLWA 1RPRA 4DV1B 3B09A 1QNMA 1JFFA 2PGGA 3D3IA 4YHHB 3JAKA 4PDRA 4JI1B 4QE7A 1IBKO 1OCCB 4NXMO 2YXLA 1L8DA 2Q73A 4DV6O 3UCSC 3F5TA 1WB7A 2Q67A 3APOA 3OGCC 4TOIA 4LF7O 3RYCB 1FJGO 3G6BA 1S77D 1XL6A 4JF3A 3RVYA 1JX9A 2O57A 2VRZA 5B3SC 3PJSK 1ORQC 4TT3G 5IJ0B 4H37A 2LQTA 5J2TB 4TQFA 1M4UA 4J42A 1N34O 4H44B 1W0JG 1YZBA 4PDLA 4AILC 1GAXA 3OE7G 4ASUG 5H6QA 4YJ3A 1ZAUA 3OMIB 1IX9A 4BW9A 2F1MA 3SGIA 2JIZG 3LDEA 3B8NA 3FAVA 3CCQV 4DR1B 2JK5C 2QM4A 4LBEC 4X1YA 5LOVB 1NVPB 3ZN0A 1I94B 1XREA 2LW1A 4YY3O 2JJ1G 3RYIB 1K3EA 2X6CA 1I08A 1K33A 5KHGA 3BCCH 4LF9O 3OAAG 2JDIG 2VWJA 4DUYB 3FKSG 4B7KA 3I56V 2UUBO 4GLXA 3BHPA 4PA7A 3TJTA 4KP4A 1BMFG 1TUBA 4IIJA 3K03A 4RAIA 4LR3A 1GN3A 4JI8O 3BVOA 3DXRB 1MNGA 3CJHB 2ZCEA 5DM6V 2ZM6B 4LH6A 1LUWA 3W7XA 1R3KC 3UO3A 2LW7A 4L87A 5KHHA 3UT5B 4K3AA 5IT9N 2FL4A 3VQXA 5JCOC 2ZXWB 3HKCA 1ZL8A 3D8CA 1O9HA 4JI2B 1KD1W 2LFRA 4TV9B 1BS3A 5LP6A 4UB6Z 1N33B 4Z2WA 3VOUA 1X59A 1Q90D 2R72A 4YHHO 4JI1O 4MTGA 5D5QA 5LMUB 3AG4B 2ZE7A 2YIBA 2HLDG 2XTAA 3X2QB 3T1YB 2PY5A 2Q7GA 2YI8A 3NR7A 2FB5A 2N05A 3OGIB 1N36B 4FMTA 3OMNB 1BQZA 4NTYA 1QVGU 2ZD9A 4FM0A 2UXXA 2ZR3A 1AP5A 2F66C 2Q9LA 3E22B 4JV5B 2QWRB 3FB8C 3JATB 2Q69A 1K8AW 1VMGA 1YI2V 1EN4A 2NR5A 1WJZA 2WLIB 3K5LA 3A0HZ 3JALB 1THZA 2BTQA 5KMGB 4DR4B 3DC6A 4UVCA 4DR1O 5B1AB 1VQ9V 2HJFC 1ROPA 2RCVA 3K57A 4ZBMA 1SQQH 1KQSU 3G67A 2DYSB 1Z2GA 2EINC 4RO2A 4PA4A 4DK1A 1Q6IA 3NXSA 4UVBA 1E1RG 2XAHA 5J2UB 3G6EV 2JRIA 1YIJV 5GONA 4DR2B 3QVNA 2DWDC 4O4LB 3L9DA 2OCCC 4MVSA 4DUYO 1YJNV 4X1KA 4FLVA 5BZBA 5KHIA 2UXBB 1B3QA 2Q7HA 2CTPA 4FZ0A 3N2GB 2QM8A 4QPJA 4P30A 1R6TA 2N04A 2ZM6O 1Q5OA 4KFMA 4YJ2B 2KSDA 4TUYA 2CH7B 4O4HB 4MVZA 4HNAB 4TV8B 3AG7A 3P3PA 1RPOA 2YICA 2R70A 2RJZA 1NI8A 3SJAC 5IYCO 3AG2C 3D3QA 3E8FA 1US6A 1CPYA 2KG7B 3MD0A 5HFMA 2Q8VA 4NKGB 4P9OA 4X62B 1K73W 2Q7EA 3FYIB 4MSWC 4U3FH 1M57B 5KX5A 4JI2O 5BMVB 2AZ2A 3SYPA 5C8YB 5JWPA 1DTOA 3IC7A 4F6RA 3CCSV 1N33O 2WLKA 4U3JB 5CA0A 1FFXA 4IYIA 2P4VA 4DYLA 4B3RB 4JI5B 3W7TA 2DYRC 3SPGA 5LMUO 4RUFA 1F4NA 3IAYA 4DV4B 1GRJA 1W0KG 4JTAB 4BR6A 2JGDB 1Q6HA 4GX2A 1OCOB 2Y4TA 3T1YO 4RQEA 1H8EG 4B3SB 1I5YA 2GBOA 3ZHQA 1H2SB 1FYJA 4MVUA 1FKAO 1N36O 2EIKC 5IY5B 2ITDC 5B1NA 4TQDA 3FFQA 4K0KB 1VQNV 3CRMA 4JV5O 4R6ZA 2B5UA 1NTMH 4WBNA 1XNRB 2XT9A 5EYPA 3CSXA 5LL6Y 4X65B 4DR4O 4AHCA 1K97A 3WB1A 3J80N 3BAAA 5LXTA 2EZPA 4DV0B 3B8MA 4I50A 3SR2C 1Q6UA 5H6RA 5JQGA 5FL7G 2GSMB 4PA6A 2EBOA 1DF4A 4DR2O 1R3LC 4PV1B 5JCOA 4R50A 3AK1A 5IJ9B 4H33A 1MZEA 5GTHZ 3ZCCA 2Y48A 5LMNB 4DV7B 5L3DA 4CH4A 3CRCA 1F23A 1NQTA 3CHXA 3U0ZA 3CCUV 1XQ8A 4IL6Z 4YIOA 1OZ0A 1QBZA 4MTFA 4PA3A 4O4IA 3OR7C 4QGPA 3ZHSA 4BW5A 3IC9A 4YXWG 4ZOLB 2E5LB 4LWSA 3K0GA 1YHQV 3BFRA 4EB6B 2FTKA 4W4KA 2WLLA 2QKSA 1NR1A 3H01A 2LGQA 4X62O 1LR1A 3AG3B 4IHJB 1K4CC 3ZRSA 2BTOA 4WFFA 4X1IB 5FLXN 4FM1A 2ZKOA 2GUZB 1GM8A 3ABMC 4FJCC 2XUMA 1E1QG 3K06A 1VF5B 3Q4HA 2CGNA 4B3RO 4JI5O 3BABA 3CWBH 1QHTA 5AG2A 1GMGA 2Y0PA 2YC0A 2YIDA 4DV4O 1B04A 5LGTA 3HR0A 3L75H 5F2VO 5IE9A 2WLHA 1BSMA 5GW7A 3CE2A 4LNUB 2N74A 4B3SO 1L0NH 3K59A 2P6JA 2EILC 3JCZA 1PP9H 3K58A 