2JSOA

Antimicrobial resistance protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
88
structure length
88
Chain Sequence
MEWLVKKSCCNKQDNRHVLMLCDAGGAIKMIAEVKSDFAVKVGDLLSPLQNALYCINREKLHTVKVLSASSYSPDEWERQCKVAGKTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polymyxin resistance protein pmrD
publication title First structure of the polymyxin resistance proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 20
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11183 PmrD Polymyxin resistance protein PmrD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.650 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2jsoA00
2JSOA 4HN7A 2RQXA
chains in the Genus database with same CATH superfamily
5IIFA 5EPLA 5DEHA 1JB7A 1LYLA 4J1MA 1KQSA 5E1FA 4ZLTF 3FPUB 1X3PA 4CJ2C 2DNEA 1SJHD 1NMGA 2A8VA 1NMFA 1S5FD 1LM0A 1CA6A 1PH8A 3EBEA 2V4DA 2FFKB 2PNRC 1HZAA 1B4OA 2L11A 3RN5A 1EEID 1AP0A 4K6DA 1X3FA 2R92G 5I9OA 2Z4HA 1J5EQ 1VQAA 1C0AA 1B8AA 4JPBW 2OXPA 4FF4A 4ME5A 2ENBA 3RMHA 1W2BA 1OXVA 2F0KA 1ESFA 2R7ZG 1H9RA 3TBIB 4QGUA 2F0VA 2RVLA 5C3WA 1YVCA 2VB2X 1Y1VG 3K5NA 2I46A 1IL8A 3K0YA 4ZUIA 3HOYH 2E2JH 1I4RA 1LV9A 3K6OA 3U4VA 4DR3L 1PRTC 3PIPA 5LMUL 4LFCL 4OO1H 1QJOA 1NR2A 2V1CC 2HCCA 1K83B 4LF7L 2QEJC 2ZXPA 1C4QA 5LL6S 5IODA 1CA5A 1D7QA 1AN8A 2EOTA 5IE8A 1GUGA 1XMQL 3ERQA 3ERSX 1OO9B 3L2PA 1JMCA 2OWOA 4B3RQ 1DOKA 4K2KA 1CHQD 4LWCA 3CCQA 3NTHA 3OSOA 1C8CA 1SYBA 3HRZC 1PDQA 1G2SA 4DK6C 4ZYSA 3S9WA 1LT4D 1B44D 2GN5A 4I7ZC 4JI3L 4DV0Q 4DR4Q 2UUAQ 3OIPA 1GVPA 1QB5D 2KUMA 4O42A 3JAMc 5NUCA 3I2ZA 5C4XB 1PH9A 5IP9G 1G51A 5JAVA 5IGCA 2ZM6L 1HQMC 1TVXA 2HIXA 4A3IH 2B63H 1EWHA 2LS01 5FLMG 1WTOA 4Q5VA 3LGJA 3U4ZA 1DYQA 4X3SA 1BCPC 