2JS3A

Nmr structure of protein q6n9a4_rhopa. northeast structural genomics consortium target rpt8
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
96
structure length
96
Chain Sequence
MGSSHHHHHHSSGRENLYFQGMTDTAAEDVRKIATALLKTAIEIVSEEDGGAHNQCKLCGASVPWLQTGDEIKHADDCPVVIAKQILSSRPKLHAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title NMR structure of protein Q6N9A4_RHOPA.
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
total genus 14
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11519 DUF3222 Protein of unknown function (DUF3222)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.780 Mainly Alpha Orthogonal Bundle Helix Hairpins ITPase-like domains 2js3A01
2JS3A
chains in the Genus database with same CATH superfamily
1B3QA 3JAWB 4DR3B 1H8EG 2W0FC 4K8ZA 1YZBA 3D3IA 1WPBA 1G6UA 1EN6A 1AI6A 4ZI7B 2ITDC 3SYPA 1EZVH 2EINB 4PELA 4MS2A 4PA3A 4QGPA 5J2TA 3CWBH 4TV8A 4RWUA 1K4DC 2N05A 1M57B 1QQCA 3P3PA 1VF7A 4H33A 2RN9A 3E86A 5H6RA 4FLTA 2QEXV 1Q7YW 4XBFA 2DWDC 4I5SA 1I7FA 1ROPA 3GB7C 4AILC 4HAMA 3ABLB 2ETNA 1TUEB 1BSMA 3W7XA 2YXHA 2YSUB 4J11A 3G71V 4UVBA 2Y48A 4HNAB 4PA6A 3H1IH 3LSSA 2PGGA 2F4VO 1UFIA 2JK5C 2MK3A 4ZKIA 2BTQA 1SQVH 2EILB 4FZ0A 2GBOA 5L3DA 2V1DA 2ZE7A 4DW0A 1S76D 1XBLA 2Q7HA 2Q9LA 2IJJA 3T1HO 3TCUA 1YJNV 1NI8A 4YY3B 2HLDG 2Y69C 2UXDB 1YTFB 3APOA 2CTWA 3IC9A 4G28B 3MDSA 2Q68A 1JR9A 1M4UA 4DV1B 2JJ2G 4JI3O 3ZHRA 1K97A 2P22C 4EEQA 4I55B 4NXNO 4EKWA 1RSOA 1EFRG 4EB6B 3T4ZA 1GM9A 1WAZA 5LL6Y 1JMKC 3DXRB 3MHHC 1R6NA 4DV6B 5KUMA 1F7YA 3QO7A 3G6EV 1N32B 2HHHO 4JI8O 3S3XA 5LMUO 2IH1C 3GWOA 3SJQC 2Y4TA 2ZIMA 3F5TA 3LUTB 3WB0A 4CH6A 1V9PA 3G6BA 3OTOB 2UUCB 1KYOF 2BOBC 2UUBO 3SPIA 3K58A 1CXZB 5IE9A 1FXKA 3K9AA 4I4TA 1ZL8B 3HPLC 3WG7C 2ZINA 2WA4A 3AG1B 3ZMSA 4OXSA 3GVMA 4GX5A 2EBOA 3JD3A 2GSMB 3LSQA 1SETA 4HYOA 2JRIA 2IU0A 5IY5B 2ARHA 4O4IA 1I0HA 5KMGA 1KMIZ 5KAFZ 3JARA 2XAQA 3E8HA 1UPGA 4UV9A 2EIMB 4U3JB 2JVDA 1WNSA 2Q69A 1P49A 2LFSA 3O9OA 4MTXA 4U3FH 4EFEA 4TSFG 1OZ0A 1Y67A 1F23A 4PA7A 2PF4E 3BHPA 4NTXA 3JCZA 2QWRB 3M7MX 2YXLA 3OE7G 2PYJA 3BABA 2QTSA 1Q5OA 2ZXWB 1HNWB 4JASA 3HR0A 3DC6A 4G27B 4JAVA 4IIJA 3LSUA 1VQ8V 4O4LA 3H1KH 5LOVB 3CCJV 3IJ4A 3E22A 1XL4A 4X89A 5EIBC 3JSLA 2CGOA 3ASOB 1IBLO 3L70H 4YJ2A 2R9IA 1OCOC 4R8CA 1VIBA 4QPJA 4N23A 4JI1O 4NTYA 5LP6A 1AR5A 2CTQA 3H9VA 2LW1A 3QVNA 1ZSPA 5ITZA 5EIBD 5HFMA 1G8MA 1KU9A 1WA8B 2EINC 2Y0PA 3TK1A 5KX5B 4QE9A 4J7ZA 1LUWA 5H6QA 3CB2A 3RYIB 1GM8A 1XNRB 2M6YA 4FK5C 4FM2A 1KB9F 3GWKC 5JJJB 1SERA 2UU9O 5JJEB 5CMUA 2KKWA 4J80A 3H1JH 3L73H 4GX2A 5EYPA 2HP8A 2JIZG 3BAAA 5FNVA 2FKXA 1AJPA 4PDMA 4NVPA 3UO2A 1KC8W 2P5OA 1F4MA 4JZ2A 5DECA 1YVWA 1JVMA 2P06A 2A79B 3E8BA 1EBOA 3ZRSA 4WF9V 3JYCA 4DV7B 3DC5A 3N2KA 5EK0A 1BCCH 2XNDG 2PTMA 2X6BA 3K59A 2JJ1G 2UUAO 5LXTA 2F66C 1TVKA 2XAFA 3FB8C 3W7SA 2WLIB 3N2GA 4DUYB 1ZX3A 3JD2A 5BR8O 1SQXH 2EJ7A 4RAIA 3RVYA 3I55V 4PA9A 1IURA 4K3AA 3KKYA 1IBKO 4P30A 1YSCA 2EIKC 2YEVB 4DRXA 2CUGA 2BSKB 4DO2A 2DQ3A 1H38A 1XHXA 1VQOV 2OYQA 1OCZB 1J5EO 1KD1W 3ZMTA 4X1YB 1WLEA 5F2VO 4GKKO 3DGEA 1S5LZ 5IWAB 3L72H 4WCEV 3CCLV 4FZ1A 4O2AB 1AI7A 4I50A 4TT3G 4BR6A 2B9ZA 5B3SC 2EZOA 4MVZA 4DR5B 5B1BC 4X65O 3Q4HA 4JYAB 2W6JG 1VQ5V 3JALB 5CBHA 5KA5A 5LGNA 4LF5O 3B4SA 2JS5A 4WBNA 5IY5C 3JAWA 3K03A 3ABUA 3B40A 1WPXA 3I56V 1D2DA 1XMQB 2N74A 2EIMC 3H1LH 4NTWA 4QJFB 4ZHQB 3W7TA 1NH2B 1G4YB 1YITV 2WWWA 4Z1MG 2RNBA 2IU3A 2DYRC 1FJGB 2JGDB 4X1KB 5LBQA 4B3RO 1N4CA 4J7JA 4X64O 1N33O 4QPKA 1E1QG 1M1KW 5FLXN 2HFEC 3CJHB 3G67A 1GN3A 4DR6O 1I08A 4JAAA 1N0NA 1JA8A 3RT3C 3TXQA 4WFBV 1K8AW 2GTAA 3T1YB 2E3CA 5BXZA 4X1IA 1MA1A 2E5LO 1VQKV 4BW5A 1S0VA 4HNAA 2IBZH 4TOIA 3CX5F 2A06H 4I7ZB 1Y74B 1BGYH 3SYOA 4F6RB 1R3JC 4YIOA 4DR4O 5CBGA 2OIGA 5TISZ 4W4LA 2KG7B 5LHIA 