2JSDA

Solution structure of mmp20 complexed with nngh
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
160
structure length
160
Chain Sequence
GEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix metalloproteinase-20
publication title Catalytic domain of MMP20 (Enamelysin) - the NMR structure of a new matrix metalloproteinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 32
structure length 160
sequence length 160
ec nomenclature ec 3.4.24.-:
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2jsdA00
2WO9A 1CIZA 2RJQA 2CLTA 3TSKA 1WNIA 2JSDA 3P1VA 1QJIA 2XS3A 3HB2P 1ZTQA 1L6JA 1HFCA 2J0TA 1D5JA 1ZS0A 1HV5A 3EWJA 5BOTA 1KAPP 1DMTA 3LQBA 1YCMA 2OY2A 1ASTA 2OW2A 3P24A 2D1NA 3LQ0A 4H1QA 3DSLA 3ELMA 1XURA 1BKCE 4GWMA 5D1SA 2AIGP 1GKDA 3USNA 1R1IA 4GF1A 2CKIA 4I35A 5BPAA 4R3VA 1QJJA 4GR0A 4H30A 4PKQA 4FXQA 1XFXA 2A8HA 4H82A 2XS4A 3U1RA 2MLSA 3K7LA 3OHOA 2DDYA 1A85A 4JIJA 4WF6A 1Q3AA 2W0DA 1FLSA 4GQLA 5D7WA 1HTDA 4JA1A 2X3CA 3EHXA 1G4KA 1B3DA 1KUFA 1PWVA 3DPEA 4CTHA 1O0QA 2YB9A 3KHIA 3B2ZA 1K7IA 2L0RA 3LUMA 2OXUA 1A86A 3DL1A 830CA 1GE7A 1RM8A 3CKIA 5H8XA 1SATA 3UVCA 3HDBA 2OW9A 1OS2A 5I43A 5JMYA 4L6TA 2MLRA 3KECA 3Q2HA 1G9KA 2OZRA 4GR3A 4PKVA 1Y93A 1CGEA 1OMJA 1SLNA 1K7QA 2Y6DA 4PKUA 4J4MA 1SLMA 3LKAA 1MMQA 1QIAA 4PKWA 1I73A 1XFYA 3F18A 1IACA 1UMSA 3WV3A 1JAPA 5CUHA 1HOVA 5CXAA 4IJOA 4DF9A 4AIGA 1ROSA 1CK7A 1IABA 1BQOA 3HBVP 1SRPA 3RTSA 3ZUKA 3LK8A 3LIKA 2MZEA 3F1AA 1EUBA 4I03A 1AF0A 3KEKA 1MMRA 5D1TA 2OXZA 2WO8A 1BUDA 3G42A 1PWPA 1ZVXA 3DWBA 4FU4A 2O3EA 1GXDA 3WV2A 4PKRA 1CXVA 1SU3A 3LMCA 2X3AA 4GR8A 5D1UA 2X3BA 1G05A 2KRJA 3LE9A 1FBLA 3WV1A 1YOUA 5I12A 1MMPA 1IADA 1UTZA 4QKZA 1R55A 2DW0A 1O0TA 2E2DA 3LJGA 3LJTA 2W12A 1GE5A 1JK3A 1USNA 1IAAA 4HMAA 1PWQA 3TVCA 4ON1A 1MMBA 1ZP5A 3HY9A 1GO8P 3EDHA 3HYGA 1OM8A 1OM7A 1Y8JA 3G5CA 2FV9A 3OHLA 3EDGA 1IAGA 3L0TA 3EDIA 3TT4A 3B92A 3F19A 2JT6A 2QPJA 1R1JA 4AUOA 2JT5A 3SHIA 3VI1A 4A3WA 3VTGA 1XFUA 1EB6A 3ZXHA 3Q2GA 5BOYA 5I3MA 1JKYA 3BA0A 1G12A 4WKEA 4XM6A 3GBOA 2OI0A 1OS9A 2K9CA 1D7XA 2PJTA 2D1OA 1C8TA 2Y6CA 3K7NA 1XFWA 3ZVSA 3EHYA 2W13A 3F15A 1GKCA 1FM1A 1GE6A 1PWWA 1BIWA 1BZSA 2MZHA 4WZVA 4G0DA 4WKIA 4A7BA 4AXQA 3LGPA 3AYUA 5I0LA 1ZXVA 1QIBA 4EFSA 5L7FA 5LABA 3TS4A 3I7IA 2OVXA 3DPFA 1MNCA 1Y0VA 1D8MA 1XFVA 456CA 2J83A 1BQQM 1XUDA 4XBHA 1JH1A 1QUAA 4Q1LA 3I7GA 3KRYA 5B5PA 1J7NA 1B8YA 2SRTA 4GUYA 2AYKA 3N2UA 4H76A 1YP1A 2JNPA 2TCLA 1AYKA 1H71P 3LJZA 3KWVC 1BKCA 4DPEA 1AKLA 3O2XA 2USNA 1ZXCA 4DD8A 1JANA 2OW0A 3KEJA 1UTTA 1UMTA 1G49A 2O36A 3NX7A 4GWNA 2DW2A 4XCTA 5B5OA 3DNGA 4FXYP 3F17A 4FVLA 2E3XA 4WK7A 1IAEA 1GO7P 1RMZA 2V4BA 1R54A 1D8FA 5D3CA 2W15A 1KUHA 1CQRA 2FV5A 3KMCA 3LUNA 5I2ZA 1K7GA 4JPAA 2W14A 4XM7A 4XM8A 1HFSA 2OW1A 1KUIA 2YIGA 1JJ9A 1XUCA 4ZR5A 2DW1A 