2HVJC 2CTRA 3CC2V 2X6BA 5LA6B 3H1KH 4K0KO 4XBFA 2HEPA 1MSDA 4ZHQB 1G6UA 1XNRO 2QTSA 1Y6XA 3RYFA 3PN1A 4U7NA 4X65O 1IVSA 1GN2A 2UXCB 4O2AB 1G8MA 3B4SA 2JGUA 3JD1A 1YEWA 4GZRB 3LNMB 4DV0O 2OCHA 2Q5ZA 5CN0A 2A9HA 3AG1B 2WLJA 2OWOA 1P7BA 4JYBA 2EJRA 4QPKA 4GYCB 2DQ0A 2WLMA 3ASOC 2XAGA 1ZUQA 1S76D 4B08A 5CA3A 2IJJA 2JJ2G 1WA8A 4IGGA 2H3OA 2YXYA 3GWOA 4JZGA 2GDSA 3MHHC 5LMNO 4DV7O 1Q3EA 1X4TA 1SETA 5B5EZ 3EVKA 2UUCB 1YTFD 5LYJA 1MABG 1JOYA 1VQKV 2YEVB 4I4TA 4J9ZB 4JAAA 3ETQA 5H9CA 1AJNA 3ABLC 5EC1C 3UQ8A 4B7EA 5CB4A 1F7YA 1AR5A 1AI6A 2X0LA 4X88A 1QLEC 3IFXA 3R65A 2LFSA 1XILA 2AHYA 5LHGA 5IYZA 2DQ3A 2YIBD 1QLNA 1JJOA 2LO1A 4MVRA 2Q0OC 3P30A 1KC8W 3K0DA 4DR7B 3STZC 4L8JA 2KQXA 1HNXB 1IZ3A 3DSQA 3RYHA 3B40A 4I55B 1ZWIC 2BOBC 2PF4E 5IDJA 1ZTEA 3U11A 5EZYB 3STLC 3HKBA 3JASA 4N21A 1F4MA 5JH7A 2EZOA 2OIEA 3J81N 3ZRWA 5E79Z 3JARB 1VF6C 2Y0IA 1VQ4V 2AHZA 1FXKB 2B1GA 2E74B 4J11A 1OJHA 1VARA 1WLEA 3LDDA 1Q81W 2Q4PA 3LSQA 3A0BZ 3SDLA 2UXCO 4CBCA 3ASNC 4DV5B 1GTOA 4X20A 4UXNA 1UPGA 3T1HB 4ZKIA 5JVDA 2WLIA 1XBLA 2ZNIA 2BSKA 3JAWB 1Q8IA 2JS3A 3CRRA 1MA1A 2CGOA 5C93A 2A79B 2ARHA 5A9GA 2XAJA 1QVFU 3FX7A 3ZHVA 2Q6AA 1XMOB 1BHAA 1YDXA 4FK5C 1WAZA 1VQMV 2CTQA 3E83A 2WLNA 4UCUA 1JR9A 5ITZA 3SJQC 2H94A 2WAMA 3OM3B 4DO2A 3JD2A 4MT8A 4DR6B 1Y66A 1D5AA 3RFRA 1EN6A 1PNLA 4I0XA 2Z5UA 1OCZC 3SYCA 4XDKA 3AG2B 4WCEV 1VQ5V 5FPOA 4EFEA 3ZRXA 1NH2D 3JCUZ 1OHHG 3APQA 2IU0A 4X8AA 3T1CA 5D5PA 2QJ1A 4D7TA 3S3WA 4DR7O 1FXHA 3SJCC 1D5NA 1B6QA 4EEQA 1HNXO 2PUSA 2Y69C 5BMVA 4LFAB 1YVWA 1WNSA 4I5SA 1SC5B 3HKDB 1SQGA 5CA1A 3JD3A 4FM2A 4DRXB 3OD4A 4CC6A 1MZFA 3G71V 4GT1A 1Q86W 2P4KA 4MTOA 1M56C 1URFA 2UU9B 4DV1O 4K8ZA 1Y74A 2JGDA 3RBZA 1J95A 5GTIZ 1PKXA 3OTFA 5KHKA 2EIJB 2QDOA 3C3SA 4ZI7B 3TETA 1BT8A 1VEWA 1SQPH 1UJWB 5KLVH 1AI7A 1CEZA 5FNVB 4QNHB 1OCRB 4DV5O 3JYCA 1H2MA 2WPDG 3H1IH 3T1HO 3CYOA 1KP2A 3CCLV 3O9OA 1RSOA 2IM9A 2ZQMA 4FLTA 3IGAC 2K1EA 1VQ7V 1NS1A 2JS5A 1V55B 5B1BC 3VQVA 2OTLV 3K9AA 4EKWA 1JFFB 2GTSA 3JAKB 4JZ2A 3CRAA 1DF5A 1XMOO 1HR0B 1VF7A 3VBBA 2MW2B 2F93B 1OCCC 4D7SA 1I5XA 3E8HA 4GCZA 4J41A 4A5UB 1SA0A 1I94O 3N2KA 4DW1A 2F43G 2RDCA 5HFLA 2ZE8A 1P84F 3KCYA 4LFCB 3VQWA 4MTXA 4YJ3B 4GX1A 2IH1C 2UXDB 2DJVA 3CEIA 3ZMVA 3G4SV 4B3MB 3ICXA 3JAMN 3ZS8C 3FAVB 4CZZA 4JI0B 4DR3B 3E2EA 1SESA 2BCCH 1R6KA 4X1YB 3I55V 1AP6A 4BIUA 2W0XA 1YXBA 4LF5B 2HFEC 1AI4A 1EFRG 3FYEB 1VF6A 3P32A 2IJHA 4TSFG 1PL4A 1QQCA 4LFAO 1AJPA 2GTAA 5L3BA 4LFBB 3CXHF 4CC5A 1PPJH 3K5MA 3J7AU 1COWG 1SERA 2P90A 4BAYA 4PELA 1Q82W 4ZIBA 2R9IA 2QKCA 4NB5A 3ABKC 2DMXA 3DC5A 4AQYB 1ZSPA 1TUBB 1JVMA 4IIJB 4JYAB 4NTWA 1S5LZ 3OTOB 2UU9O 2L6LA 4PHZA 1PM9A 1WP8A 3CRQA 1M9NA 3C3TA 4F4LA 2EILB 4QE9A 1SQXH 3SPHA 4Z1MG 1G1XB 3TXSA 1RM1C 3M8AA 1S5JA 3ETDA 3CMEV 1MSWD 4BWAA 2EIMB 4CS2A 3HKCB 1ZL8B 1YTFB 2ZXWC 1WB8A 1P4RA 3QO7A 4MS2A 2CUGA 3AEIA 3WFVA 1R1BA 5LP6B 1Y76A 5JJEB 1TVKA 2P67A 1GN6A 3K5OA 1TUEB 4U7OA 1HR0O 1EBOA 3ETEA 4UCTA 2A3QA 2AXTZ 4JYCA 2DW4A 1N4CA 3CXCU 2H8PC 5K1XA 3B2EE 4J10A 5EK0A 4RQFA 1OV9A 3X2QC 1VQOV 1LNQA 4LFCO 1VQPV 1KKCA 3CCVV 3OUSA 2D3OW 2BE3A 