3RYHB 3A0HZ 1SRYA 1SF9A 2CAZC 4DR3O 4J9ZB 1DTOA 2Q7GA 3D8CA 2Y69B 4CZZA 1XI1A 2BCCH 1S5JA 2E75B 4CS3A 2YICA 2YXYA 4MW3A 4D6TH 4UB6Z 4RUEA 2Q0OC 4I55A 3QTCA 4O4HA 3JATB 2H94A 2DQ0A 1Q86W 1XMOB 5L3EA 3EVKA 3QNEA 1W0KG 4PI2A 4MVMA 3RVZA 1XL6A 1L0NH 2XOKG 1TUBB 5KHHA 5C8YB 3H1HH 3CRQA 1IVSA 5BMVA 2PI4A 1PNKA 1ZL8A 5D5PA 1BMFG 1E1RG 4K8XA 3WG7B 4PI0A 3FB7C 5IT9N 3J81N 4X88A 2D3OW 3IAYA 5IYBO 3SJBC 1I94B 4O2BA 2YIAA 1HDJA 1PPJH 2UXBB 5KUKA 1OCRC 4LFAB 5HFLA 3KCYA 4DR2B 3QG5A 3TETA 4YY3O 2UXDO 4YXWG 3E2EA 1FXHA 4OPHA 4TWKA 4AQYB 1FPOA 4LBEC 1K7DA 3B09A 4DV1O 1COWG 1M56C 3ABKC 1KKDA 3ETDA 1FFXB 4DR1B 5B1AB 2ZNJA 4LR3A 4CC6A 1LR1A 5CBFA 3J7AU 3OUSA 3E8GA 1YXBA 3K08A 4PD4F 1Z5WA 4DV6O 5LOVA 3UT5B 2PUSA 1N32O 2UXCB 2H8PC 3FB6C 3OTOO 4JI7B 2UUCO 2NR5A 3EXAA 1Z2GA 2V7QG 1OCOB 5EC2C 2Y4UA 4ZOLA 3SPCA 3NXSA 4P9PA 3VQXA 3D3QA 3RW0A 3STZC 3MHSC 1VQ6V 1CEZA 1PL0A 1OHHG 2LFRA 4D7SA 1JX9A 3L74H 1VF6C 1AVMA 3OM3B 1Q6IA 4WFEA 5KX5A 1R6TA 4R6ZA 4DV3B 2HG5C 4BIUA 3CHXA 2Q7EA 2CH7B 3RYIA 1KP3A 2N04A 4O4JA 4B3MB 1AP6A 1NH2D 1S72V 1Y76B 4LF9B 1A32A 1G1XB 3ZRWA 4X8AA 3THOA 1R73A 1NR1A 5LMNB 2BTOA 3FFQA 1VQMV 2ITCC 1I5YA 4BWAA 2WLLB 2B1GA 1QBZA 2F1MA 3RGBA 4G2KA 1HNWO 1CP9A 4UUJC 1TA8A 5DM6V 2M7WA 3HKEB 1SQGA 4U7NA 4BAYA 5L3FA 4J41A 1S3JA 1QLNA 1W59A 1Q3EA 2JDIG 2GDSA 1RPRA 1KUQA 1HNXB 5A2QN 4KFMA 2WLIA 4H44B 1XNQB 3CC2V 4F4LA 3CCVV 4LWSB 4DK0A 2R72A 1CPYA 1NQTA 5CB4B 4JI5B 2PZSA 2YEVA 2EIKB 3AK3A 3CMEV 1NKDA 2BSKA 1XNRO 3CCSV 3FYIB 1X4TA 4LF4B 3KCXA 2RQ6A 1IXBA 4LFBB 2DW4A 3WB2A 2VQFB 4KHPB 4JGSA 3LDCA 1WB7A 3FYEB 3PN1A 3LNMB 5LA6B 1XQ8A 1AI5A 1I5XA 3CYOA 4MVQA 3BVOA 2LJ2A 3CS5A 4O2AA 3A0RA 4N21A 4J42A 5B3SB 1W2BU 4JPRA 2EULA 5B1BB 4B08A 1S5HC 3JALA 3CP1A 1N8RW 1L8DA 3QF7A 1BL8A 4DV7O 1QHTA 3ML0A 1BZKA 3ZBHA 3QO5A 3G4SV 1T5EA 5FPRA 1NTZH 4PDVA 4RUFA 2ZE6A 2VQEB 2R9AA 2Q73A 1K92A 3M8AA 1R6KA 1SZXA 5A9GA 4Q20A 2W0XA 4DUYO 3ETEA 3E35A 4MSWC 4PDLA 2JGDA 5B1AC 1H2GA 2DYRB 4OPAA 1M5IA 1K3EA 2G38A 3M99B 1PD3A 3CJHA 5LYJB 4GKJB 4JI6B 2NLJC 2C2AA 3L71H 3C3TA 5H9CA 1YDXA 2E76B 1VP7A 4XDLA 3CC7V 1F4NA 1GMGA 2ZDIC 2QGNA 1Y74A 3L75H 5E79Z 4F6RA 2HR3A 1BQZA 5IWAO 1SQPH 3NR7A 3X2QC 1QVGU 1NTKH 1Q6HA 4DR5O 2X7RB 4JYAO 2WA3A 2XTAA 1VQ4V 3QO8A 4FVMA 1BHAA 3ZS8C 2H3OA 3HKDA 3WFVA 1SKVA 5GW7A 4WFGA 5H2FZ 1XMQO 1V55C 1EN5A 2EJRA 1KQSU 5IDJA 3BFRA 2Q0AA 1K33A 2DYSB 4FJCC 3ZX6A 2L6LA 2QWOB 5JQGA 1MOFA 4ICGA 5KHIA 2Q4PA 4FLVA 4X9QA 1HW7A 1MZEA 5CA0B 4TQFA 4L8JA 3JATA 5CA1B 3CC4V 5E1AC 5J2TB 1FJGO 4KUMA 2QM4A 1MABG 1Q81W 3P30A 3H01A 4NR1A 1U96A 2BOCC 3K79A 4UB8Z 2IH3C 1TUBA 1P7GA 2YIBD 1XEQA 1RM1C 1PKXA 3ZHQA 5C8YA 2ZKOA 1SA0B 3T1YO 1H2LA 1VQNV 1O9HA 2CGNA 2GUZB 2WPDG 5LHHA 4FM0A 1XUQA 2RMKB 2NNUA 1PL4A 1MZFA 3RYFA 4MVSA 3G80A 2MW2B 1K4CC 1O9GA 3CRRA 5AG2A 1KECA 2Y0IA 1B04A 4WFFA 4GZRB 1D5NA 3ABTA 4LFCB 1OCRB 1PNLA 4TV9A 4KP4A 1NJIW 4UCSA 2EZPA 5CA3A 1MSWD 2GHYA 3ZN0A 4UCTA 4TQDA 1HP8A 3LNNA 2QM8A 5GONA 1M56B 3ABKB 1FFXA 1P7BA 4FLYA 3OMIB 2P6JA 3T4DA 1VQ9V 1FXVA 1GKFA 4B7EA 3VBBA 1RP3B 2VS0A 1XMOO 2YI9A 3OGIB 3ZHUA 3UT5A 2ILMA 5JVDB 3ABMC 1YIJV 4ASUG 3WU2Z 2RCVA 3KZIZ 3O65A 2VRZA 1FXKB 4JV5B 3B2EE 4I4TB 1K73W 3D36C 3VQYA 5IYZB 2QA4V 1VF5B 1HNZB 1EM1A 4H13B 1YJ9V 4J9YB 4ZI7A 3U10A 4I0XB 1I94O 1GO3F 4A5UB 2DJVA 4O4IB 1N36B 5KMGB 2UXBO 2ZIOA 4DV0B 3JASB 3JARB 2CH7A 3UCSC 4LFAO 4Z2WA 3BCCH 1Q6UA 4DR2O 2UXXA 1Y76A 2YS8A 2FTKA 2ZM6B 5BY1A 3F7YC 2QSAA 4AQYO 4JI4B 4B3TB 1JJOA 3A8TA 5JCOC 2EX3A 2YI8A 3SDLA 2AXTZ 5JWPA 2Z5UA 2WLMA 4DR1O 1ZAUA 2IM9A 1EN4A 3JD0A 4X20B 3CCRV 2EIJC 2GV9A 1BQ0A 4AHCA 1B6QA 4NB5A 4IIJB 3HKEA 4O4LB 2CDYA 3K0GA 3AG2B 3CE2A 2UXCO 4FFBB 4UVAA 1N0JA 4JI7O 2YDEA 3DTUB 3HB3B 2LQTA 4OX9B 3B8MA 1H2SB 2LP7A 4LF6B 1WN7A 1DLBA 2DYSC 1YJWV 2WSSG 5ITZB 3MAQA 