1EQTA 4QJFA 3S1QB 4L6TB 3STBD 1PA6A 1HR0L 3X3NA 3PIP3 1HZBA 1JE5A 2RDFA 4XYOA 4U68A 2EE1A 2VXWA 4OO1I 1H95A 3T4AC 1VMPA 3SHLA 5GAHC 1YJ9A 2NVYB 2DY8A 4Y7NB 1QG7A 3A74A 1MGSA 4KLKA 2Z6KA 1TKWB 2OCEA 2Z8LA 2B8GA 3HS0C 3SDZA 1WOCA 2UU9Q 4OWTB 4YWKA 3K80C 1LTRD 2L12A 5LMNW 2YTVA 1SNDA 1QE6A 2KEEA 3C1EA 1A3UA 2HD3A 4YWLA 3D4RA 1TR5A 1L0WA 4UP8A 1YNJD 1SYCA 2BA1A 2UXBL 1R9TB 4MTNA 4EQ5A 1RJTA 3MXUA 1I4PA 1IL2A 1IW7D 2YV5A 4IJLA 2ALYB 4YCWA 2WIIB 4YIJA 1EIFA 4AYBG 4TRDA 3NQTA 4QY7A 3PIOA 1X3QA 1PLFA 4DV4L 1BR9A 2X6LA 3T51B 1BUVT 4YCUA 1PH7A 4KN4C 1KL9A 4RG1A 3UI2A 4KY7A 2MQHA 2NTSA 4IURA 1UUPA 1PTOF 2FXQA 3D8GA 1NJIC 1F9RA 2AQ2B 4ABNA 5J22A 1BVSA 1K83H 2R92B 3IL8A 4MIUA 3NPPA 4KV6A 3NK9A 2E76C 1K3RA 5T1GA 4RKLA 3SVMA 4IFDG 3PO3B 3RZOB 2ZXOA 2PO4A 4A4IA 3MZ5A 1PH4A 1CKNB 1LO5D 3OMCA 4AIMA 5ELEA 1STNA 2JSOA 4B3MQ 3S2HB 1RIPA 3QR8A 4BBRG 4GNXB 4EQPA 4C3HB 1PZID 1FNWA 1U0LA 3Q22A 3GTOH 2IHFA 5KYIA 4CKEA 3H09A 5GADC 1EQVA 4N8FA 1E3PA 2I5HA 3PIO3 4G4KA 5C4XH 4FXDA 1NBWA 4DUYL 2B2TC 3S17B 2BDNA 1W6JA 1JR0D 1OTCA 1CQFA 4HIMA 3KLWA 1EU4A 3S1QH 1CTMA 5IYDH 4S3SA 1WTWA 4MZ9A 1V1OA 4RGMA 3E0EA 3WDNA 2K05A 3I7FA 2L15A 3E6ZX 1Q46A 3I70A 2NVYH 2B2YC 1QNKA 3LWUA 3JAMi 3NHHA 4Y7NH 3SK6A 2C5CA 4GZYC 3DMUA 1QUQB 3BDLA 4H7BA 4OHJA 1ENAA 2RHQB 1F2LA 2MJ8A 2Q8RE 4A3CG 5L37A 1Y8OB 5AJ3L 5ELFA 5JJKA 2JP1A 1E2WA 2K50A 1SR3A 3K5MA 4GKJL 4A3KG 4DAYB 3KLSA 1Q81C 4QIWB 2PQAB 4DF7A 1AZPA 1HNXL 1HQRD 2XSCA 2ZJPA 3CCSA 1R9TH 4RFBA 1CM9A 1XJVA 2KENA 1II3A 4DR3Q 1F9QA 5LMUQ 3D4WA 4LFCQ 2ID0A 3HG9A 2K5QA 1VQHA 3P1HA 5KGUA 4LF7Q 4RH6A 3PUXA 4KJNA 3L9AX 4LF8Q 4H0LC 1TS4A 3MTSA 3DWPA 1U4MA 3Q6SA 1C9OA 1K8AC 4I7AA 1SLJA 5KNBA 1VF5C 5BN3A 1LTBD 3MHBA 2F0GA 