1PWUA 4H49A 4L63A 3L0VA 2OXWA 1KUKA 3EDZA 3B8ZA 1BM6A 5CZMA 1QICA 1CGFA 2ERQA 1I1IP 1CGLA 1SMPA 2POJA 4L19A 4JQGA 1C3IA 4G9LA 4HX3A 3HDAP 1Z3JA 2Z2DA 4PKTA 4IUWA 3N2VA 3O64A 1OO9A 2OVZA 3HBUP 2JIHA 3KMEA 5I4OA 966CA 1JIZA 1I76A 1ATLA 2N8RA 4IN9A 1OM6A 3AYKA 5L79A 1BUVM 1JIWP 1ND1A 3MA2A 3AIGA 1BKCI 2DDFA 2I47A 1HY7A 4ILWD 2HU6A 4DV8A 2K2GA 2EROA 3LILA 3E8RA 4H2EA 4AYKA 1DTHA 4H3XA 2WOAA 1UEAA 1KUGA 1C7KA 1KBCA 1JAOA 1R1HA 2RJPA 4H84A 2X7MA 2ERPA 4JP4A 1YQYA 3V96B 4PKSA 1BSWA 3RTTA 3F16A 1JAQA 1EAKA 3LIRA 1CAQA 3HY7A 5D2BA 2MZIA 3LEAA 2OY4A 1S4BP 1XFZA
chains in the Genus database with same CATH superfamily
2WO9A 1CIZA 2RJQA 2CLTA 3TSKA 1WNIA 2JSDA 3P1VA 1QJIA 2XS3A 3HB2P 1ZTQA 1L6JA 1HFCA 2J0TA 1D5JA 1ZS0A 1HV5A 3EWJA 5BOTA 1KAPP 1DMTA 3LQBA 1YCMA 2OY2A 1ASTA 2OW2A 3P24A 2D1NA 3LQ0A 4H1QA 3DSLA 3ELMA 1XURA 1BKCE 4GWMA 5D1SA 2AIGP 1GKDA 3USNA 1R1IA 4GF1A 2CKIA 4I35A 5BPAA 4R3VA 1QJJA 1XM5A 4GR0A 4H30A 4PKQA 4FXQA 1XFXA 2A8HA 4H82A 2XS4A 3U1RA 2MLSA 3K7LA 3OHOA 2DDYA 1A85A 4JIJA 4WF6A 1Q3AA 2W0DA 1FLSA 4GQLA 5D7WA 1HTDA 4JA1A 2X3CA 3EHXA 1G4KA 1B3DA 1KUFA 1PWVA 3DPEA 4CTHA 3DTKA 1O0QA 2YB9A 3KHIA 3B2ZA 1K7IA 2L0RA 3LUMA 2OXUA 1A86A 3DL1A 830CA 1GE7A 1RM8A 3CKIA 5H8XA 1SATA 3UVCA 3HDBA 2OW9A 1OS2A 5I43A 5JMYA 4L6TA 2MLRA 3KECA 3Q2HA 1G9KA 2OZRA 4GR3A 4PKVA 1Y93A 1CGEA 1OMJA 1SLNA 1K7QA 2Y6DA 4PKUA 4J4MA 1SLMA 3LKAA 1MMQA 1QIAA 4PKWA 1I73A 1XFYA 3F18A 1IACA 1UMSA 3WV3A 1JAPA 5CUHA 1HOVA 5CXAA 4IJOA 4DF9A 4AIGA 1ROSA 1CK7A 1IABA 1BQOA 3HBVP 1SRPA 3RTSA 3ZUKA 3LK8A 3LIKA 2MZEA 3F1AA 1EUBA 4I03A 1AF0A 3KEKA 1MMRA 5D1TA 2OXZA 2WO8A 1BUDA 3G42A 1PWPA 1ZVXA 3DWBA 4FU4A 2O3EA 1GXDA 3WV2A 4PKRA 1CXVA 1SU3A 3LMCA 2X3AA 4GR8A 5D1UA 2X3BA 1G05A 2KRJA 3LE9A 1FBLA 3WV1A 1YOUA 5I12A 1MMPA 1IADA 1UTZA 4QKZA 1R55A 2DW0A 1O0TA 2E2DA 3LJGA 3LJTA 2W12A 1GE5A 1JK3A 1USNA 1IAAA 4HMAA 1PWQA 3TVCA 1TVIA 4ON1A 1MMBA 1ZP5A 3HY9A 1GO8P 3EDHA 3HYGA 1OM8A 1OM7A 1Y8JA 3G5CA 2FV9A 3OHLA 3EDGA 1IAGA 3L0TA 3EDIA 3TT4A 3B92A 3F19A 2JT6A 2QPJA 1R1JA 4L7AA 4AUOA 2JT5A 3SHIA 3VI1A 4A3WA 3VTGA 1XFUA 1EB6A 3ZXHA 3Q2GA 5BOYA 5I3MA 1JKYA 3BA0A 1G12A 4WKEA 4XM6A 3GBOA 2OI0A 1OS9A 2K9CA 1D7XA 2PJTA 2D1OA 1C8TA 2Y6CA 3K7NA 1XFWA 3ZVSA 3EHYA 1OZ9A 2W13A 3F15A 1GKCA 1FM1A 1GE6A 1PWWA 1BIWA 1BZSA 2MZHA 4WZVA 4G0DA 4WKIA 4A7BA 4AXQA 3LGPA 3AYUA 5I0LA 1ZXVA 1QIBA 4EFSA 5L7FA 5LABA 3TS4A 3I7IA 2OVXA 3DPFA 1MNCA 1Y0VA 1D8MA 1XFVA 456CA 2J83A 1BQQM 1XUDA 4XBHA 1JH1A 1QUAA 4Q1LA 3I7GA 3KRYA 5B5PA 1J7NA 1B8YA 3DTEA 2SRTA 4GUYA 2AYKA 3N2UA 4H76A 1YP1A 2JNPA 2TCLA 1AYKA 1H71P 3LJZA 3KWVC 1BKCA 4DPEA 1AKLA 3O2XA 2USNA 1ZXCA 4DD8A 1JANA 2OW0A 3KEJA 1UTTA 1UMTA 1G49A 2O36A 3NX7A 4GWNA 2DW2A 4XCTA 5B5OA 3DNGA 2YUFA 4FXYP 3F17A 4FVLA 2E3XA 4WK7A 1IAEA 1GO7P 1RMZA 2V4BA 