1LNQA 3UQ8A 4DV5B 4H37A 4MVOA 4CH4A 3K5MA 4LWSA 5DN6G 4FIPC 1SZTA 3EFFK 4DV3O 5D5QA 4MVRA 5CB4A 4B3SB 3RFRA 4EB6A 4R50A 2OT5A 2P4VA 3DXRA 5KA6A 4B3MO 3STLC 2VWJA 4I9WA 3OMAB 4LF9O 2R9RB 1TGOA 1V54B 5LMNO 1FAFA 4JYYA 1QCEA 1IX9A 3AK1A 4GLXA 4IGGA 1AR4A 2X6CA 1AJQA 3K04A 4LP8A 3HKCB 3LDDA 2KQXA 2QE7G 3K5OA 1JCHA 2XAHA 5LXTB 2Q8VA 2Q67A 3OD4A 5GTIZ 1FYJA 4U3JA 1HNXO 3SYQA 3N2GB 5IJ0B 2HKOA 5IJ9B 2RDCA 5J2UB 5IYCO 3TJTA 3RYCB 3A0BZ 2AGAA 1XNQO 2QR4A 3IC7A 1HR0B 5EBMC 2YUAA 1K34A 3ZJZA 5DEDA 1B06A 1N34B 3ICXA 2Z0AA 3SYCA 2OIEA 4PJ0Z 3K5LA 2OTJV 1IXMA 1R1BA 4DUZB 4JI5O 1Y6XA 1PM9A 2WLJA 3HKBB 4IHJB 3ZN1A 4Q6GA 2OTLV 2PY5A 4LF4O 1DGSA 2K1EA 4ZBMA 1SQFA 2QM7A 4LFBO 1FXKC 2VQFO 4KHPO 3CXCU 1GTOA 3KG2A 2FB5A 4KL1A 4LH6A 1BS3A 3VQVA 2BE3A 3JAKB 3AG3B 1QR8A 4I50B 4CS4A 4PA4A 1QR9A 4LF7B 4FLUA 3X2QB 3S3WA 5K1PA 4JTCB 4QIWF 3SR2C 1L0LH 3W7UA 1WP7A 1D5AA 3U0ZA 1AILA 1WA8A 1YEWA 2QKCA 4WBNB 3TXSA 2VWKA 2PI5A 2OCCC 4LCUC 3RN4A 4E2LA 4NXMO 4BIZA 4DR7B 3OT7A 1V55B 1Y4MA 2P7TC 4CC5A 4X62B 3JSNA 2VQEO 1JFFB 2DOSA 2FYUH 2K9PA 3ZRVA 5CA0A 3JD4A 3AEIA 4YJ3B 4JI2B 5CA1A 3R66A 4Z1VA 2QKAA 4ZIBA 3CCEV 4PDRA 4BW9A 5KHKA 1VARA 3FD9A 3OFNG 4JI0B 5LGUA 4MTOA 4NYKA 4HZ3A 2F23A 5FPOA 4GKJO 4CH5A 1J95A 3SGIA 4JI6O 3LDEA 1RM1B 2QJ1A 3AG2C 3SJAC 3RWRD 4X1IB 1SA0A 3F5WC 3JD1A 5GTHZ 4LF8B 1GAXA 2GUZA 1K9MW 3CRAA 1FD9A 2KB1A 3OGCC 5L3GA 1GN4A 4FM1A 5LP6C 3FAVB 3J80N 1IBMB 2XUMA 2FMLA 5FL7G 1FKAO 4K0KB 1QLEC 5B5EZ 4GX0A 5KLVH 5L3BA 2JEUA 3APQA 5JH7B 4DV4B 4GX1A 1M93A 3C90A 2JGUA 2DWEC 4YHHB 1VMGA 3K57A 4H0LB 2QDOA 4UVCA 3I5DA 4IYIA 2F93B 4LC1A 2P4KA 3B8NA 1FFTB 4TUYB 4RQEA 3U11A 3N27A 2ADQB 4CBCA 4X66B 1V54C 3EHBB 4UCVA 4FPPA 4O4HB 4X1YA 1SC5B 4E4EA 2QWNB 2HVJC 3PJSK 1OCCC 4IT5A 1TAEA 2AZ2A 1Q8IA 4UCOA 4P2ZA 3P32A 1URFA 2CE4A 1GM7A 1KKCA 3AG4C 4RQFA 3B77A 4DV2B 5JVDA 3ZMZA 5CN0A 1FS0G 3ABMB 2UXNA 1ZTEA 1MG1A 5BMVB 4RO2A 5EC1C 5IYZA 1Q82W 4NXMB 4OGQB 1OJHA 4ZHQA 2QTOA 4I0XA 4O2BB 2WLNA 4LNUB 1VF6A 1VQLV 1JQ0A 3CCMV 4MVUA 2HJFC 3JASA 4X1KA 5BZBA 3SYAA 4LFCO 2ADPA 5C93A 2ZE8A 4CS2A 3SPHA 1AB3A 4WFAV 1THZA 3CMAV 3OUFA 5B1OA 1KBHA 4FMTA 5EZYB 4JF3A 2LGQA 2CK3G 2F4VB 2RJZA 3ZHVA 4GUNA 1U97A 3CD6V 1LUVA 3AG3C 3L9DA 4X20A 3BRCA 2YIDA 3T1CA 1PV0A 2EIJB 1XHZA 2F95B 2IJIA 2E74B 1NTMH 1SQBH 3ASNC 2KG7A 3RYHA 3OAAG 4LH7A 1YI2V 2ZT9B 1AROP 1DF5A 4FFBA 3T1HB 1NBMG 3ZIAG 4ABMA 4JV5O 4EFBA 1W0JG 1H2KA 2LO1A 3FKSG 1WJZA 4ZOLB 3A2FA 1M90W 2V4DA 3ZCCA 1HNZO 1XDCA 3BA9A 4JI3B 3T2MA 3SPJA 2XHBA 3CRMA 3OR6C 4NXNB 1AI4A 1N36O 4TV8B 1K5QA 1P4RA 1NT2B 4DV0O 3JAMN 1M57C 2A7WA 4MW8A 4O4JB 3TGUH 2HHHB 4JI8B 5LMUB 1R3IC 1VEWA 3E89A 1NZ6A 4JZGA 3C3SA 4XDJA 3ZRWB 3ZHTA 3K06A 2UUBB 2ZM6O 3CEIA 2PYLA 2X6AA 3ABLC 4JTDB 3JCUZ 4JI4O 4B3TO 3F7VC 1NS1A 1SQQH 4I9QA 1MMMA 2AHYA 1DF4A 4DYLA 1MSDA 3R65A 2ZR3A 2XASA 2BTQB 2EILC 2IJKA 4L87A 1YCIA 3E83A 5B1NA 4IYHA 2XT9A 1VQPV 1H2NA 1SESA 4B7KA 2CTPA 3HKCA 2DN9A 4MT8A 2JS3A 1RPOA 3OR7C 1UJWB 1HWYA 4FFKA 2IW5A 3CRCA 2JEXA 4JYBA 2YC0A 2OCHA 1BE3H 1WP8A 4J7KA 4OX9O 2Q5ZA 4DK1A 5IJ0A 5IJ9A 4FLZA 5J2UA 3DSQA 3RYCA 4LF6O 2F43G 2FL4A 2P67A 4R7CA 1JJ2U 2WAMA 4DV5O 1NR7A 5H5NA 1YTFD 3P3NA 2A3QA 1RSOB 4CH3A 3K3WA 4JYCA 4B3SO 1IZ3A 1NVPB 1QNMA 3HKBA 3MD0A 4IHJA 2OWOA 1ZLZA 3ETGA 1YHQV 3OEHG 3ZEDA 2ZQMA 1IBLB 3BPZA 4MTFA 2R70A 2XAJA 2CTRA 4JI1B 2ZDIA 3JAKA 2IJHA 3AG1C 2LGWA 1WB8A 2O57A 1AP5A 1GN2A 2B1IA 1P84F 4DXWA 3IGAC 3CCQV 2AW9A 5KHJA 1AR1B 3UM7A 3CCUV 4GT1A 2ZR2A 4MTGA 2W6IG 2OCCB 2WLHA 4QE7A 5JJNB 3UKMA 1H2MA 2QWPB 2UU9B 1JPXA 1BT8A 1JFFA 2XAGA 2NN4A 2LW7A 1NU1H 4YJ3A 2YIBA 2ZCEA 1HR0O 5KHGA 1N34O 3UO3A 4JTAB 4GYCB 2L35A 2WLLA 3K9SA 2ZXWC 1Q43A 4DUZO 3CSXA 3ETQA 1GRJA 1JOYA 4U7OA 1RFYA 1XREA 2ZD9A 3VOUA 2ZE5A 3E22B 3IFXA 1L1FA 5L3CA 3ASOC 2UUAB 2A0LA 