1XPRA 2R92H 1HHVA 1L1OA 1PFSA 4X62L 4B3TL 4C1NK 3IRBA 1LTSD 3PO3H 3RZOH 1HPCA 3HFZB 3RNUA 2NN6H 4JI3Q 4IQZA 1A3VA 3VR4A 1EOVA 2VW9A 2A73B 2D5DA 1AE3A 3MEHA 1SFOB 2NZOA 4JI7L 2DY7A 1E2VA 1E24A 3S2HH 2NVQB 2ZM6Q 3CCMA 4X64L 3SK8A 2L9HA 1VQDA 5BN5A 4C3JG 3S24A 1IBML 3MFYA 5M3FB 1SE4A 1LT3D 1KIXA 5D3DA 1HR0Q 4DAPA 3I4NG 1RCVD 1X65A 2SEBD 1N33L 3OWFA 1WCMG 2KCTA 3BYTB 3K5LA 3S17H 1HH2P 2IWHA 1S4ZA 4ZKCB 2VNUD 4HMIA 1RTNA 1E22A 3G6EA 4K5VA 2A6HC 1WD0A 3OIQA 1WTVA 2QF7A 1Q3LA 1DOLA 3L7ZC 1AW7A 4K5XA 1DCZA 2AUJD 1BBUA 4LMQD 5H1SE 4DR2L 1P16A 2XNAC 4XQQA 4CBVA 5DAUA 4DU9A 4X66L 3CCUA 5IY0A 1EIGA 2CWPA 5CV8A 2K6AA 4DUZL 1BQQT 4EGVA 2NN6I 1WTQA 5CYUA 3CD6A 2EY5A 4KI0A 4KD4A 5M3MG 2GA4B 5FO8B 1HFGA 2IJ0A 2XN9C 3T56B 4WJ4A 1N32L 2JEAI 4DV5L 3TEHB 2L5TA 5FLMH 4IZ8A 3H0GG 5JEAG 2ATWA 3NE5B 3HOXG 2Z1CA 3KBGA 1CK1A 5IT9L 1LT6D 1WD1A 3IKJA 4JOIA 1G2TA 1SMYC 5EKKA 2VUMB 4FYDA 1JT8A 4IUPA 3RN2A 1Q7YC 4IPDA 4RCOA 5C4HA 2FMMA 3QO2A 5CR3A 4P75A 3M4OB 1F2ZA 4KHVA 4XXEA 3G71A 4CDFC 2LMCB 1K8GA 4FNFA 4A3JB 3T1HL 1M1KC 1ML0D 2NUCA 4IJHA 4O1NA 2F0HA 5DM73 4A3DB 1VQEA 3D6WA 1KNAA 2E75C 1W3SA 3CC2A 2MFIA 4IFDJ 2EDGA 3F2DA 4EQNA 1X55A 2PZTA 5EAYA 2PW5A 4JVZA 1SFOH 4LF5L 3RR5A 3A5ZB 4BXXG 4YCVA 5E3FA 4CJ0B 2NVQH 4ZK9B 4DUYQ 4I65A 4YHHL 5M3FH 1EIHA 3ITPA 3EN2A 2WFWA 2F0IA 2B2WC 3H3VH 2IX1A 2E2HB 1YNXA 1IHZA 3RUZA 3BJUA 2EYJA 4UHVA 3DWAA 4OGQC 2HCIA 2UUBL 1EYCA 1KTKA 4IFDH 4OIJA 2LXKA 4FXGC 1JOQA 1SROA 2QILA 1KC8C 1FJGL 3H6MA 2MHVA 3FRPB 2K03A 2ZTDA 5AJ3Q 1HUMA 1PH1A 1UE1A 2EJMA 3G4SA 1NCVA 1NNXA 3NBHB 4H02A 4GKJQ 2D9UA 2G9DA 4C3JB 3TREA 1YBYA 5C5LA 1D8LA 3PUVA 4HJ5A 3I4NB 2OQKA 4IOCA 3RD4A 1CUKA 4XT3B 2NB0A 1TWGB 3EJIA 2KECA 4K8IA 3CKIB 1BCPB 3MEFA 