1V54B 3CCRV 4BIOA 2UXDO 1GM9A 2FMLA 2UXBO 4B3MO 3ABLB 4UCOA 2BTQB 5KUMA 3JD0A 2XHBA 4JI0O 4O2BA 3SYQA 3A2FA 4H0LB 2V4DA 1IURA 4R8CA 4X66B 2HG5C 1CXZB 2NLJC 5B1AC 3HKEA 1AROP 2F95B 4NR1A 3KZIZ 5BR8B 4PD4F 1KBHA 1MOFA 2CE4A 4FPPA 2DYSC 2MK3A 4LFBO 4JGSA 2HKOA 4AI8A 4LC1A 1EN5A 1CP9A 3CX5F 5GONB 4PJ0Z 4CH5A 4N23A 1H2KA 2PZSA 5CBHA 4X1KB 2OT5A 3CCJV 1JPXA 4AQYO 4O4JA 3RGBA 3OTOO 1AB3A 3M99B 1RFYA 4FFBA 2ATKC 2GV9A 1H38A 4TUYB 2XAQA 1S72V 1HDJA 2IH3C 3SPJA 2OYQA 3A8TA 3H1HH 2ZR2A 4DW0A 3CC4V 1GM7A 2IJIA 1Q43A 1IBMB 1SRYA 1EM1A 2QWQB 3LDCA 4QJFB 2QA4V 4EFBA 3OT7A 5B66Z 3RYCA 5KX5B 3KG2A 5B3SB 1NU1H 1DGSA 1K4DC 2VWKA 1ZX3A 1KU9A 2LJ2A 4F6RB 1S0VA 3ZIAG 5IJ0A 5CA0B 5J2TA 4XDJA 1WPBA 3TXQA 1FFXB 2F4VB 1BCCH 3HPLC 3KKYA 4DV2B
chains in the Genus database with same CATH topology
2JS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JS3 A; 
#chains in the Genus database with same CATH topology
 4RUE A;  2RQ6 A;  4HZ3 A;  4UB8 Z;  1NH2 B;  1YCI A;  4G28 B;  1BE3 H;  5EIB C;  2QWP B;  4GX5 A;  4FLU A;  4JTC B;  2PYJ A;  3ZHU A;  1XI1 A;  1NTK H;  1OCO C;  4FVM A;  3L70 H;  2JEX A;  4LF7 B;  1Z5W A;  1XOU A;  3F7Y C;  5LOV A;  3QG5 A;  1PL0 A;  5FPR A;  3RYI A;  5IY5 C;  1XL4 A;  3L72 H;  3OEH G;  5H2F Z;  3SJB C;  1J5E B;  4E4E A;  5KHJ A;  1YSC A;  4WBN B;  1H2N A;  5EYP B;  1OCZ B;  2Z0A A;  2AGA A;  1Y4M A;  2B9Z A;  3SYO A;  5LXT B;  3BPZ A;  4X66 O;  3LNN A;  5EIB D;  4WF9 V;  3U10 A;  3A0R A;  3R66 A;  1S5H C;  2E5L O;  2ETN A;  4I50 B;  3DXR A;  3BA8 A;  2YIA A;  5BR8 O;  3CJH A;  4ABM A;  5JQG B;  2CTW A;  4UCR A;  4P9P A;  3F7V C;  1XUQ A;  1H2L A;  2R9R B;  4J9Y B;  4DV3 B;  3UT5 A;  3HB3 B;  1RP3 B;  4J7Z A;  1HW7 A;  1YJ9 V;  1XHX A;  5LGN A;  3TK1 A;  3B77 A;  2ADQ B;  4FIP C;  3AK2 A;  1SKV A;  5IYD O;  2E3C A;  5E1A C;  1IXB A;  4DXW A;  4XDL A;  1M56 B;  4O4I B;  4J80 A;  4PDM A;  3GB7 C;  1AR4 A;  4TV9 A;  4GUN A;  5JJJ B;  1AI5 A;  4W4L A;  1VQL V;  4LWS B;  1MMM A;  1AR1 B;  3WG7 C;  2Y4U A;  3ZMZ A;  2IJK A;  4MVO A;  2WLL B;  3WB0 A;  1IBM O;  3E8G A;  3W7S A;  2M7W A;  2ZT9 B;  1NTZ H;  4IYH A;  3K08 A;  4J7J A;  1WP7 A;  3JD4 A;  2CAZ C;  1GKF A;  5EBM C;  5BXZ A;  2DN9 A;  2QR4 A;  1V9P A;  2F4V O;  3Q4H B;  4DR5 B;  1H8H G;  4DV2 O;  5B1B B;  1PNM A;  2KB1 A;  1TGO A;  3LUT B;  1BZK A;  3E22 A;  4GKK B;  2EX3 A;  3CCM V;  3JAT A;  5K1P A;  4GKJ B;  4OGQ B;  3JAL A;  2R9A A;  1AVM A;  5KMG A;  3ML0 A;  3BA9 A;  1XMQ B;  3K04 A;  1K9M W;  2WA3 A;  2EIN B;  4MVQ A;  2VS0 A;  2UUA B;  5LHI A;  1P49 A;  5J2U A;  4UUJ C;  1J5E O;  1GN4 A;  3CCE V;  2A0L A;  4FFK A;  2VQF B;  4LF4 B;  2OCC B;  1F51 A;  2QTO A;  3RYF B;  4WFH A;  4O4L A;  4MW8 A;  3T4D A;  2A06 H;  2UUC O;  5CBF A;  2P22 C;  2L35 A;  2HR3 A;  3N2G A;  2RMK B;  1I7F A;  4JPR A;  4R7C A;  3AG1 C;  2IW5 A;  4YJ2 A;  2CH7 A;  4O4H A;  2ZNJ A;  4NYK A;  4HNA A;  4TV8 A;  1ZLZ A;  1QR8 A;  4DV3 O;  1GH6 A;  2V1D A;  1FFT B;  1A32 A;  1NKD A;  1WA8 B;  1SQB H;  4FLZ A;  2KG7 A;  5CMU A;  1NR7 A;  3L71 H;  