5IYDO 3E8FA 1VQ7V 4YJ2B 3AG7A 4UV8A 1Y66A 4NKGB 2B5UA 3K0DA 4PV1B 1KP2A 1Z5VA 4C7UA 3FAVA 2QKSA 5LP6B 3CXHF 5B66Z 4LF7O 2HVKC 2X0LA 5BR8B 1QLEB 5JH7A 2WLKA 3BEHA 2ATKC 1K5SA 4FLWA 4YIPA 1PP9H 4UXNA 1IBKB 2Z3YA 2A9HA 2HJDA 3OEEG 3HKDB 1ZWIC 1XOUA 2QWQB 1E79G 4K35A 4TUYA 1J5EB 3BA8A 4DR7O 4JAUA 1MNGA 5JQGB 4X62O 5EYPB 1R3KC 4GKKB 3AK2A 5FNVB 1IDSA 4XDKA 1ENVA 3FB5C 4J10A 5LGTA 4JI2O 1GN6A 5LA6A 3ZRXA 3FX7A 1OCCB 2ODMA 1OV9A 1QVFU 5EBLC 1XILA 3W7WA 4X65B 4DW1A 1BHBA 3SPGA 4UCRA 2DE0X 4PHZA 4LF5B 4JI0O 3AG4B 4WFHA 1S77D 1H8HG 1M9NA 4KXRA 3N2KB 2D2CB 2DMXA 2AHZA 1R3LC 2P90A 4LF8O 3D36A 4QNHB 3BY6A 3ZHSA 3RYFB 1X59A 1SS3A 1PNMA 1TVKB 4UCUA 1GH6A 3RBZA 4F6EA 5J9PC 4FLXA 1IBMO 4K0KO 2KSDA 4LNUA 2Q6AA 1Q90D 3OMNB 4BIOA 3ZMVA 3OTFA 5K1XA 4AI8A 4B3RB 4UFZA 4X64B 1F51A 4DV4O 1AJNA 1N33B 1US6A 3WB1A 4YHHO 4TV9B 1QU7A 3SJCC 4DR6B 3VQWA 4DRXB 5LYJA 3OW2U 1OCZC 1YF2A 5GONB 5JCOA 3ZMUA 2E5LB 5EZYA 1ZUQA 4P9OA 4X66O 4D7TA 1NVPD 4HBNA 3K5NA 2HEPA 4DR4B 1DK1A 4IL6Z 1GK9A 5KAIZ 3Q4HB 4W4KA 4GCZA 2GTSA 5EBWC 2AZ0A 3ASNB 3CPWU 5LHGA 4DV2O 1ORQC 1EZJA 2ZNIA
chains in the Genus database with same CATH topology
2JS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JS3 A; 
#chains in the Genus database with same CATH topology
 1B3Q A;  3JAW B;  4DR3 B;  1H8E G;  2W0F C;  4K8Z A;  1YZB A;  3D3I A;  1WPB A;  1G6U A;  1EN6 A;  1AI6 A;  4ZI7 B;  2ITD C;  3SYP A;  1EZV H;  2EIN B;  4PEL A;  4MS2 A;  4PA3 A;  4QGP A;  5J2T A;  3CWB H;  4TV8 A;  4RWU A;  1K4D C;  2N05 A;  1M57 B;  1QQC A;  3P3P A;  1VF7 A;  4H33 A;  2RN9 A;  3E86 A;  5H6R A;  4FLT A;  2QEX V;  1Q7Y W;  4XBF A;  2DWD C;  4I5S A;  1I7F A;  1ROP A;  3GB7 C;  4AIL C;  4HAM A;  3ABL B;  2ETN A;  1TUE B;  1BSM A;  3W7X A;  2YXH A;  2YSU B;  4J11 A;  3G71 V;  4UVB A;  2Y48 A;  4HNA B;  4PA6 A;  3H1I H;  3LSS A;  2PGG A;  2F4V O;  1UFI A;  2JK5 C;  2MK3 A;  4ZKI A;  2BTQ A;  1SQV H;  2EIL B;  4FZ0 A;  2GBO A;  5L3D A;  2V1D A;  2ZE7 A;  4DW0 A;  1S76 D;  1XBL A;  2Q7H A;  2Q9L A;  2IJJ A;  3T1H O;  3TCU A;  1YJN V;  1NI8 A;  4YY3 B;  2HLD G;  2Y69 C;  2UXD B;  1YTF B;  3APO A;  2CTW A;  3IC9 A;  4G28 B;  3MDS A;  2Q68 A;  1JR9 A;  1M4U A;  4DV1 B;  2JJ2 G;  4JI3 O;  3ZHR A;  1K97 A;  2P22 C;  4EEQ A;  4I55 B;  4NXN O;  4EKW A;  1RSO A;  1EFR G;  4EB6 B;  3T4Z A;  1GM9 A;  1WAZ A;  5LL6 Y;  1JMK C;  3DXR B;  3MHH C;  1R6N A;  4DV6 B;  5KUM A;  1F7Y A;  3QO7 A;  3G6E V;  1N32 B;  2HHH O;  4JI8 O;  3S3X A;  5LMU O;  2IH1 C;  3GWO A;  3SJQ C;  2Y4T A;  2ZIM A;  3F5T A;  3LUT B;  3WB0 A;  4CH6 A;  1V9P A;  3G6B A;  3OTO B;  2UUC B;  1KYO F;  2BOB C;  2UUB O;  3SPI A;  3K58 A;  1CXZ B;  5IE9 A;  1FXK A;  3K9A A;  4I4T A;  1ZL8 B;  3HPL C;  3WG7 C;  2ZIN A;  2WA4 A;  3AG1 B;  3ZMS A;  4OXS A;  3GVM A;  4GX5 A;  2EBO A;  3JD3 A;  2GSM B;  3LSQ A;  1SET A;  4HYO A;  2JRI A;  2IU0 A;  5IY5 B;  2ARH A;  4O4I A;  1I0H A;  5KMG A;  1KMI Z;  5KAF Z;  3JAR A;  2XAQ A;  3E8H A;  1UPG A;  4UV9 A;  2EIM B;  4U3J B;  2JVD A;  1WNS A;  2Q69 A;  1P49 A;  2LFS A;  3O9O A;  4MTX A;  4U3F H;  4EFE A;  4TSF G;  1OZ0 A;  1Y67 A;  1F23 A;  4PA7 A;  2PF4 E;  3BHP A;  4NTX A;  3JCZ A;  2QWR B;  3M7M X;  2YXL A;  3OE7 G;  2PYJ A;  3BAB A;  2QTS A;  1Q5O A;  2ZXW B;  1HNW B;  4JAS A;  3HR0 A;  3DC6 A;  4G27 B;  4JAV A;  4IIJ A;  3LSU A;  1VQ8 V;  4O4L A;  3H1K H;  5LOV B;  3CCJ V;  3IJ4 A;  3E22 A;  1XL4 A;  4X89 A;  5EIB C;  3JSL A;  2CGO A;  3ASO B;  1IBL O;  3L70 H;  4YJ2 A;  2R9I A;  1OCO C;  4R8C A;  1VIB A;  4QPJ A;  4N23 A;  4JI1 O;  4NTY A;  5LP6 A;  1AR5 A;  2CTQ A;  3H9V A;  2LW1 A;  3QVN A;  1ZSP A;  5ITZ A;  5EIB D;  5HFM A;  1G8M A;  1KU9 A;  1WA8 B;  2EIN C;  2Y0P A;  3TK1 A;  5KX5 B;  4QE9 A;  4J7Z