5I2XA 4X6AH 2CFMA 1CSQA 1PZJD 4DV3Q 1O78A 2D0PA 1JJGA 1X32A 1CKNA 1D6EC 2WAQG 2A74C 2F4VL 4KD3A 2NYZD 2A5HA 4GNXA 1A15A 2IT1A 1BCPD 2Y0SG 2YTXA 3GTQB 2CH4W 4RWSC 4GLAC 4BS9A 3I91A 2EZVA 3A8KE 3M4PA 1VQ9A 3U9SA 3OW2A 4HSVA 3GTKH 2HDLA 1E1TA 2F0EA 4XIGS 5CMDA 3TP5A 4IFDI 5ELOA 1RD9D 4U673 2EJGC 2JJQA 2VUMH 1XYIA 1XNRL 4A3CH 4B3TQ 3QJYA 2NZHA 4ZQ3A 2H5XA 1K8MA 1WTPA 4A3KH 3QOLA 2JA8G 4FDBA 2RBMA 1I6HH 4HN7A 5ELCA 3WOFA 1JJ2A 5JPNC 4QIWE 4RGNA 4A3FG 4JI7Q 2KQ3A 3H0GB 3A54A 3AB9A 3NQIA 4A3JH 4X64Q 3HOXB 1IBMQ 5DM63 4HIOA 3TQYA 4ZRZA 3EQLC 3OMGA 4L5QA 5I2YA 1QUQA 2PMZB 4P72A 5KNCA 4A3IB 3LWEA 3S14B 5LHY1 2EQSA 5K36H 2XWBB 2PZWA 1EWIA 1N33Q 3PV0A 1H9MA 4K14A 2EXDA 2WB1G 4LFBL 1TY2A 2FMCA 4DAYA 1VCIA 3VA5A 2Z0SA 4RMFA 5D14A 4J15A 2F3VA 2PQAA 3CPWA 4QMGA 1VQ6A 1ICWA 2E2HH 3VR3A 5FJ8G 4DGZA 4DR2Q 4K2LA 2MNAA 1PVOA 2J7ZA 4CDDC 3V05A 4X66Q 3GTJH 5GROA 1Q1EA 2XVSA 4KY6A 3VYTA 4R9WA 4DUZQ 2A1AA 4HJ9A 1XNQL 4AYBE 4UDUC 2RA4A 4RKBA 5JPMC 5IT9E 1DD2A 1RF2D 2Z6KC 1ILQA 3URYA 1N32Q 3HOVB 4DV5Q 4C3JH 3W3AA 3UDIA 1FGUA 1SNQA 4C1NI 1DOMA 1H9JA 3I4NH 3FVQA 3I4OA 3A8IE 5FO7B 2ZT9C 4ID6A 4FO2A 1NY4A 1TWGH 3TP6A 1GUTA 1O7YA 4EVOA 2KVMA 3CQZB 5IYBG 3AU7A 1IZ6A 2C35B 3BYYB 3V96A 1GD7A 1YITA 2N3SA 4BWGB 3CF5A 1QZHA 3J80i 1ICFB 2Z4IA 4LUVA 5JEAJ 3GTQH 1Z7TA 4BY7G 2XTIA 3J7YW 1KNEA 3EVQA 4LF8L 4IPCA 2JA5B 5IYCG 2EYMA 2K52A 1TU2B 3J7ZC 3K7UC 4YWMA 3T1HQ 1BXTA 2D62A 2CQAA 5M3MH 4JBMA 1YEZA 1GUWA 1MD2D 1PZKD 4IUQA 3J81i 2F3IA 3GTOB 5IOCA 1D5ZC 2BE5C 3PQIA 4QUFA 4LF5Q 2WAQB 4F87A 3H0GH 2B2VA 3HOXH 1S72A 2K04A 1I6VC 4YHHQ 3BDOA 1V9PA 2KEDA 2PI2E 2B8FA 1A0IA 3S14H 2F0NA 2CKZB 1GM5A 2RKSA 3VDYA 3S15B 2A6EC 2CW0D 4K0KL 4PZ7A 3VR6A 2UUBQ 2EYLA 1TQOA 4QUCA 