1SZT A;  1FD9 A;  2FYU H;  2ZIO A;  3ABK B;  3CB2 A;  4LP8 A;  5KA5 A;  5LYJ B;  2GHY A;  5C8Y A;  2ADP A;  1H2G A;  5DED A;  4I4T B;  2FKX A;  4UVA A;  4U3J A;  2DYR B;  1N32 B;  1XEQ A;  4OX9 B;  2HHH B;  1NBM G;  1KYO F;  4CS3 A;  3ZJZ A;  5CB4 B;  2YUA A;  3F5W C;  1RM1 B;  2ILM A;  2NNU A;  4DUZ B;  1IXM A;  3P3N A;  5IYZ B;  2K9P A;  3CC7 V;  3O65 A;  3TCU A;  2M6Y A;  1JCH A;  5H5N A;  4WFG A;  1M1K W;  2XOK G;  2EIK B;  3SPI A;  2D2C B;  4UV8 A;  1M90 W;  4DR5 O;  3RN4 A;  3ZED A;  3RYH B;  4Z1V A;  5TIS Z;  5KA6 A;  4GKK O;  1LUV A;  2F23 A;  4WFA V;  3FD9 A;  1FPO A;  4GKJ O;  1E79 G;  1XDC A;  1JA8 A;  3HKB B;  3JAS B;  4MVM A;  5KAF Z;  4OXS A;  5JH7 B;  1XMQ O;  2XAS A;  1BGY H;  3ZRW B;  2YDE A;  2UUA O;  3L74 H;  3E8B A;  3EXA A;  1K92 A;  4MW3 A;  1PNK A;  2VQF O;  4LF4 O;  1FXK C;  2BOC C;  4J7K A;  4K35 A;  1B06 A;  1JQ0 A;  4DK0 A;  4OPH A;  5DN6 G;  5IJ9 A;  1EZJ A;  3OEE G;  4X20 B;  4D6T H;  4Q20 A;  5EBL C;  5JVD B;  4PA9 A;  1MG1 A;  3OUF A;  2BSK B;  5LBQ A;  2LP7 A;  4DR6 O;  3H9V A;  4PDV A;  3QO5 A;  2RN9 A;  2E75 B;  3RWR D;  3BRC A;  3LSU A;  1AIL A;  2YXH A;  1S3J A;  2PI5 A;  4RWU A;  1L0L H;  2PTM A;  2HVK C;  4GX0 A;  4ZOL A;  4HBN A;  1EZV H;  4IT5 A;  1XHZ A;  4Q6G A;  3WB2 A;  1Q7Y W;  4EB6 A;  3QTC A;  2OTJ V;  2QSA A;  3CMA V;  1N8R W;  1Z5V A;  1SQF A;  4UFZ A;  1KKD A;  2ZDI A;  4IHJ A;  1M93 A;  3AK3 A;  4X89 A;  5ITZ B;  1TAE A;  2Z3Y A;  4X1I A;  2QWN B;  3ABM B;  1IBL B;  5EC2 C;  3K5N A;  2GUZ A;  2QKA A;  1N32 O;  4OX9 O;  2HHH O;  4CS4 A;  3DTU B;  1O9G A;  2G38 A;  4I0X B;  5L3F A;  4JAS A;  3JSL A;  2EUL A;  1U97 A;  2E76 B;  3OR6 C;  3DGE A;  4DUZ O;  4JAU A;  4JTD B;  3ZMU A;  5A2Q N;  3ZBH A;  2KKW A;  2XAF A;  3ABT A;  1XNQ B;  2WWW A;  4LNU A;  3OFN G;  2QEX V;  1SQV H;  4UCS A;  4I9W A;  2HJD A;  3K3W A;  1NVP D;  5LA6 A;  3T2M A;  5BY1 A;  3OW2 U;  2W6J G;  5CA1 B;  3ZRV A;  4KL1 A;  4ZHQ A;  2P7T C;  3CD6 V;  4PI0 A;  3D36 C;  4JI7 B;  4O2A A;  1R6N A;  1YIT V;  1NJI W;  4FLX A;  2WSS G;  1Y74 B;  3CPW U;  1HNZ B;  3UM7 A;  3ASO B;  4NTX A;  2PI4 A;  5LHH A;  2EIJ C;  4UCV A;  3RVZ A;  4F6E A;  1FS0 G;  3AG4 C;  2CDY A;  4ICG A;  4E2L A;  3MHS C;  3E89 A;  4JI4 B;  1OCR C;  2ZIM A;  1TA8 A;  2RNB A;  3CP1 A;  4YIP A;  1DK1 A;  1RSO B;  5B1O A;  5EBW C;  3ETG A;  1R3I C;  2AW9 A;  4NXN B;  1SF9 A;  2YEV A;  3OMA B;  1NZ6 A;  1V55 C;  1P7G A;  1G4Y B;  3QNE A;  4OPA A;  3ZMT A;  1FXV A;  5IWA B;  1Y67 A;  4LF6 B;  4DR3 O;  1QLE B;  1D2D A;  2ZE6 A;  4I9Q A;  3GVM A;  3K9S A;  3ZHR A;  4LF8 B;  1SA0 B;  4LF5 O;  3T4Z A;  3N2K B;  1K7D A;  4H13 B;  5J9P C;  2W6I G;  4HAM A;  2WA4 A;  1IBL O;  4LH7 A;  1VQ8 V;  3H1J H;  2YI9 A;  3G80 A;  1QR9 A;  2VQE B;  3UO2 A;  1L1F A;  4I55 A;  2NN4 A;  4JI3 B;  3WG7 B;  1IDS A;  3FB5 C;  2IU3 A;  1WPX A;  2X6A A;  4JYA O;  2C2A A;  2EJ7 A;  3EFF K;  5LGU A;  4B3T B;  1WN7 A;  1XNQ O;  2YS8 A;  3IJ4 A;  4I7Z B;  5EZY A;  2LGW A;  4BIZ A;  1HNW B;  2OIG A;  2X7R B;  3GWK C;  3JAR A;  