A;  1LUW A;  5H6Q A;  3CB2 A;  3RYI B;  1GM8 A;  1XNR B;  2M6Y A;  4FK5 C;  4FM2 A;  1KB9 F;  3GWK C;  5JJJ B;  1SER A;  2UU9 O;  5JJE B;  5CMU A;  2KKW A;  4J80 A;  3H1J H;  3L73 H;  4GX2 A;  5EYP A;  2HP8 A;  2JIZ G;  3BAA A;  5FNV A;  2FKX A;  1AJP A;  4PDM A;  4NVP A;  3UO2 A;  1KC8 W;  2P5O A;  1F4M A;  4JZ2 A;  5DEC A;  1YVW A;  1JVM A;  2P06 A;  2A79 B;  3E8B A;  1EBO A;  3ZRS A;  4WF9 V;  3JYC A;  4DV7 B;  3DC5 A;  3N2K A;  5EK0 A;  1BCC H;  2XND G;  2PTM A;  2X6B A;  3K59 A;  2JJ1 G;  2UUA O;  5LXT A;  2F66 C;  1TVK A;  2XAF A;  3FB8 C;  3W7S A;  2WLI B;  3N2G A;  4DUY B;  1ZX3 A;  3JD2 A;  5BR8 O;  1SQX H;  2EJ7 A;  4RAI A;  3RVY A;  3I55 V;  4PA9 A;  1IUR A;  4K3A A;  3KKY A;  1IBK O;  4P30 A;  1YSC A;  2EIK C;  2YEV B;  4DRX A;  2CUG A;  2BSK B;  4DO2 A;  2DQ3 A;  1H38 A;  1XHX A;  1VQO V;  2OYQ A;  1OCZ B;  1J5E O;  1KD1 W;  3ZMT A;  4X1Y B;  1WLE A;  5F2V O;  4GKK O;  3DGE A;  1S5L Z;  5IWA B;  3L72 H;  4WCE V;  3CCL V;  4FZ1 A;  4O2A B;  1AI7 A;  4I50 A;  4TT3 G;  4BR6 A;  2B9Z A;  5B3S C;  2EZO A;  4MVZ A;  4DR5 B;  5B1B C;  4X65 O;  3Q4H A;  4JYA B;  2W6J G;  1VQ5 V;  3JAL B;  5CBH A;  5KA5 A;  5LGN A;  4LF5 O;  3B4S A;  2JS5 A;  4WBN A;  5IY5 C;  3JAW A;  3K03 A;  3ABU A;  3B40 A;  1WPX A;  3I56 V;  1D2D A;  1XMQ B;  2N74 A;  2EIM C;  3H1L H;  4NTW A;  4QJF B;  4ZHQ B;  3W7T A;  1NH2 B;  1G4Y B;  1YIT V;  2WWW A;  4Z1M G;  2RNB A;  2IU3 A;  2DYR C;  1FJG B;  2JGD B;  4X1K B;  5LBQ A;  4B3R O;  1N4C A;  4J7J A;  4X64 O;  1N33 O;  4QPK A;  1E1Q G;  1M1K W;  5FLX N;  2HFE C;  3CJH B;  3G67 A;  1GN3 A;  4DR6 O;  1I08 A;  4JAA A;  1N0N A;  1JA8 A;  3RT3 C;  3TXQ A;  4WFB V;  1K8A W;  2GTA A;  3T1Y B;  2E3C A;  5BXZ A;  4X1I A;  1MA1 A;  2E5L O;  1VQK V;  4BW5 A;  1S0V A;  4HNA A;  2IBZ H;  4TOI A;  3CX5 F;  2A06 H;  4I7Z B;  1Y74 B;  1BGY H;  3SYO A;  4F6R B;  1R3J C;  4YIO A;  4DR4 O;  5CBG A;  2OIG A;  5TIS Z;  4W4L A;  2KG7 B;  5LHI A;  3RYH B;  3A0H Z;  1SRY A;  1SF9 A;  2CAZ C;  4DR3 O;  4J9Z B;  1DTO A;  2Q7G A;  3D8C A;  2Y69 B;  4CZZ A;  1XI1 A;  2BCC H;  1S5J A;  2E75 B;  4CS3 A;  2YIC A;  2YXY A;  4MW3 A;  4D6T H;  4UB6 Z;  4RUE A;  2Q0O C;  4I55 A;  3QTC A;  4O4H A;  3JAT B;  2H94 A;  2DQ0 A;  1Q86 W;  1XMO B;  5L3E A;  3EVK A;  3QNE A;  1W0K G;  4PI2 A;  4MVM A;  3RVZ A;  1XL6 A;  1L0N H;  2XOK G;  1TUB B;  5KHH A;  5C8Y B;  3H1H H;  3CRQ A;  1IVS A;  5BMV A;  2PI4 A;  1PNK A;  1ZL8 A;  5D5P A;  1BMF G;  1E1R G;  4K8X A;  3WG7 B;  4PI0 A;  3FB7 C;  5IT9 N;  3J81 N;  4X88 A;  2D3O W;  3IAY A;  5IYB O;  3SJB C;  1I94 B;  4O2B A;  2YIA A;  1HDJ A;  1PPJ H;  2UXB B;  5KUK A;  1OCR C;  4LFA B;  5HFL A;  3KCY A;  4DR2 B;  3QG5 A;  3TET A;  4YY3 O;  2UXD O;  4YXW G;  3E2E A;  1FXH A;  4OPH A;  4TWK A;  4AQY B;  1FPO A;  4LBE C;  1K7D A;  3B09 A;  4DV1 O;  1COW G;  1M56 C;  3ABK C;  1KKD A;  3ETD A;  1FFX B;  4DR1 B;  5B1A B;  2ZNJ A;  4LR3 A;  4CC6 A;  1LR1 A;  5CBF A;  3J7A U;  3OUS A;  3E8G A;  1YXB A;  3K08 A;  4PD4 F;  1Z5W A;  4DV6 O;  5LOV A;  3UT5 B;  2PUS A;  1N32 O;  2UXC B;  2H8P C;  3FB6 C;  3OTO O;  4JI7 B;  2UUC O;  2NR5 A;  3EXA A;  1Z2G A;  2V7Q G;  1OCO B;  5EC2 C;  2Y4U A;  4ZOL A;  3SPC A;  3NXS A;  4P9P A;  3VQX A;  3D3Q A;  3RW0 A;  3STZ C;  3MHS C;  1VQ6 V;  1CEZ A;  1PL0 A;  1OHH G;  2LFR A;  4D7S A;  1JX9 A;  3L74 H;  1VF6 C;  1AVM A;  3OM3 B;  1Q6I A;  4WFE A;  5KX5 A;  1R6T A;  4R6Z A;  4DV3 B;  2HG5 C;  4BIU A;  3CHX A;  2Q7E A;  2CH7 B;  3RYI A;  1KP3 A;  2N04 A;  4O4J A;  4B3M B;  1AP6 A;  1NH2 D;  1S72 V;  1Y76 B;  4LF9 B;  1A32 A;  1G1X B;  3ZRW A;  4X8A A;  3THO A;  1R73 A;  1NR1 A;  5LMN B;  2BTO A;  3FFQ A;  1VQM V;  2ITC C;  1I5Y A;  4BWA A;  2WLL B;  2B1G