4F7XA 2E5LL 3SGIA 4XTCS 3BVMA 1FJGQ 1HNZL 4K8JA 1Q86C 3FMCA 5F2DA 1H9SB 1LTID 1VQFA 4A3FB 2A69C 1CKOA 5KEEA 4JBWA 3TSSA 2PI2A 2O5JC 5D3IB 4XDXA 1YNNC 1KXLA 1XWEA 4NMZA 1FL0A 3WOEA 4L5TA 1STYA 1ILPA 2JEBI 2KOLA 1FR3A 1AE2A 3ONAB 4R8IA 2OT2A 1I94Q 4X3TA 2AKWB 1I4HA 4O2DA 2XWJB 1JWSD 3M4YA 3HOZG 4BXXH 2A68D 4R4CA 5K5PA 4H13C 4G7ZC 3HOVH 1VS0A 3KUPA 3HP3A 1VQBA 1STEA 2F4VQ 1IKMA 2JYOA 3DHQA 4BA1I 2K5WA 1GHKA 2ZXRA 1YHAA 4K5WA 2CCZA 2UXDL 2B2UC 4NB3A 3M9BA 3CQZH 2L55A 2HQEA 1I50B 3K57A 4PMWA 1ENCA 1L0YB 1EQQA 1PTOB 1LTAD 1XNRQ 3TDQA 3MC0B 5A2QL 4CJ1B 1YI2A 1X3EA 4UP9A 2IHEA 4JI5L 5C3EG 1S5BD 3OW7A 4KY5A 2IX0A 3TN2A 1UWVA 1PFMA 2JA5H 1B3AA 3C2PA 5IGGA 1EY8A 1G291 1PTOD 1UEBA 2R7ZB 1D1IA 2X69A 3NEMA 4QL5A 1VQMA 2R7DA 1V1PB 1F9SA 1Y1VB 4JBKA 3ULLA 3TS2A 2R93G 2K5HA 2LXJA 1L1OC 2DJFC 3FP9A 5JJZA 1Y1WG 3MXGA 1SMXA 2BA0A 3GTPB 3DEPA 4LFAL 3ND8A 4HMJA 4LFBQ 3A56A 3NBHA 4CGYB 4MN3A 5GAGC 3HKSA 1JE4A 3TS0A 3UDFA 1IKLA 1V1QA 4BY7B 2CHBD 3KJOA 4BBSG 1JQYD 4C3IG 3S15H 2PYKA 4AQYQ 4N9PA 3FKIG 2AMCB 1F2MA 4YY3L 4NP5A 1EWCA 5HGTA 4RGTA 1BF4A 1O7IA 5CORA 1HTPA 1PXUA 2F0UA 1QZGA 2RDGA 3E5SA 3KF8B 1BDOA 2Q8TA 1XNQQ 5C44G 2JA8H 2KA7A 5EKIA 2ES2A 4L5SA 2EJFC 3A55A 4A3FH 4X3KA 2AUKA 1GOZA 1RDPD 1GUOA 4N9TA 3DM3A 4L5RC 3DM1A 4GOPC 1WYDA 2EY2A 4OELB 3AQQA 1IBLL 3SK5A 1M90C 4OWWB 1N9WA 1A8VA 1BKBA 4R8NA 2VZAA 2PMZE 4K6LA 1KDAA 3T13A 5A35A 5J3BA 2VB3X 3GQBA 4A3MG 4DNTB 1A3TA 2J0TD 1RHPA 4RHSA 1JOKA 4IALA 5M9OA 2SNSA 1VQ8A 4DV3L 3ULPA 4HSPA 5EBCA 2JXMB 1A6XA 1SJED 2UXCL 3PF4A 5FJ8H 2CWAA 4H44C 5EKLA 2NWGA 2JA6G 1J6QA 5C0XJ 2Q8IB 1TS2A 2I5MX 5KNDA 1KRSA 1QILA 3K7AB 1I50H 1UE6A 1PTOH 1SNCA 3F8TA 3I4LA 5T1IA 3STBC 2PNHA 4A3EG 1Q8IA 3HOZB 3GTMB 