1R54A 1D8FA 5D3CA 2W15A 1KUHA 1CQRA 2FV5A 3KMCA 3LUNA 5I2ZA 1K7GA 4JPAA 2W14A 4XM7A 4XM8A 1HFSA 2OW1A 1KUIA 2YIGA 1JJ9A 1XUCA 4ZR5A 2DW1A 1PWUA 4H49A 4L63A 3DTIA 3L0VA 2OXWA 1KUKA 3EDZA 3B8ZA 1BM6A 5CZMA 1QICA 1CGFA 2ERQA 1I1IP 1CGLA 1SMPA 2POJA 4L19A 4JQGA 1C3IA 4G9LA 4HX3A 3HDAP 1Z3JA 2Z2DA 4PKTA 4IUWA 3N2VA 3O64A 1OO9A 2OVZA 3HBUP 2JIHA 3KMEA 5I4OA 966CA 1JIZA 1I76A 1ATLA 2N8RA 4IN9A 1OM6A 3AYKA 5L79A 1BUVM 1JIWP 1ND1A 3MA2A 3AIGA 1BKCI 2DDFA 2I47A 1HY7A 4ILWD 2HU6A 4DV8A 2K2GA 2EROA 3LILA 3E8RA 4H2EA 4AYKA 1DTHA 4H3XA 2WOAA 1UEAA 1KUGA 1C7KA 1KBCA 1JAOA 1R1HA 2RJPA 4H84A 2X7MA 2ERPA 4JP4A 1YQYA 3V96B 1XAXA 4PKSA 1BSWA 3RTTA 3F16A 1JAQA 1EAKA 3LIRA 1CAQA 3HY7A 5D2BA 2MZIA 3LEAA 2OY4A 1S4BP 1XFZA
chains in the Genus database with same CATH topology
2WO9A 1CIZA 2RJQA 2CLTA 3TSKA 1WNIA 2JSDA 3P1VA 1QJIA 2XS3A 3HB2P 1ZTQA 1L6JA 1HFCA 2J0TA 1D5JA 1ZS0A 1HV5A 3EWJA 5BOTA 1KAPP 1DMTA 3LQBA 1YCMA 2OY2A 1ASTA 2OW2A 3P24A 2D1NA 3LQ0A 4H1QA 3DSLA 3ELMA 1XURA 1BKCE 4GWMA 5D1SA 2AIGP 1GKDA 3USNA 1R1IA 4GF1A 2CKIA 4I35A 5BPAA 4R3VA 1QJJA 4GR0A 4H30A 4PKQA 4FXQA 1XFXA 2A8HA 4H82A 2XS4A 3U1RA 2MLSA 3K7LA 3OHOA 2DDYA 1A85A 4JIJA 4WF6A 1Q3AA 2W0DA 1FLSA 4GQLA 5D7WA 1HTDA 4JA1A 2X3CA 3EHXA 1G4KA 1B3DA 1KUFA 1PWVA 3DPEA 4CTHA 3DTKA 1O0QA 2YB9A 3KHIA 3B2ZA 1K7IA 2L0RA 3LUMA 2OXUA 1A86A 3DL1A 830CA 1GE7A 1RM8A 3CKIA 5H8XA 1SATA 3UVCA 3HDBA 2OW9A 1OS2A 5I43A 5JMYA 4L6TA 2MLRA 3KECA 3Q2HA 1G9KA 2OZRA 4GR3A 4PKVA 1Y93A 1CGEA 1OMJA 1SLNA 1K7QA 2Y6DA 4PKUA 4J4MA 1SLMA 3LKAA 1MMQA 1QIAA 4PKWA 1I73A 1XFYA 3F18A 1IACA 1UMSA 3WV3A 1JAPA 5CUHA 1HOVA 5CXAA 4IJOA 4DF9A 4AIGA 1ROSA 1CK7A 1IABA 1BQOA 3HBVP 1SRPA 3RTSA 3ZUKA 3LK8A 3LIKA 2MZEA 3F1AA 1EUBA 4I03A 1AF0A 3KEKA 1MMRA 5D1TA 2OXZA 2WO8A 1BUDA 3G42A 1PWPA 1ZVXA 3DWBA 4FU4A 2O3EA 1GXDA 3WV2A 4PKRA 1CXVA 1SU3A 3LMCA 2X3AA 4GR8A 5D1UA 2X3BA 1G05A 2KRJA 3LE9A 1FBLA 3WV1A 1YOUA 5I12A 1MMPA 1IADA 1UTZA 4QKZA 1R55A 2DW0A 1O0TA 2E2DA 3LJGA 3LJTA 2W12A 1GE5A 1JK3A 1USNA 1IAAA 4HMAA 1PWQA 3TVCA 4ON1A 1MMBA 1ZP5A 3HY9A 1GO8P 3EDHA 3HYGA 1OM8A 1OM7A 1Y8JA 3G5CA 2FV9A 3OHLA 3EDGA 1IAGA 3L0TA 3EDIA 3TT4A 3B92A 3F19A 2JT6A 2QPJA 1R1JA 4L7AA 4AUOA 2JT5A 3SHIA 3VI1A 4A3WA 3VTGA 1XFUA 1EB6A 3ZXHA 3Q2GA 5BOYA 5I3MA 1JKYA 3BA0A 1G12A 4WKEA 4XM6A 3GBOA 2OI0A 1OS9A 2K9CA 1D7XA 2PJTA 2D1OA 1C8TA 2Y6CA 3K7NA 1XFWA 3ZVSA 3EHYA 2W13A 3F15A 1GKCA 1FM1A 1GE6A 1PWWA 1BIWA 1BZSA 2MZHA 4WZVA 4G0DA 4WKIA 4A7BA 4AXQA 3LGPA 3AYUA 5I0LA 1ZXVA 1QIBA 4EFSA 5L7FA 5LABA 3TS4A 3I7IA 2OVXA 3DPFA 1MNCA 1Y0VA 1D8MA 1XFVA 456CA 2J83A 1BQQM 1XUDA 4XBHA 1JH1A 1QUAA 4Q1LA 3I7GA 3KRYA 5B5PA 1J7NA 1B8YA 3DTEA 2SRTA 4GUYA 2AYKA 3N2UA 4H76A 1YP1A 2JNPA 2TCLA 1AYKA 1H71P 3LJZA 3KWVC 1BKCA 4DPEA 1AKLA 3O2XA 2USNA 1ZXCA 4DD8A 1JANA 2OW0A 