4X64 B;  2PYL A;  4K8X A;  4UV9 A;  3MDS A;  2UXN A;  1R3J C;  1KUQ A;  1FXK A;  4JYY A;  1VQ6 V;  1AJQ A;  3QF7 A;  3ASN B;  1K5Q A;  2W0F C;  4KHP B;  4JAV A;  1W2B U;  2B1I A;  4JI7 O;  2QGN A;  1M57 C;  1NT2 B;  3RW0 A;  2JEU A;  3ZMS A;  3ZHT A;  1K5S A;  1N0N A;  1HNZ O;  2Q68 A;  1VP7 A;  1T5E A;  1R73 A;  3ZX6 A;  3JAW A;  1GO3 F;  4JI6 B;  2QWO B;  1M5I A;  3KCX A;  4WFE A;  3LSS A;  1IBK B;  1YF2 A;  4NXM B;  2P06 A;  4G2K A;  2ITC C;  2ZIN A;  4DV6 B;  4JI4 O;  1JJ2 U;  2EIM C;  4LCU C;  2JVD A;  1FJG B;  4TWK A;  1PD3 A;  1BQ0 A;  5DEC A;  1K34 A;  1Y76 B;  3BEH A;  2ODM A;  4P2Z A;  4NXN O;  3TGU H;  1TVK B;  2QE7 G;  2DOS A;  1N34 B;  1N0J A;  5LP6 C;  5L3G A;  1GK9 A;  3M7M X;  1ENV A;  2DWE C;  3E86 A;  5L3C A;  3ZN1 A;  5IWA O;  4LF6 O;  2V7Q G;  3L73 H;  3N27 A;  1I0H A;  2DE0 X;  2XND G;  4G27 B;  4LF8 O;  3K79 A;  3QO8 A;  4C7U A;  4KXR A;  1VIB A;  2VQE O;  1QU7 A;  4WFB V;  2Y69 B;  3CS5 A;  2Q0A A;  4KUM A;  3SYA A;  4YY3 B;  1HWY A;  3UKM A;  5L3E A;  1HP8 A;  4HYO A;  5KAI Z;  1KB9 F;  3FB6 C;  1YJW V;  3C90 A;  1FAF A;  1V54 C;  4LF9 B;  4JI3 O;  5JJN B;  3HKD A;  1UFI A;  1JMK C;  2A7W A;  3D36 A;  2HP8 A;  4B3T O;  3SPC A;  4O2B B;  3E35 A;  4PI2 A;  5CBG A;  1BHB A;  1U96 A;  4DRX A;  1SS3 A;  2CK3 G;  3FB7 C;  2UUB B;  3W7U A;  3W7W A;  1HNW O;  3HKE B;  4JI8 B;  3BY6 A;  3H1L H;  4NVP A;  4X64 O;  3VQY A;  3ABU A;  3THO A;  3I5D A;  3JSN A;  3WU2 Z;  4ZI7 A;  4X9Q A;  4FLY A;  1QCE A;  2P5O A;  1BL8 A;  2QM7 A;  1KMI Z;  3MAQ A;  5KUK A;  4KHP O;  2IBZ H;  4FZ1 A;  1KP3 A;  4QIW F;  5FNV A;  1DLB A;  3AG3 C;  2ZDI C;  4CH6 A;  1KEC A;  4O4J B;  3RT3 C;  1SZX A;  1W59 A;  3S3X A;  5IYB O;  3EHB B;  4FFB B;  1PV0 A;  2ZE5 A;  2AZ0 A;  4CH3 A;  2YSU B;  4JI6 O;  4FLW A;  1RPR A;  4DV1 B;  3B09 A;  1QNM A;  1JFF A;  2PGG A;  3D3I A;  4YHH B;  3JAK A;  4PDR A;  4JI1 B;  4QE7 A;  1IBK O;  1OCC B;  4NXM O;  2YXL A;  1L8D A;  2Q73 A;  4DV6 O;  3UCS C;  3F5T A;  1WB7 A;  2Q67 A;  3APO A;  3OGC C;  4TOI A;  4LF7 O;  3RYC B;  1FJG O;  3G6B A;  1S77 D;  1XL6 A;  4JF3 A;  3RVY A;  1JX9 A;  2O57 A;  2VRZ A;  5B3S C;  3PJS K;  1ORQ C;  4TT3 G;  5IJ0 B;  4H37 A;  2LQT A;  5J2T B;  4TQF A;  1M4U A;  4J42 A;  1N34 O;  4H44 B;  1W0J G;  1YZB A;  4PDL A;  4AIL C;  1GAX A;  3OE7 G;  4ASU G;  5H6Q A;  4YJ3 A;  1ZAU A;  3OMI B;  1IX9 A;  4BW9 A;  2F1M A;  3SGI A;  2JIZ G;  3LDE A;  3B8N A;  3FAV A;  3CCQ V;  4DR1 B;  2JK5 C;  2QM4 A;  4LBE C;  4X1Y A;  5LOV B;  1NVP B;  3ZN0 A;  1I94 B;  1XRE A;  2LW1 A;  4YY3 O;  2JJ1 G;  3RYI B;  1K3E A;  2X6C A;  1I08 A;  1K33 A;  5KHG A;  3BCC H;  4LF9 O;  3OAA G;  2JDI G;  2VWJ A;  4DUY B;  3FKS G;  4B7K A;  3I56 V;  2UUB O;  4GLX A;  3BHP A;  4PA7 A;  3TJT A;  4KP4 A;  1BMF G;  1TUB A;  4IIJ A;  3K03 A;  4RAI A;  4LR3 A;  1GN3 A;  4JI8 O;  3BVO A;  3DXR B;  1MNG A;  3CJH B;  2ZCE A;  5DM6 V;  2ZM6 B;  4LH6 A;  1LUW A;  3W7X A;  1R3K C;  3UO3 A;  2LW7 A;  4L87 A;  5KHH A;  3UT5 B;  4K3A A;  5IT9 N;  2FL4 A;  3VQX A;  5JCO C;  2ZXW