3CCEA 2QKIC 4JOIC 1RODA 3GO5A 2UUCL 4NPSA 1R4QB 5C4JH 2DJGC 4JW0A 4AYBB 2R7ZH 2Z9HA 3WWVA 2HDMA 1ASYA 3FEWX 3NXWA 2E74C 1VQNA 1STBA 1Y1VH 3D6CA 3DEOA 4TQUS 4FF1A 3VYSA 4K0KQ 3GTPH 1LUZA 2K01A 5DLQE 2K14A 1TY0A 2MPMA 5CC4A 3MFGA 1B9MA 1PYSB 2YYZA 1LTTD 1B50A 1IW7C 3M7GA 5C3EB 3BS1A 2FJ2A 2E5LQ 1STAA 4BY7H 3I4MG 1C7YA 1WVLA 4J8QA 2B2TA 1HNZQ 1SRUA 1KAWA 3UDGA 5IYCH 4BY1G 3TRZA 1NE3A 1TWAB 3VYRA 2O4XA 3BU2A 1SXTA 1CHPD 3RLOA 4ULLA 5EPJA 1VMCA 2BH8A 2K1BA 4BBRB 5ISRA 2WACA 1B3QA 4A3LG 1T5EA 1XPOA 3HOYG 2I5LX 5CV9A 1U4RA 2WAQE 2EXZA 4QCLA 1EY6A 3E3XA 1EQRA 5FO9B 4CHTB 1MSGA 3KFUA 5IP9H 2IW3A 2Y0SE 2RCNA 3W5OA 5A2QE 1WJJA 4KMUC 3KDFB 4BBSB 4C3IB 4CDCC 4OIKA 1EY7A 1HR0W 4EQOA 2UXDQ 4LF4L 3MXNB 3FKIB 3DLLA 3T1YL 1MKHA 3M7NA 1EOTA 4LNQA 3L0OA 5KRUA 2WV6D 3F2UA 3QWNA 3GTKB 4DK1A 4FF2A 1HZ9A 3S1NB 1O7LA 2K75A 4JI5Q 4OEMB 1HXYD 1KRTA 3NSWA 1JWUD 3NTIA 4DV2L 4DFAA 4JV5L 4GNXC 3S1RB 2JQOA 3CW2C 3K7AH 5IWAL 1SDFA 4TVAB 4A3KB 2L0CA 1SE3A 1I6HB 3S2DB 4JCVE 4IPGA 3UE1A 3NBIA 1N8RC 3GTMH 3HOZH 3SXHA 3KJPA 2WB1E 2JA7G 2GVAA 4CDEC 4ODGA 3PCOB 3CP0A 4GKKL 1H9SA 1UEAB 1U9RA 4LFAQ 4DR7L 1KLUD 1U4LA 1N36L 5I9PA 1VQKA 1EEFD 1PRTB 4RAUC 2OTLA 2ICEC 3EROA 4PZ6A 1GUNA 2JA6B 3A5UA 2F0SA 3RLFA 4OONA 3SE0A 2EYHA 4LJZC 3I72A 4XQJA 2M2LA 4YY3Q 1DJRD 2R6GA 3KF6B 1WI5A 5LMNL 4POFA 1UAPA 1PRTD 4L8JA 1LLRD 1SAPA 1LABA 4GS3A 2G5DA 2KBNA 3C1FA 5C3EH 2QCPX 5KIXA 1H9KA 4WJWA 3VYUA 3VR5A 3GTJB 2BCOA 4GN3B 1DONA 1DGSA 3OHXC 3PUYA 3H94A 4Q0FA 5EQ0A 4A3BG 1TWAH 2A19A 1IBLQ 1MIUA 2C9OA 1A63A 3PUZA 1FYCA 4BBRH 3W1BA 4R4OA 1Y1WH 4C2MH 3LX0A 4LK1C 4ALPA 1I94L 3FHWA 4PG3A 1JWMD 4CKCA 5M5WB 5IGFA 3JAML 2EVBA 1WCMB 5M5XB 2RF4A 4M1UB 2WP8J 4DR5L 2VS1A 2NBFA 1WFQA 2K33A 