3KEJA 1UTTA 1UMTA 1G49A 2O36A 3NX7A 4GWNA 2DW2A 4XCTA 5B5OA 3DNGA 2YUFA 4FXYP 3F17A 4FVLA 2E3XA 4WK7A 1IAEA 1GO7P 1RMZA 2V4BA 1R54A 1D8FA 5D3CA 2W15A 1KUHA 1CQRA 2FV5A 3KMCA 3LUNA 5I2ZA 1K7GA 4JPAA 2W14A 4XM7A 4XM8A 1HFSA 2OW1A 1KUIA 2YIGA 1JJ9A 1XUCA 4ZR5A 2DW1A 1PWUA 4H49A 4L63A 3DTIA 3L0VA 2OXWA 1KUKA 3EDZA 3B8ZA 1BM6A 5CZMA 1QICA 1CGFA 2ERQA 1I1IP 1CGLA 1SMPA 2POJA 4L19A 4JQGA 1C3IA 4G9LA 4HX3A 3HDAP 1Z3JA 2Z2DA 4PKTA 4IUWA 3N2VA 3O64A 1OO9A 2OVZA 3HBUP 2JIHA 3KMEA 5I4OA 966CA 1JIZA 1I76A 1ATLA 2N8RA 4IN9A 1OM6A 3AYKA 5L79A 1BUVM 1JIWP 1ND1A 3MA2A 3AIGA 1BKCI 2DDFA 2I47A 1HY7A 4ILWD 2HU6A 4DV8A 2K2GA 2EROA 3LILA 3E8RA 4H2EA 4AYKA 1DTHA 4H3XA 2WOAA 1UEAA 1KUGA 1C7KA 1KBCA 1JAOA 1R1HA 2RJPA 4H84A 2X7MA 2ERPA 4JP4A 1YQYA 3V96B 4PKSA 1BSWA 3RTTA 3F16A 1JAQA 1EAKA 3LIRA 1CAQA 3HY7A 5D2BA 2MZIA 3LEAA 2OY4A 1S4BP 1XFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WO9 A;  1CIZ A;  2RJQ A;  2CLT A;  3TSK A;  1WNI A;  2JSD A;  3P1V A;  1QJI A;  2XS3 A;  3HB2 P;  1ZTQ A;  1L6J A;  1HFC A;  2J0T A;  1D5J A;  1ZS0 A;  1HV5 A;  3EWJ A;  5BOT A;  1KAP P;  1DMT A;  3LQB A;  1YCM A;  2OY2 A;  1AST A;  2OW2 A;  3P24 A;  2D1N A;  3LQ0 A;  4H1Q A;  3DSL A;  3ELM A;  1XUR A;  1BKC E;  4GWM A;  5D1S A;  2AIG P;  1GKD A;  3USN A;  1R1I A;  4GF1 A;  2CKI A;  4I35 A;  5BPA A;  4R3V A;  1QJJ A;  4GR0 A;  4H30 A;  4PKQ A;  4FXQ A;  1XFX A;  2A8H A;  4H82 A;  2XS4 A;  3U1R A;  2MLS A;  3K7L A;  3OHO A;  2DDY A;  1A85 A;  4JIJ A;  4WF6 A;  1Q3A A;  2W0D A;  1FLS A;  4GQL A;  5D7W A;  1HTD A;  4JA1 A;  2X3C A;  3EHX A;  1G4K A;  1B3D A;  1KUF A;  1PWV A;  3DPE A;  4CTH A;  1O0Q A;  2YB9 A;  3KHI A;  3B2Z A;  1K7I A;  2L0R A;  3LUM A;  2OXU A;  1A86 A;  3DL1 A;  830C A;  1GE7 A;  1RM8 A;  3CKI A;  5H8X A;  1SAT A;  3UVC A;  3HDB A;  2OW9 A;  1OS2 A;  5I43 A;  5JMY A;  4L6T A;  2MLR A;  3KEC A;  3Q2H A;  1G9K A;  2OZR A;  4GR3 A;  4PKV A;  1Y93 A;  1CGE A;  1OMJ A;  1SLN A;  1K7Q A;  2Y6D A;  4PKU A;  4J4M A;  1SLM A;  3LKA A;  1MMQ A;  1QIA A;  4PKW A;  1I73 A;  1XFY A;  3F18 A;  1IAC A;  1UMS A;  3WV3 A;  1JAP A;  5CUH A;  1HOV A;  5CXA A;  4IJO A;  4DF9 A;  4AIG A;  1ROS A;  1CK7 A;  1IAB A;  1BQO A;  3HBV P;  1SRP A;  3RTS A;  3ZUK A;  3LK8 A;  3LIK A;  2MZE A;  3F1A A;  1EUB A;  4I03 A;  1AF0 A;  3KEK A;  1MMR A;  5D1T A;  2OXZ A;  2WO8 A;  1BUD A;  3G42 A;  1PWP A;  1ZVX A;  3DWB A;  4FU4 A;  2O3E A;  1GXD A;  3WV2 A;  4PKR A;  1CXV A;  1SU3 A;  3LMC A;  2X3A A;  4GR8 A;  5D1U A;  2X3B A;  1G05 A;  2KRJ A;  3LE9 A;  1FBL A;  3WV1 A;  1YOU A;  5I12 A;  1MMP A;  1IAD A;  1UTZ A;  4QKZ A;  1R55 A;  2DW0 A;  1O0T A;  2E2D A;  3LJG A;  3LJT A;  2W12 A;  1GE5 A;  1JK3 A;  1USN A;  1IAA A;  4HMA A;  1PWQ A;  3TVC A;  4ON1 A;  1MMB A;  