B;  3HKC A;  1ZL8 A;  3D8C A;  1O9H A;  4JI2 B;  1KD1 W;  2LFR A;  4TV9 B;  1BS3 A;  5LP6 A;  4UB6 Z;  1N33 B;  4Z2W A;  3VOU A;  1X59 A;  1Q90 D;  2R72 A;  4YHH O;  4JI1 O;  4MTG A;  5D5Q A;  5LMU B;  3AG4 B;  2ZE7 A;  2YIB A;  2HLD G;  2XTA A;  3X2Q B;  3T1Y B;  2PY5 A;  2Q7G A;  2YI8 A;  3NR7 A;  2FB5 A;  2N05 A;  3OGI B;  1N36 B;  4FMT A;  3OMN B;  1BQZ A;  4NTY A;  1QVG U;  2ZD9 A;  4FM0 A;  2UXX A;  2ZR3 A;  1AP5 A;  2F66 C;  2Q9L A;  3E22 B;  4JV5 B;  2QWR B;  3FB8 C;  3JAT B;  2Q69 A;  1K8A W;  1VMG A;  1YI2 V;  1EN4 A;  2NR5 A;  1WJZ A;  2WLI B;  3K5L A;  3A0H Z;  3JAL B;  1THZ A;  2BTQ A;  5KMG B;  4DR4 B;  3DC6 A;  4UVC A;  4DR1 O;  5B1A B;  1VQ9 V;  2HJF C;  1ROP A;  2RCV A;  3K57 A;  4ZBM A;  1SQQ H;  1KQS U;  3G67 A;  2DYS B;  1Z2G A;  2EIN C;  4RO2 A;  4PA4 A;  4DK1 A;  1Q6I A;  3NXS A;  4UVB A;  1E1R G;  2XAH A;  5J2U B;  3G6E V;  2JRI A;  1YIJ V;  5GON A;  4DR2 B;  3QVN A;  2DWD C;  4O4L B;  3L9D A;  2OCC C;  4MVS A;  4DUY O;  1YJN V;  4X1K A;  4FLV A;  5BZB A;  5KHI A;  2UXB B;  1B3Q A;  2Q7H A;  2CTP A;  4FZ0 A;  3N2G B;  2QM8 A;  4QPJ A;  4P30 A;  1R6T A;  2N04 A;  2ZM6 O;  1Q5O A;  4KFM A;  4YJ2 B;  2KSD A;  4TUY A;  2CH7 B;  4O4H B;  4MVZ A;  4HNA B;  4TV8 B;  3AG7 A;  3P3P A;  1RPO A;  2YIC A;  2R70 A;  2RJZ A;  1NI8 A;  3SJA C;  5IYC O;  3AG2 C;  3D3Q A;  3E8F A;  1US6 A;  1CPY A;  2KG7 B;  3MD0 A;  5HFM A;  2Q8V A;  4NKG B;  4P9O A;  4X62 B;  1K73 W;  2Q7E A;  3FYI B;  4MSW C;  4U3F H;  1M57 B;  5KX5 A;  4JI2 O;  5BMV B;  2AZ2 A;  3SYP A;  5C8Y B;  5JWP A;  1DTO A;  3IC7 A;  4F6R A;  3CCS V;  1N33 O;  2WLK A;  4U3J B;  5CA0 A;  1FFX A;  4IYI A;  2P4V A;  4DYL A;  4B3R B;  4JI5 B;  3W7T A;  2DYR C;  3SPG A;  5LMU O;  4RUF A;  1F4N A;  3IAY A;  4DV4 B;  1GRJ A;  1W0K G;  4JTA B;  4BR6 A;  2JGD B;  1Q6H A;  4GX2 A;  1OCO B;  2Y4T A;  3T1Y O;  4RQE A;  1H8E G;  4B3S B;  1I5Y A;  2GBO A;  3ZHQ A;  1H2S B;  1FYJ A;  4MVU A;  1FKA O;  1N36 O;  2EIK C;  5IY5 B;  2ITD C;  5B1N A;  4TQD A;  3FFQ A;  4K0K B;  1VQN V;  3CRM A;  4JV5 O;  4R6Z A;  2B5U A;  1NTM H;  4WBN A;  1XNR B;  2XT9 A;  5EYP A;  3CSX A;  5LL6 Y;  4X65 B;  4DR4 O;  4AHC A;  1K97 A;  3WB1 A;  3J80 N;  3BAA A;  5LXT A;  2EZP A;  4DV0 B;  3B8M A;  4I50 A;  3SR2 C;  1Q6U A;  5H6R A;  5JQG A;  5FL7 G;  2GSM B;  4PA6 A;  2EBO A;  1DF4 A;  4DR2 O;  1R3L C;  4PV1 B;  5JCO A;  4R50 A;  3AK1 A;  5IJ9 B;  4H33 A;  1MZE A;  5GTH Z;  3ZCC A;  2Y48 A;  5LMN B;  4DV7 B;  5L3D A;  4CH4 A;  3CRC A;  1F23 A;  1NQT A;  3CHX A;  3U0Z A;  3CCU V;  1XQ8 A;  4IL6 Z;  4YIO A;  1OZ0 A;  1QBZ A;  4MTF A;  4PA3 A;  4O4I A;  3OR7 C;  4QGP A;  3ZHS A;  4BW5 A;  3IC9 A;  4YXW G;  4ZOL B;  2E5L B;  4LWS A;  3K0G A;  1YHQ V;  3BFR A;  4EB6 B;  2FTK A;  4W4K A;  2WLL A;  2QKS A;  1NR1 A;  3H01 A;  2LGQ A;  4X62 O;  1LR1 A;  3AG3 B;  4IHJ B;  1K4C C;  3ZRS A;  2BTO A;  4WFF A;  4X1I B;  5FLX N;  4FM1 A;  2ZKO A;  2GUZ B;  1GM8 A;  3ABM C;  4FJC C;  2XUM A;  1E1Q G;  3K06 A;  1VF5 B;  3Q4H A;  2CGN A;  4B3R O;  4JI5 O;  3BAB