A;  1QBZ A;  2F1M A;  3RGB A;  4G2K A;  1HNW O;  1CP9 A;  4UUJ C;  1TA8 A;  5DM6 V;  2M7W A;  3HKE B;  1SQG A;  4U7N A;  4BAY A;  5L3F A;  4J41 A;  1S3J A;  1QLN A;  1W59 A;  1Q3E A;  2JDI G;  2GDS A;  1RPR A;  1KUQ A;  1HNX B;  5A2Q N;  4KFM A;  2WLI A;  4H44 B;  1XNQ B;  3CC2 V;  4F4L A;  3CCV V;  4LWS B;  4DK0 A;  2R72 A;  1CPY A;  1NQT A;  5CB4 B;  4JI5 B;  2PZS A;  2YEV A;  2EIK B;  3AK3 A;  3CME V;  1NKD A;  2BSK A;  1XNR O;  3CCS V;  3FYI B;  1X4T A;  4LF4 B;  3KCX A;  2RQ6 A;  1IXB A;  4LFB B;  2DW4 A;  3WB2 A;  2VQF B;  4KHP B;  4JGS A;  3LDC A;  1WB7 A;  3FYE B;  3PN1 A;  3LNM B;  5LA6 B;  1XQ8 A;  1AI5 A;  1I5X A;  3CYO A;  4MVQ A;  3BVO A;  2LJ2 A;  3CS5 A;  4O2A A;  3A0R A;  4N21 A;  4J42 A;  5B3S B;  1W2B U;  4JPR A;  2EUL A;  5B1B B;  4B08 A;  1S5H C;  3JAL A;  3CP1 A;  1N8R W;  1L8D A;  3QF7 A;  1BL8 A;  4DV7 O;  1QHT A;  3ML0 A;  1BZK A;  3ZBH A;  3QO5 A;  3G4S V;  1T5E A;  5FPR A;  1NTZ H;  4PDV A;  4RUF A;  2ZE6 A;  2VQE B;  2R9A A;  2Q73 A;  1K92 A;  3M8A A;  1R6K A;  1SZX A;  5A9G A;  4Q20 A;  2W0X A;  4DUY O;  3ETE A;  3E35 A;  4MSW C;  4PDL A;  2JGD A;  5B1A C;  1H2G A;  2DYR B;  4OPA A;  1M5I A;  1K3E A;  2G38 A;  3M99 B;  1PD3 A;  3CJH A;  5LYJ B;  4GKJ B;  4JI6 B;  2NLJ C;  2C2A A;  3L71 H;  3C3T A;  5H9C A;  1YDX A;  2E76 B;  1VP7 A;  4XDL A;  3CC7 V;  1F4N A;  1GMG A;  2ZDI C;  2QGN A;  1Y74 A;  3L75 H;  5E79 Z;  4F6R A;  2HR3 A;  1BQZ A;  5IWA O;  1SQP H;  3NR7 A;  3X2Q C;  1QVG U;  1NTK H;  1Q6H A;  4DR5 O;  2X7R B;  4JYA O;  2WA3 A;  2XTA A;  1VQ4 V;  3QO8 A;  4FVM A;  1BHA A;  3ZS8 C;  2H3O A;  3HKD A;  3WFV A;  1SKV A;  5GW7 A;  4WFG A;  5H2F Z;  1XMQ O;  1V55 C;  1EN5 A;  2EJR A;  1KQS U;  5IDJ A;  3BFR A;  2Q0A A;  1K33 A;  2DYS B;  4FJC C;  3ZX6 A;  2L6L A;  2QWO B;  5JQG A;  1MOF A;  4ICG A;  5KHI A;  2Q4P A;  4FLV A;  4X9Q A;  1HW7 A;  1MZE A;  5CA0 B;  4TQF A;  4L8J A;  3JAT A;  5CA1 B;  3CC4 V;  5E1A C;  5J2T B;  1FJG O;  4KUM A;  2QM4 A;  1MAB G;  1Q81 W;  3P30 A;  3H01 A;  4NR1 A;  1U96 A;  2BOC C;  3K79 A;  4UB8 Z;  2IH3 C;  1TUB A;  1P7G A;  2YIB D;  1XEQ A;  1RM1 C;  1PKX A;  3ZHQ A;  5C8Y A;  2ZKO A;  1SA0 B;  3T1Y O;  1H2L A;  1VQN V;  1O9H A;  2CGN A;  2GUZ B;  2WPD G;  5LHH A;  4FM0 A;  1XUQ A;  2RMK B;  2NNU A;  1PL4 A;  1MZF A;  3RYF A;  4MVS A;  3G80 A;  2MW2 B;  1K4C C;  1O9G A;  3CRR A;  5AG2 A;  1KEC A;  2Y0I A;  1B04 A;  4WFF A;  4GZR B;  1D5N A;  3ABT A;  4LFC B;  1OCR B;  1PNL A;  4TV9 A;  4KP4 A;  1NJI W;  4UCS A;  2EZP A;  5CA3 A;  1MSW D;  2GHY A;  3ZN0 A;  4UCT A;  4TQD A;  1HP8 A;  3LNN A;  2QM8 A;  5GON A;  1M56 B;  3ABK B;  1FFX A;  1P7B A;  4FLY A;  3OMI B;  2P6J A;  3T4D A;  1VQ9 V;  1FXV A;  1GKF A;  4B7E A;  3VBB A;  1RP3 B;  2VS0 A;  1XMO O;  2YI9 A;  3OGI B;  3ZHU A;  3UT5 A;  2ILM A;  5JVD B;  3ABM C;  1YIJ V;  4ASU G;  3WU2 Z;  2RCV A;  3KZI Z;  3O65 A;  2VRZ A;  1FXK B;  4JV5 B;  3B2E E;  4I4T B;  1K73 W;  3D36 C;  3VQY A;  5IYZ B;  2QA4 V;  1VF5 B;  1HNZ B;  1EM1 A;  4H13 B;  1YJ9 V;  4J9Y B;  4ZI7 A;  3U10 A;  4I0X B;  1I94 O;  1GO3 F;  4A5U B;  2DJV A;  4O4I B;  1N36 B;  5KMG B;  2UXB O;  2ZIO A;  4DV0 B;  3JAS B;  3JAR B;  2CH7 A;  3UCS C;  4LFA O;  4Z2W A;  3BCC H;  1Q6U A;  4DR2 O;  2UXX A;  1Y76 A;  2YS8 A;  2FTK A;  2ZM6 B;  5BY1 A;  3F7Y C;  2QSA A;  4AQY O;  4JI4 B;  4B3T B;  1JJO A;  3A8T A;  5JCO C;  2EX3 A;  2YI8 A;  3SDL A;  2AXT Z;  5JWP A;  2Z5U A;  2WLM A;  4DR1 O;  1ZAU A;  2IM9 A;  1EN4 A;  3JD0 A;  4X20 B;  3CCR V;  2EIJ C;  2GV9 A;  1BQ0 A;  4AHC A;  1B6Q A;  4NB5 A;  4IIJ B;  3HKE A;  4O4L B;  2CDY A;  3K0G A;  3AG2 B;  3CE2 A;  2UXC O;  4FFB B;  4UVA A;  1N0J A;  4JI7 O;  2YDE A;  3DTU B;  3HB3 B;  2LQT A;  4OX9 B;  