1ZP5 A;  3HY9 A;  1GO8 P;  3EDH A;  3HYG A;  1OM8 A;  1OM7 A;  1Y8J A;  3G5C A;  2FV9 A;  3OHL A;  3EDG A;  1IAG A;  3L0T A;  3EDI A;  3TT4 A;  3B92 A;  3F19 A;  2JT6 A;  2QPJ A;  1R1J A;  4AUO A;  2JT5 A;  3SHI A;  3VI1 A;  4A3W A;  3VTG A;  1XFU A;  1EB6 A;  3ZXH A;  3Q2G A;  5BOY A;  5I3M A;  1JKY A;  3BA0 A;  1G12 A;  4WKE A;  4XM6 A;  3GBO A;  2OI0 A;  1OS9 A;  2K9C A;  1D7X A;  2PJT A;  2D1O A;  1C8T A;  2Y6C A;  3K7N A;  1XFW A;  3ZVS A;  3EHY A;  2W13 A;  3F15 A;  1GKC A;  1FM1 A;  1GE6 A;  1PWW A;  1BIW A;  1BZS A;  2MZH A;  4WZV A;  4G0D A;  4WKI A;  4A7B A;  4AXQ A;  3LGP A;  3AYU A;  5I0L A;  1ZXV A;  1QIB A;  4EFS A;  5L7F A;  5LAB A;  3TS4 A;  3I7I A;  2OVX A;  3DPF A;  1MNC A;  1Y0V A;  1D8M A;  1XFV A;  456C A;  2J83 A;  1BQQ M;  1XUD A;  4XBH A;  1JH1 A;  1QUA A;  4Q1L A;  3I7G A;  3KRY A;  5B5P A;  1J7N A;  1B8Y A;  2SRT A;  4GUY A;  2AYK A;  3N2U A;  4H76 A;  1YP1 A;  2JNP A;  2TCL A;  1AYK A;  1H71 P;  3LJZ A;  3KWV C;  1BKC A;  4DPE A;  1AKL A;  3O2X A;  2USN A;  1ZXC A;  4DD8 A;  1JAN A;  2OW0 A;  3KEJ A;  1UTT A;  1UMT A;  1G49 A;  2O36 A;  3NX7 A;  4GWN A;  2DW2 A;  4XCT A;  5B5O A;  3DNG A;  4FXY P;  3F17 A;  4FVL A;  2E3X A;  4WK7 A;  1IAE A;  1GO7 P;  1RMZ A;  2V4B A;  1R54 A;  1D8F A;  5D3C A;  2W15 A;  1KUH A;  1CQR A;  2FV5 A;  3KMC A;  3LUN A;  5I2Z A;  1K7G A;  4JPA A;  2W14 A;  4XM7 A;  4XM8 A;  1HFS A;  2OW1 A;  1KUI A;  2YIG A;  1JJ9 A;  1XUC A;  4ZR5 A;  2DW1 A;  1PWU A;  4H49 A;  4L63 A;  3L0V A;  2OXW A;  1KUK A;  3EDZ A;  3B8Z A;  1BM6 A;  5CZM A;  1QIC A;  1CGF A;  2ERQ A;  1I1I P;  1CGL A;  1SMP A;  2POJ A;  4L19 A;  4JQG A;  1C3I A;  4G9L A;  4HX3 A;  3HDA P;  1Z3J A;  2Z2D A;  4PKT A;  4IUW A;  3N2V A;  3O64 A;  1OO9 A;  2OVZ A;  3HBU P;  2JIH A;  3KME A;  5I4O A;  966C A;  1JIZ A;  1I76 A;  1ATL A;  2N8R A;  4IN9 A;  1OM6 A;  3AYK A;  5L79 A;  1BUV M;  1JIW P;  1ND1 A;  3MA2 A;  3AIG A;  1BKC I;  2DDF A;  2I47 A;  1HY7 A;  4ILW D;  2HU6 A;  4DV8 A;  2K2G A;  2ERO A;  3LIL A;  3E8R A;  4H2E A;  4AYK A;  1DTH A;  4H3X A;  2WOA A;  1UEA A;  1KUG A;  1C7K A;  1KBC A;  1JAO A;  1R1H A;  2RJP A;  4H84 A;  2X7M A;  2ERP A;  4JP4 A;  1YQY A;  3V96 B;  4PKS A;  1BSW A;  3RTT A;  3F16 A;  1JAQ A;  1EAK A;  3LIR A;  1CAQ A;  3HY7 A;  5D2B A;  2MZI A;  3LEA A;  2OY4 A;  1S4B P;  1XFZ A; 
#chains in the Genus database with same CATH topology