A;  3CWB H;  1QHT A;  5AG2 A;  1GMG A;  2Y0P A;  2YC0 A;  2YID A;  4DV4 O;  1B04 A;  5LGT A;  3HR0 A;  3L75 H;  5F2V O;  5IE9 A;  2WLH A;  1BSM A;  5GW7 A;  3CE2 A;  4LNU B;  2N74 A;  4B3S O;  1L0N H;  3K59 A;  2P6J A;  2EIL C;  3JCZ A;  1PP9 H;  3K58 A;  2HVJ C;  2CTR A;  3CC2 V;  2X6B A;  5LA6 B;  3H1K H;  4K0K O;  4XBF A;  2HEP A;  1MSD A;  4ZHQ B;  1G6U A;  1XNR O;  2QTS A;  1Y6X A;  3RYF A;  3PN1 A;  4U7N A;  4X65 O;  1IVS A;  1GN2 A;  2UXC B;  4O2A B;  1G8M A;  3B4S A;  2JGU A;  3JD1 A;  1YEW A;  4GZR B;  3LNM B;  4DV0 O;  2OCH A;  2Q5Z A;  5CN0 A;  2A9H A;  3AG1 B;  2WLJ A;  2OWO A;  1P7B A;  4JYB A;  2EJR A;  4QPK A;  4GYC B;  2DQ0 A;  2WLM A;  3ASO C;  2XAG A;  1ZUQ A;  1S76 D;  4B08 A;  5CA3 A;  2IJJ A;  2JJ2 G;  1WA8 A;  4IGG A;  2H3O A;  2YXY A;  3GWO A;  4JZG A;  2GDS A;  3MHH C;  5LMN O;  4DV7 O;  1Q3E A;  1X4T A;  1SET A;  5B5E Z;  3EVK A;  2UUC B;  1YTF D;  5LYJ A;  1MAB G;  1JOY A;  1VQK V;  2YEV B;  4I4T A;  4J9Z B;  4JAA A;  3ETQ A;  5H9C A;  1AJN A;  3ABL C;  5EC1 C;  3UQ8 A;  4B7E A;  5CB4 A;  1F7Y A;  1AR5 A;  1AI6 A;  2X0L A;  4X88 A;  1QLE C;  3IFX A;  3R65 A;  2LFS A;  1XIL A;  2AHY A;  5LHG A;  5IYZ A;  2DQ3 A;  2YIB D;  1QLN A;  1JJO A;  2LO1 A;  4MVR A;  2Q0O C;  3P30 A;  1KC8 W;  3K0D A;  4DR7 B;  3STZ C;  4L8J A;  2KQX A;  1HNX B;  1IZ3 A;  3DSQ A;  3RYH A;  3B40 A;  4I55 B;  1ZWI C;  2BOB C;  2PF4 E;  5IDJ A;  1ZTE A;  3U11 A;  5EZY B;  3STL C;  3HKB A;  3JAS A;  4N21 A;  1F4M A;  5JH7 A;  2EZO A;  2OIE A;  3J81 N;  3ZRW A;  5E79 Z;  3JAR B;  1VF6 C;  2Y0I A;  1VQ4 V;  2AHZ A;  1FXK B;  2B1G A;  2E74 B;  4J11 A;  1OJH A;  1VAR A;  1WLE A;  3LDD A;  1Q81 W;  2Q4P A;  3LSQ A;  3A0B Z;  3SDL A;  2UXC O;  4CBC A;  3ASN C;  4DV5 B;  1GTO A;  4X20 A;  4UXN A;  1UPG A;  3T1H B;  4ZKI A;  5JVD A;  2WLI A;  1XBL A;  2ZNI A;  2BSK A;  3JAW B;  1Q8I A;  2JS3 A;  3CRR A;  1MA1 A;  2CGO A;  5C93 A;  2A79 B;  2ARH A;  5A9G A;  2XAJ A;  1QVF U;  3FX7 A;  3ZHV A;  2Q6A A;  1XMO B;  1BHA A;  1YDX A;  4FK5 C;  1WAZ A;  1VQM V;  2CTQ A;  3E83 A;  2WLN A;  4UCU A;  1JR9 A;  5ITZ A;  3SJQ C;  2H94 A;  2WAM A;  3OM3 B;  4DO2 A;  3JD2 A;  4MT8 A;  4DR6 B;  1Y66 A;  1D5A A;  3RFR A;  1EN6 A;  1PNL A;  4I0X A;  2Z5U A;  1OCZ C;  3SYC A;  4XDK A;  3AG2 B;  4WCE V;  1VQ5 V;  5FPO A;  4EFE A;  3ZRX A;  1NH2 D;  3JCU Z;  1OHH G;  3APQ A;  2IU0 A;  4X8A A;  3T1C A;  5D5P A;  2QJ1 A;  4D7T A;  3S3W A;  4DR7 O;  1FXH A;  3SJC C;  1D5N A;  1B6Q A;  4EEQ A;  1HNX O;  2PUS A;  2Y69 C;  5BMV A;  4LFA B;  1YVW A;  1WNS A;  4I5S A;  1SC5 B;  3HKD B;  1SQG A;  5CA1 A;  3JD3 A;  4FM2 A;  4DRX B;  3OD4 A;  4CC6 A;  1MZF A;  3G71 V;  4GT1 A;  1Q86 W;  2P4K A;  4MTO A;  1M56 C;  1URF A;  2UU9 B;  4DV1 O;  4K8Z A;  1Y74 A;  2JGD A;  3RBZ A;  1J95 A;  5GTI Z;  1PKX A;  3OTF A;  5KHK A;  2EIJ B;  2QDO A;  3C3S A;  4ZI7 B;  3TET A;  1BT8 A;  1VEW A;  1SQP H;  1UJW B;  5KLV H;  1AI7 A;  1CEZ A;  5FNV B;  4QNH B;  1OCR B;  4DV5 O;  3JYC A;  1H2M A;  2WPD G;  3H1I H;  3T1H O;  3CYO A;  1KP2 