3B8M A;  1H2S B;  2LP7 A;  4LF6 B;  1WN7 A;  1DLB A;  2DYS C;  1YJW V;  2WSS G;  5ITZ B;  3MAQ A;  1LNQ A;  3UQ8 A;  4DV5 B;  4H37 A;  4MVO A;  4CH4 A;  3K5M A;  4LWS A;  5DN6 G;  4FIP C;  1SZT A;  3EFF K;  4DV3 O;  5D5Q A;  4MVR A;  5CB4 A;  4B3S B;  3RFR A;  4EB6 A;  4R50 A;  2OT5 A;  2P4V A;  3DXR A;  5KA6 A;  4B3M O;  3STL C;  2VWJ A;  4I9W A;  3OMA B;  4LF9 O;  2R9R B;  1TGO A;  1V54 B;  5LMN O;  1FAF A;  4JYY A;  1QCE A;  1IX9 A;  3AK1 A;  4GLX A;  4IGG A;  1AR4 A;  2X6C A;  1AJQ A;  3K04 A;  4LP8 A;  3HKC B;  3LDD A;  2KQX A;  2QE7 G;  3K5O A;  1JCH A;  2XAH A;  5LXT B;  2Q8V A;  2Q67 A;  3OD4 A;  5GTI Z;  1FYJ A;  4U3J A;  1HNX O;  3SYQ A;  3N2G B;  5IJ0 B;  2HKO A;  5IJ9 B;  2RDC A;  5J2U B;  5IYC O;  3TJT A;  3RYC B;  3A0B Z;  2AGA A;  1XNQ O;  2QR4 A;  3IC7 A;  1HR0 B;  5EBM C;  2YUA A;  1K34 A;  3ZJZ A;  5DED A;  1B06 A;  1N34 B;  3ICX A;  2Z0A A;  3SYC A;  2OIE A;  4PJ0 Z;  3K5L A;  2OTJ V;  1IXM A;  1R1B A;  4DUZ B;  4JI5 O;  1Y6X A;  1PM9 A;  2WLJ A;  3HKB B;  4IHJ B;  3ZN1 A;  4Q6G A;  2OTL V;  2PY5 A;  4LF4 O;  1DGS A;  2K1E A;  4ZBM A;  1SQF A;  2QM7 A;  4LFB O;  1FXK C;  2VQF O;  4KHP O;  3CXC U;  1GTO A;  3KG2 A;  2FB5 A;  4KL1 A;  4LH6 A;  1BS3 A;  3VQV A;  2BE3 A;  3JAK B;  3AG3 B;  1QR8 A;  4I50 B;  4CS4 A;  4PA4 A;  1QR9 A;  4LF7 B;  4FLU A;  3X2Q B;  3S3W A;  5K1P A;  4JTC B;  4QIW F;  3SR2 C;  1L0L H;  3W7U A;  1WP7 A;  1D5A A;  3U0Z A;  1AIL A;  1WA8 A;  1YEW A;  2QKC A;  4WBN B;  3TXS A;  2VWK A;  2PI5 A;  2OCC C;  4LCU C;  3RN4 A;  4E2L A;  4NXM O;  4BIZ A;  4DR7 B;  3OT7 A;  1V55 B;  1Y4M A;  2P7T C;  4CC5 A;  4X62 B;  3JSN A;  2VQE O;  1JFF B;  2DOS A;  2FYU H;  2K9P A;  3ZRV A;  5CA0 A;  3JD4 A;  3AEI A;  4YJ3 B;  4JI2 B;  5CA1 A;  3R66 A;  4Z1V A;  2QKA A;  4ZIB A;  3CCE V;  4PDR A;  4BW9 A;  5KHK A;  1VAR A;  3FD9 A;  3OFN G;  4JI0 B;  5LGU A;  4MTO A;  4NYK A;  4HZ3 A;  2F23 A;  5FPO A;  4GKJ O;  4CH5 A;  1J95 A;  3SGI A;  4JI6 O;  3LDE A;  1RM1 B;  2QJ1 A;  3AG2 C;  3SJA C;  3RWR D;  4X1I B;  1SA0 A;  3F5W C;  3JD1 A;  5GTH Z;  4LF8 B;  1GAX A;  2GUZ A;  1K9M W;  3CRA A;  1FD9 A;  2KB1 A;  3OGC C;  5L3G A;  1GN4 A;  4FM1 A;  5LP6 C;  3FAV B;  3J80 N;  1IBM B;  2XUM A;  2FML A;  5FL7 G;  1FKA O;  4K0K B;  1QLE C;  5B5E Z;  4GX0 A;  5KLV H;  5L3B A;  2JEU A;  3APQ A;  5JH7 B;  4DV4 B;  4GX1 A;  1M93 A;  3C90 A;  2JGU A;  2DWE C;  4YHH B;  1VMG A;  3K57 A;  4H0L B;  2QDO A;  4UVC A;  3I5D A;  4IYI A;  2F93 B;  4LC1 A;  2P4K A;  3B8N A;  1FFT B;  4TUY B;  4RQE A;  3U11 A;  3N27 A;  2ADQ B;  4CBC A;  4X66 B;  1V54 C;  3EHB B;  4UCV A;  4FPP A;  4O4H B;  4X1Y A;  1SC5 B;  4E4E A;  2QWN B;  2HVJ C;  3PJS K;  1OCC C;  4IT5 A;  1TAE A;  2AZ2 A;  1Q8I A;  4UCO A;  4P2Z A;  3P32 A;  1URF A;  2CE4 A;  1GM7 A;  1KKC A;  3AG4 C;  4RQF A;  3B77 A;  4DV2 B;  5JVD A;  3ZMZ A;  5CN0 A;  1FS0 G;  3ABM B;  2UXN A;  1ZTE A;  1MG1 A;  5BMV B;  4RO2 A;  5EC1 C;  5IYZ A;  1Q82 W;  4NXM B;  4OGQ B;  1OJH A;  4ZHQ A;  2QTO A;  4I0X A;  4O2B B;  2WLN A;  4LNU B;  1VF6 A;  1VQL V;  1JQ0 A;  3CCM V;  4MVU A;  2HJF C;  3JAS A;  4X1K A;  5BZB A;  3SYA A;  4LFC O;  2ADP A;  5C93 A;  2ZE8 A;  4CS2 A;  3SPH A;  1AB3 A;  4WFA V;  1THZ A;  3CMA V;  3OUF A;  5B1O A;  1KBH A;  4FMT A;  5EZY B;  4JF3 A;  2LGQ A;  2CK3 G;  2F4V B;  2RJZ A;  3ZHV A;  4GUN A;  1U97 A;  3CD6 V;  1LUV A;  3AG3 C;  3L9D A;  4X20 A;  3BRC A;  2YID A;  3T1C A;  1PV0 A;  2EIJ B;  1XHZ A;  2F95 B;  2IJI A;  2E74 B;  1NTM H;  1SQB H;  3ASN C;  2KG7 A;  3RYH A;  3OAA G;  4LH7 A;  1YI2 V;  2ZT9 B;  1ARO P;  1DF5 A;  4FFB A;  3T1H B;  1NBM G;  3ZIA G;  4ABM A;  4JV5 O;  4EFB A;  1W0J G;  1H2K A;  2LO1 A;  3FKS G;  1WJZ A;  4ZOL B;  3A2F A;  1M90 