 2WO9 A;  1CIZ A;  2RJQ A;  2CLT A;  3TSK A;  1WNI A;  2JSD A;  3P1V A;  1QJI A;  2XS3 A;  3HB2 P;  1ZTQ A;  1L6J A;  1HFC A;  2J0T A;  1D5J A;  1ZS0 A;  1HV5 A;  3EWJ A;  5BOT A;  1KAP P;  1DMT A;  3LQB A;  1YCM A;  2OY2 A;  1AST A;  2OW2 A;  3P24 A;  2D1N A;  3LQ0 A;  4H1Q A;  3DSL A;  3ELM A;  1XUR A;  1BKC E;  4GWM A;  5D1S A;  2AIG P;  1GKD A;  3USN A;  1R1I A;  4GF1 A;  2CKI A;  4I35 A;  5BPA A;  4R3V A;  1QJJ A;  1XM5 A;  4GR0 A;  4H30 A;  4PKQ A;  4FXQ A;  1XFX A;  2A8H A;  4H82 A;  2XS4 A;  3U1R A;  2MLS A;  3K7L A;  3OHO A;  2DDY A;  1A85 A;  4JIJ A;  4WF6 A;  1Q3A A;  2W0D A;  1FLS A;  4GQL A;  5D7W A;  1HTD A;  4JA1 A;  2X3C A;  3EHX A;  1G4K A;  1B3D A;  1KUF A;  1PWV A;  3DPE A;  4CTH A;  3DTK A;  1O0Q A;  2YB9 A;  3KHI A;  3B2Z A;  1K7I A;  2L0R A;  3LUM A;  2OXU A;  1A86 A;  3DL1 A;  830C A;  1GE7 A;  1RM8 A;  3CKI A;  5H8X A;  1SAT A;  3UVC A;  3HDB A;  2OW9 A;  1OS2 A;  5I43 A;  5JMY A;  4L6T A;  2MLR A;  3KEC A;  3Q2H A;  1G9K A;  2OZR A;  4GR3 A;  4PKV A;  1Y93 A;  1CGE A;  1OMJ A;  1SLN A;  1K7Q A;  2Y6D A;  4PKU A;  4J4M A;  1SLM A;  3LKA A;  1MMQ A;  1QIA A;  4PKW A;  1I73 A;  1XFY A;  3F18 A;  1IAC A;  1UMS A;  3WV3 A;  1JAP A;  5CUH A;  1HOV A;  5CXA A;  4IJO A;  4DF9 A;  4AIG A;  1ROS A;  1CK7 A;  1IAB A;  1BQO A;  3HBV P;  1SRP A;  3RTS A;  3ZUK A;  3LK8 A;  3LIK A;  2MZE A;  3F1A A;  1EUB A;  4I03 A;  1AF0 A;  3KEK A;  1MMR A;  5D1T A;  2OXZ A;  2WO8 A;  1BUD A;  3G42 A;  1PWP A;  1ZVX A;  3DWB A;  4FU4 A;  2O3E A;  1GXD A;  3WV2 A;  4PKR A;  1CXV A;  1SU3 A;  3LMC A;  2X3A A;  4GR8 A;  5D1U A;  2X3B A;  1G05 A;  2KRJ A;  3LE9 A;  1FBL A;  3WV1 A;  1YOU A;  5I12 A;  1MMP A;  1IAD A;  1UTZ A;  4QKZ A;  1R55 A;  2DW0 A;  1O0T A;  2E2D A;  3LJG A;  3LJT A;  2W12 A;  1GE5 A;  1JK3 A;  1USN A;  1IAA A;  4HMA A;  1PWQ A;  3TVC A;  1TVI A;  4ON1 A;  1MMB A;  1ZP5 A;  3HY9 A;  1GO8 P;  3EDH A;  3HYG A;  1OM8 A;  1OM7 A;  1Y8J A;  3G5C A;  2FV9 A;  3OHL A;  3EDG A;  1IAG A;  3L0T A;  3EDI A;  3TT4 A;  3B92 A;  3F19 A;  2JT6 A;  2QPJ A;  1R1J A;  4L7A A;  4AUO A;  2JT5 A;  3SHI A;  3VI1 A;  4A3W A;  3VTG A;  1XFU A;  1EB6 A;  3ZXH A;  3Q2G A;  5BOY A;  5I3M A;  1JKY A;  3BA0 A;  1G12 A;  4WKE A;  4XM6 A;  3GBO A;  2OI0 A;  1OS9 A;  2K9C A;  1D7X A;  2PJT A;  2D1O A;  1C8T A;  2Y6C A;  3K7N A;  1XFW A;  3ZVS A;  3EHY A;  1OZ9 A;  2W13 A;  3F15 A;  1GKC A;  1FM1 A;  1GE6 A;  1PWW A;  1BIW A;  1BZS A;  2MZH A;  4WZV A;  4G0D A;  4WKI A;  4A7B A;  4AXQ A;  3LGP A;  3AYU A;  5I0L A;  1ZXV A;  1QIB A;  4EFS A;  5L7F A;  5LAB A;  3TS4 A;  3I7I A;  2OVX A;  3DPF A;  1MNC A;  1Y0V A;  1D8M A;  1XFV A;  456C A;  2J83 A;  1BQQ M;  1XUD A;  4XBH A;  1JH1 A;  1QUA A;  4Q1L A;  3I7G A;  3KRY A;  5B5P A;  1J7N A;  1B8Y A;  3DTE A;  2SRT A;  4GUY A;  2AYK A;  3N2U A;  4H76 A;  1YP1 A;  2JNP A;  2TCL A;  1AYK A;  1H71 P;  3LJZ A;  3KWV C;  1BKC A;  4DPE A;  1AKL A;  3O2X A;  2USN A;  1ZXC A;  4DD8 A;  1JAN A;  2OW0 A;  3KEJ A;  1UTT A;  1UMT A;  1G49 A;  2O36 A;  3NX7 A;  4GWN A;  2DW2 A;  4XCT A;  5B5O A;  3DNG A;  2YUF A;  4FXY P;  3F17 A;  