A;  3CCL V;  3O9O A;  1RSO A;  2IM9 A;  2ZQM A;  4FLT A;  3IGA C;  2K1E A;  1VQ7 V;  1NS1 A;  2JS5 A;  1V55 B;  5B1B C;  3VQV A;  2OTL V;  3K9A A;  4EKW A;  1JFF B;  2GTS A;  3JAK B;  4JZ2 A;  3CRA A;  1DF5 A;  1XMO O;  1HR0 B;  1VF7 A;  3VBB A;  2MW2 B;  2F93 B;  1OCC C;  4D7S A;  1I5X A;  3E8H A;  4GCZ A;  4J41 A;  4A5U B;  1SA0 A;  1I94 O;  3N2K A;  4DW1 A;  2F43 G;  2RDC A;  5HFL A;  2ZE8 A;  1P84 F;  3KCY A;  4LFC B;  3VQW A;  4MTX A;  4YJ3 B;  4GX1 A;  2IH1 C;  2UXD B;  2DJV A;  3CEI A;  3ZMV A;  3G4S V;  4B3M B;  3ICX A;  3JAM N;  3ZS8 C;  3FAV B;  4CZZ A;  4JI0 B;  4DR3 B;  3E2E A;  1SES A;  2BCC H;  1R6K A;  4X1Y B;  3I55 V;  1AP6 A;  4BIU A;  2W0X A;  1YXB A;  4LF5 B;  2HFE C;  1AI4 A;  1EFR G;  3FYE B;  1VF6 A;  3P32 A;  2IJH A;  4TSF G;  1PL4 A;  1QQC A;  4LFA O;  1AJP A;  2GTA A;  5L3B A;  4LFB B;  3CXH F;  4CC5 A;  1PPJ H;  3K5M A;  3J7A U;  1COW G;  1SER A;  2P90 A;  4BAY A;  4PEL A;  1Q82 W;  4ZIB A;  2R9I A;  2QKC A;  4NB5 A;  3ABK C;  2DMX A;  3DC5 A;  4AQY B;  1ZSP A;  1TUB B;  1JVM A;  4IIJ B;  4JYA B;  4NTW A;  1S5L Z;  3OTO B;  2UU9 O;  2L6L A;  4PHZ A;  1PM9 A;  1WP8 A;  3CRQ A;  1M9N A;  3C3T A;  4F4L A;  2EIL B;  4QE9 A;  1SQX H;  3SPH A;  4Z1M G;  1G1X B;  3TXS A;  1RM1 C;  3M8A A;  1S5J A;  3ETD A;  3CME V;  1MSW D;  4BWA A;  2EIM B;  4CS2 A;  3HKC B;  1ZL8 B;  1YTF B;  2ZXW C;  1WB8 A;  1P4R A;  3QO7 A;  4MS2 A;  2CUG A;  3AEI A;  3WFV A;  1R1B A;  5LP6 B;  1Y76 A;  5JJE B;  1TVK A;  2P67 A;  1GN6 A;  3K5O A;  1TUE B;  4U7O A;  1HR0 O;  1EBO A;  3ETE A;  4UCT A;  2A3Q A;  2AXT Z;  4JYC A;  2DW4 A;  1N4C A;  3CXC U;  2H8P C;  5K1X A;  3B2E E;  4J10 A;  5EK0 A;  4RQF A;  1OV9 A;  3X2Q C;  1VQO V;  1LNQ A;  4LFC O;  1VQP V;  1KKC A;  3CCV V;  3OUS A;  2D3O W;  2BE3 A;  1V54 B;  3CCR V;  4BIO A;  2UXD O;  1GM9 A;  2FML A;  2UXB O;  4B3M O;  3ABL B;  4UCO A;  2BTQ B;  5KUM A;  3JD0 A;  2XHB A;  4JI0 O;  4O2B A;  3SYQ A;  3A2F A;  4H0L B;  2V4D A;  1IUR A;  4R8C A;  4X66 B;  2HG5 C;  1CXZ B;  2NLJ C;  5B1A C;  3HKE A;  1ARO P;  2F95 B;  4NR1 A;  3KZI Z;  5BR8 B;  4PD4 F;  1KBH A;  1MOF A;  2CE4 A;  4FPP A;  2DYS C;  2MK3 A;  4LFB O;  4JGS A;  2HKO A;  4AI8 A;  4LC1 A;  1EN5 A;  1CP9 A;  3CX5 F;  5GON B;  4PJ0 Z;  4CH5 A;  4N23 A;  1H2K A;  2PZS A;  5CBH A;  4X1K B;  2OT5 A;  3CCJ V;  1JPX A;  4AQY O;  4O4J A;  3RGB A;  3OTO O;  1AB3 A;  3M99 B;  1RFY A;  4FFB A;  2ATK C;  2GV9 A;  1H38 A;  4TUY B;  2XAQ A;  1S72 V;  1HDJ A;  2IH3 C;  3SPJ A;  2OYQ A;  3A8T A;  3H1H H;  2ZR2 A;  4DW0 A;  3CC4 V;  1GM7 A;  2IJI A;  1Q43 A;  1IBM B;  1SRY A;  1EM1 A;  2QWQ B;  3LDC A;  4QJF B;  2QA4 V;  4EFB A;  3OT7 A;  5B66 Z;  3RYC A;  5KX5 B;  3KG2 A;  5B3S B;  1NU1 H;  1DGS A;  1K4D C;  2VWK A;  1ZX3 A;  1KU9 A;  2LJ2 A;  4F6R B;  1S0V A;  3ZIA G;  5IJ0 A;  5CA0 B;  5J2T A;  4XDJ A;  1WPB A;  3TXQ A;  1FFX B;  2F4V B;  1BCC H;  3HPL C;  3KKY A;  4DV2 B; 
#chains in the Genus database with same CATH homology
 2JS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...