W;  2V4D A;  3ZCC A;  1HNZ O;  1XDC A;  3BA9 A;  4JI3 B;  3T2M A;  3SPJ A;  2XHB A;  3CRM A;  3OR6 C;  4NXN B;  1AI4 A;  1N36 O;  4TV8 B;  1K5Q A;  1P4R A;  1NT2 B;  4DV0 O;  3JAM N;  1M57 C;  2A7W A;  4MW8 A;  4O4J B;  3TGU H;  2HHH B;  4JI8 B;  5LMU B;  1R3I C;  1VEW A;  3E89 A;  1NZ6 A;  4JZG A;  3C3S A;  4XDJ A;  3ZRW B;  3ZHT A;  3K06 A;  2UUB B;  2ZM6 O;  3CEI A;  2PYL A;  2X6A A;  3ABL C;  4JTD B;  3JCU Z;  4JI4 O;  4B3T O;  3F7V C;  1NS1 A;  1SQQ H;  4I9Q A;  1MMM A;  2AHY A;  1DF4 A;  4DYL A;  1MSD A;  3R65 A;  2ZR3 A;  2XAS A;  2BTQ B;  2EIL C;  2IJK A;  4L87 A;  1YCI A;  3E83 A;  5B1N A;  4IYH A;  2XT9 A;  1VQP V;  1H2N A;  1SES A;  4B7K A;  2CTP A;  3HKC A;  2DN9 A;  4MT8 A;  2JS3 A;  1RPO A;  3OR7 C;  1UJW B;  1HWY A;  4FFK A;  2IW5 A;  3CRC A;  2JEX A;  4JYB A;  2YC0 A;  2OCH A;  1BE3 H;  1WP8 A;  4J7K A;  4OX9 O;  2Q5Z A;  4DK1 A;  5IJ0 A;  5IJ9 A;  4FLZ A;  5J2U A;  3DSQ A;  3RYC A;  4LF6 O;  2F43 G;  2FL4 A;  2P67 A;  4R7C A;  1JJ2 U;  2WAM A;  4DV5 O;  1NR7 A;  5H5N A;  1YTF D;  3P3N A;  2A3Q A;  1RSO B;  4CH3 A;  3K3W A;  4JYC A;  4B3S O;  1IZ3 A;  1NVP B;  1QNM A;  3HKB A;  3MD0 A;  4IHJ A;  2OWO A;  1ZLZ A;  3ETG A;  1YHQ V;  3OEH G;  3ZED A;  2ZQM A;  1IBL B;  3BPZ A;  4MTF A;  2R70 A;  2XAJ A;  2CTR A;  4JI1 B;  2ZDI A;  3JAK A;  2IJH A;  3AG1 C;  2LGW A;  1WB8 A;  2O57 A;  1AP5 A;  1GN2 A;  2B1I A;  1P84 F;  4DXW A;  3IGA C;  3CCQ V;  2AW9 A;  5KHJ A;  1AR1 B;  3UM7 A;  3CCU V;  4GT1 A;  2ZR2 A;  4MTG A;  2W6I G;  2OCC B;  2WLH A;  4QE7 A;  5JJN B;  3UKM A;  1H2M A;  2QWP B;  2UU9 B;  1JPX A;  1BT8 A;  1JFF A;  2XAG A;  2NN4 A;  2LW7 A;  1NU1 H;  4YJ3 A;  2YIB A;  2ZCE A;  1HR0 O;  5KHG A;  1N34 O;  3UO3 A;  4JTA B;  4GYC B;  2L35 A;  2WLL A;  3K9S A;  2ZXW C;  1Q43 A;  4DUZ O;  3CSX A;  3ETQ A;  1GRJ A;  1JOY A;  4U7O A;  1RFY A;  1XRE A;  2ZD9 A;  3VOU A;  2ZE5 A;  3E22 B;  3IFX A;  1L1F A;  5L3C A;  3ASO C;  2UUA B;  2A0L A;  5IYD O;  3E8F A;  1VQ7 V;  4YJ2 B;  3AG7 A;  4UV8 A;  1Y66 A;  4NKG B;  2B5U A;  3K0D A;  4PV1 B;  1KP2 A;  1Z5V A;  4C7U A;  3FAV A;  2QKS A;  5LP6 B;  3CXH F;  5B66 Z;  4LF7 O;  2HVK C;  2X0L A;  5BR8 B;  1QLE B;  5JH7 A;  2WLK A;  3BEH A;  2ATK C;  1K5S A;  4FLW A;  4YIP A;  1PP9 H;  4UXN A;  1IBK B;  2Z3Y A;  2A9H A;  2HJD A;  3OEE G;  3HKD B;  1ZWI C;  1XOU A;  2QWQ B;  1E79 G;  4K35 A;  4TUY A;  1J5E B;  3BA8 A;  4DR7 O;  4JAU A;  1MNG A;  5JQG B;  4X62 O;  5EYP B;  1R3K C;  4GKK B;  3AK2 A;  5FNV B;  1IDS A;  4XDK A;  1ENV A;  3FB5 C;  4J10 A;  5LGT A;  4JI2 O;  1GN6 A;  5LA6 A;  3ZRX A;  3FX7 A;  1OCC B;  2ODM A;  1OV9 A;  1QVF U;  5EBL C;  1XIL A;  3W7W A;  4X65 B;  4DW1 A;  1BHB A;  3SPG A;  4UCR A;  2DE0 X;  4PHZ A;  4LF5 B;  4JI0 O;  3AG4 B;  4WFH A;  1S77 D;  1H8H G;  1M9N A;  4KXR A;  3N2K B;  2D2C B;  2DMX A;  2AHZ A;  1R3L C;  2P90 A;  4LF8 O;  3D36 A;  4QNH B;  3BY6 A;  3ZHS A;  3RYF B;  1X59 A;  1SS3 A;  1PNM A;  1TVK B;  4UCU A;  1GH6 A;  3RBZ A;  4F6E A;  5J9P C;  4FLX A;  1IBM O;  4K0K O;  2KSD A;  4LNU A;  2Q6A A;  1Q90 D;  3OMN B;  4BIO A;  3ZMV A;  3OTF A;  5K1X A;  4AI8 A;  4B3R B;  4UFZ A;  4X64 B;  1F51 A;  4DV4 O;  1AJN A;  1N33 B;  1US6 A;  3WB1 A;  4YHH O;  4TV9 B;  1QU7 A;  3SJC C;  4DR6 B;  3VQW A;  4DRX B;  5LYJ A;  3OW2 U;  1OCZ C;  1YF2 A;  5GON B;  5JCO A;  3ZMU A;  2E5L B;  5EZY A;  1ZUQ A;  4P9O A;  4X66 O;  4D7T A;  1NVP D;  4HBN A;  3K5N A;  2HEP A;  4DR4 B;  1DK1 A;  4IL6 Z;  1GK9 A;  5KAI Z;  3Q4H B;  4W4K A;  4GCZ A;  2GTS A;  5EBW C;  2AZ0 A;  3ASN B;  3CPW U;  5LHG A;  4DV2 O;  1ORQ C;  1EZJ A;  2ZNI A; 
#chains in the Genus database with same CATH homology
 2JS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...