4FVL A;  2E3X A;  4WK7 A;  1IAE A;  1GO7 P;  1RMZ A;  2V4B A;  1R54 A;  1D8F A;  5D3C A;  2W15 A;  1KUH A;  1CQR A;  2FV5 A;  3KMC A;  3LUN A;  5I2Z A;  1K7G A;  4JPA A;  2W14 A;  4XM7 A;  4XM8 A;  1HFS A;  2OW1 A;  1KUI A;  2YIG A;  1JJ9 A;  1XUC A;  4ZR5 A;  2DW1 A;  1PWU A;  4H49 A;  4L63 A;  3DTI A;  3L0V A;  2OXW A;  1KUK A;  3EDZ A;  3B8Z A;  1BM6 A;  5CZM A;  1QIC A;  1CGF A;  2ERQ A;  1I1I P;  1CGL A;  1SMP A;  2POJ A;  4L19 A;  4JQG A;  1C3I A;  4G9L A;  4HX3 A;  3HDA P;  1Z3J A;  2Z2D A;  4PKT A;  4IUW A;  3N2V A;  3O64 A;  1OO9 A;  2OVZ A;  3HBU P;  2JIH A;  3KME A;  5I4O A;  966C A;  1JIZ A;  1I76 A;  1ATL A;  2N8R A;  4IN9 A;  1OM6 A;  3AYK A;  5L79 A;  1BUV M;  1JIW P;  1ND1 A;  3MA2 A;  3AIG A;  1BKC I;  2DDF A;  2I47 A;  1HY7 A;  4ILW D;  2HU6 A;  4DV8 A;  2K2G A;  2ERO A;  3LIL A;  3E8R A;  4H2E A;  4AYK A;  1DTH A;  4H3X A;  2WOA A;  1UEA A;  1KUG A;  1C7K A;  1KBC A;  1JAO A;  1R1H A;  2RJP A;  4H84 A;  2X7M A;  2ERP A;  4JP4 A;  1YQY A;  3V96 B;  1XAX A;  4PKS A;  1BSW A;  3RTT A;  3F16 A;  1JAQ A;  1EAK A;  3LIR A;  1CAQ A;  3HY7 A;  5D2B A;  2MZI A;  3LEA A;  2OY4 A;  1S4B P;  1XFZ A; 
#chains in the Genus database with same CATH homology
 2WO9 A;  1CIZ A;  2RJQ A;  2CLT A;  3TSK A;  1WNI A;  2JSD A;  3P1V A;  1QJI A;  2XS3 A;  3HB2 P;  1ZTQ A;  1L6J A;  1HFC A;  2J0T A;  1D5J A;  1ZS0 A;  1HV5 A;  3EWJ A;  5BOT A;  1KAP P;  1DMT A;  3LQB A;  1YCM A;  2OY2 A;  1AST A;  2OW2 A;  3P24 A;  2D1N A;  3LQ0 A;  4H1Q A;  3DSL A;  3ELM A;  1XUR A;  1BKC E;  4GWM A;  5D1S A;  2AIG P;  1GKD A;  3USN A;  1R1I A;  4GF1 A;  2CKI A;  4I35 A;  5BPA A;  4R3V A;  1QJJ A;  4GR0 A;  4H30 A;  4PKQ A;  4FXQ A;  1XFX A;  2A8H A;  4H82 A;  2XS4 A;  3U1R A;  2MLS A;  3K7L A;  3OHO A;  2DDY A;  1A85 A;  4JIJ A;  4WF6 A;  1Q3A A;  2W0D A;  1FLS A;  4GQL A;  5D7W A;  1HTD A;  4JA1 A;  2X3C A;  3EHX A;  1G4K A;  1B3D A;  1KUF A;  1PWV A;  3DPE A;  4CTH A;  3DTK A;  1O0Q A;  2YB9 A;  3KHI A;  3B2Z A;  1K7I A;  2L0R A;  3LUM A;  2OXU A;  1A86 A;  3DL1 A;  830C A;  1GE7 A;  1RM8 A;  3CKI A;  5H8X A;  1SAT A;  3UVC A;  3HDB A;  2OW9 A;  1OS2 A;  5I43 A;  5JMY A;  4L6T A;  2MLR A;  3KEC A;  3Q2H A;  1G9K A;  2OZR A;  4GR3 A;  4PKV A;  1Y93 A;  1CGE A;  1OMJ A;  1SLN A;  1K7Q A;  2Y6D A;  4PKU A;  4J4M A;  1SLM A;  3LKA A;  1MMQ A;  1QIA A;  4PKW A;  1I73 A;  1XFY A;  3F18 A;  1IAC A;  1UMS A;  3WV3 A;  1JAP A;  5CUH A;  1HOV A;  5CXA A;  4IJO A;  4DF9 A;  4AIG A;  1ROS A;  1CK7 A;  1IAB A;  1BQO A;  3HBV P;  1SRP A;  3RTS A;  3ZUK A;  3LK8 A;  3LIK A;  2MZE A;  3F1A A;  1EUB A;  4I03 A;  1AF0 A;  3KEK A;  1MMR A;  5D1T A;  2OXZ A;  2WO8 A;  1BUD A;  3G42 A;  1PWP A;  1ZVX A;  3DWB A;  4FU4 A;  2O3E A;  1GXD A;  3WV2 A;  4PKR A;  1CXV A;  1SU3 A;  3LMC A;  2X3A A;  4GR8 A;  5D1U A;  2X3B A;  1G05 A;  2KRJ A;  3LE9 A;  1FBL A;  3WV1 A;  1YOU A;  5I12 A;  1MMP A;  1IAD A;  1UTZ A;  4QKZ A;  1R55 A;  2DW0 A;  1O0T A;  2E2D A;  3LJG A;  3LJT A;  2W12 A;  1GE5 A;  1JK3 A;  1USN A;  1IAA A;  4HMA A;  1PWQ A;  3TVC A;  4ON1 A;  1MMB A;  1ZP5 A;  3HY9 A;  1GO8 P;  3EDH A;  3HYG A;  1OM8 A;  1OM7 A;  1Y8J A;  3G5C A;  2FV9 A;  3OHL A;  3EDG A;  1IAG A;  3L0T A;  3EDI A;  3TT4 A;  3B92 A;  3F19 A;  2JT6 A;  2QPJ A;  1R1J A;  4L7A A;  4AUO A;  2JT5 A;  3SHI A;  3VI1 A;  4A3W A;  3VTG A;  1XFU A;  1EB6 A;  3ZXH A;  3Q2G A;  5BOY A;  5I3M A;  1JKY A;  3BA0 A;  1G12 A;  4WKE A;  4XM6 A;  3GBO A;  2OI0 A;  1OS9 A;  2K9C A;  1D7X A;  2PJT A;  2D1O A;  1C8T A;  2Y6C A;  3K7N A;  1XFW A;  3ZVS A;  3EHY A;  2W13 A;  3F15 A;  1GKC A;  1FM1 A;  1GE6 A;  1PWW A;  1BIW A;  1BZS A;  2MZH A;  4WZV A;  4G0D A;  4WKI A;  4A7B A;  4AXQ A;  3LGP A;  3AYU A;  5I0L A;  1ZXV A;  1QIB A;  4EFS A;  5L7F A;  5LAB A;  3TS4 A;  3I7I A;  2OVX A;  3DPF A;  1MNC A;  1Y0V A;  1D8M A;  1XFV A;  456C A;  2J83 A;  1BQQ M;  1XUD A;  4XBH A;  1JH1 A;  1QUA A;  4Q1L A;  3I7G A;  3KRY A;  5B5P A;  1J7N A;  1B8Y A;  3DTE A;  2SRT A;  4GUY A;  2AYK A;  3N2U A;  4H76 A;  1YP1 A;  2JNP A;  2TCL A;  1AYK A;  1H71 P;  3LJZ A;  3KWV C;  1BKC A;  4DPE A;  1AKL A;  3O2X A;  2USN A;  1ZXC A;  4DD8 A;  1JAN A;  2OW0 A;  3KEJ A;  1UTT A;  1UMT A;  1G49 A;  2O36 A;  3NX7 A;  4GWN A;  2DW2 A;  4XCT A;  5B5O A;  3DNG A;  2YUF A;  4FXY P;  3F17 A;  4FVL A;  2E3X A;  4WK7 A;  1IAE A;  1GO7 P;  1RMZ A;  2V4B A;  1R54 A;  1D8F A;  5D3C A;  2W15 A;  1KUH A;  1CQR A;  2FV5 A;  3KMC A;  3LUN A;  5I2Z A;  1K7G A;  4JPA A;  2W14 A;  4XM7 A;  4XM8 A;  1HFS A;  2OW1 A;  1KUI A;  2YIG A;  1JJ9 A;  1XUC A;  4ZR5 A;  2DW1 A;  1PWU A;  4H49 A;  4L63 A;  3DTI A;  3L0V A;  2OXW A;  1KUK A;  3EDZ A;  3B8Z A;  1BM6 A;  5CZM A;  1QIC A;  1CGF A;  2ERQ A;  1I1I P;  1CGL A;  1SMP A;  2POJ A;  4L19 A;  4JQG A;  1C3I A;  4G9L A;  4HX3 A;  3HDA P;  1Z3J A;  2Z2D A;  4PKT A;  4IUW A;  3N2V A;  3O64 A;  1OO9 A;  2OVZ A;  3HBU P;  2JIH A;  3KME A;  5I4O A;  966C A;  1JIZ A;  1I76 A;  1ATL A;  2N8R A;  4IN9 A;  1OM6 A;  3AYK A;  5L79 A;  1BUV M;  1JIW P;  1ND1 A;  3MA2 A;  3AIG A;  1BKC I;  2DDF A;  2I47 A;  1HY7 A;  4ILW D;  2HU6 A;  4DV8 A;  2K2G A;  2ERO A;  3LIL A;  3E8R A;  4H2E A;  4AYK A;  1DTH A;  4H3X A;  2WOA A;  1UEA A;  1KUG A;  1C7K A;  1KBC A;  1JAO A;  1R1H A;  2RJP A;  4H84 A;  2X7M A;  2ERP A;  4JP4 A;  1YQY A;  3V96 B;  4PKS A;  1BSW A;  3RTT A;  3F16 A;  1JAQ A;  1EAK A;  3LIR A;  1CAQ A;  3HY7 A;  5D2B A;  2MZI A;  3LEA A;  2OY4 A;  1S4B P;  1XFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...