1SNOA 5HY6A 3PF5A 2NVXB 3I4MB 4BBSH 3TZUA 4C3IH 2UXCQ 4BY1B 1Y69U 2XRSD 3CMEA 1ET6A 1V1PA 3FKIH 2ZJRA 1AH9A 3A8JE 4OL7A 4NKLA 2A6ED 3H3VI 1G91A 3D0FA 4IOAA 3PUWA 5FKAC 3RZDB 3HEJA 5COYA 1TS3A 4B3SQ 1HJPA 1Q1BA 5C44H 1X56A 3E9HA 1V8QA 4RGOS 3S1NH 4JBJA 1EY0A 1U5KA 4A93G 1Q90A 2K4KA 4DK0A 3EIVA 3PSIA 5IGBA 1K9MC 2UUCQ 4DXFA 1VQJA 5M3MB 3S1RH 2A69D 3P75A 3HOWG 3J81E 1F2YA 1Z47A 3F1ZA 1YNND 1BOSA 1Q8KA 3Q8DA 3S2DH 4DXGA 1G6PA 1EYDA 3I73A 3CRLC 3CAMA 2EY1A 2K5DA 1ZYRC 4A3MH 2D2CC 2JN4A 5G3LF 3K81C 4PMBA 3KF8A 1CI3M 1BNZA 2E2DC 1IYVA 2AHOB 1TWFB 1T5XD 1VQCA 4ZAIA 2E2IB 2AQ3B 4GLXA 4A3GG 3RLNA 2ZTEA 2H4OA 4DR1L 1K3BC 1XTCD 4FP5D 5IP7G 2JA6H 1UE5A 3AEVA 2B2VC 2Q2IA 4G57A 4GN4B 1KDCA 1J8IA 1S40A 5ELDA 2AWNA 1HA5A 4OX9L 4GLVB 2B2WA 1OXXK 1LACA 3HKZG 4MTKA 4A3EH 1K8OA 1KAAA 4AQYL 3TP8A 3X3MA 1IYUA 1D2BA 1NUCA 5J39A 5JOBA 2JA7B 2IY5B 1B70B 2KHIA 3E9IA 4JYAL 1ONLA 1WTXA 1CQVA 5IT9c 4LF6L 2EYPA 3NTKA 1JOOA 2VQFL 4WJ3M 3OWEB 2AWOA 1LT5D 1GO3E 3L3OC 3KK7A 5KYLA 1VQ7A 5FOBB 3K58A 2WINB 2H1EA 3R3OA 4LF4Q 1NTGA 1AEXA 2PCFB 3T1YQ 1I5FA 5C0XG 5M5WH 1JCKB 2FHTA 5DNFA 1WCMH 5M5XH 4KK7A 2NVXH 1B9NA 3I4MH 4PMCA 2RSOA 4APVA 2KJXA 3ULJA 3T16A 3CCJA 4BY1H 3PO3G 3DWQA 2NN6G 2F0PA 4A3BB 1FGBD 5GQOA 3ZJYC 4DV2Q 1OXSC 3H91A 4JV5Q 4HAEA 2EYOA 1WTRA 5IWAQ 3RZDH 1L2FA 1MJCA 5CV4A 4GOPB 5CBAE 1SBBB 1SSOA 4A3LH 4C3HG 4PZ8A 1YHQA 1IXRA 2YU9B 2QDBA 3P20A 4HR7B 4DV1L 2R3ZA 2F1MA 3D4DA 2F0LA 1ZXTA 4RCNA 4GKKQ 4EX5A 3KBXA 4JG2A 4DR7Q 4HJ7A 1TWCB 1N36Q 2I0QA 1O80A 2ICIA 2JA9A 1EFWA 1G8ZD 1SYGA 2M00A 2IPKD 3S16H 5JEAH 3KOJA 2F0WA 4N8X1 1F9PA 1O7ZA 2Y0SB 2K28A 2K5NA 3NWSA 1HNWL 1TWFH 4LW1A 2G9HD 2E2IH 3VA7A 1QNUA 4KHZA 1W6KA 5LMNQ 1MSHA 1STGA 3KLRA 2VQEL 3HOUG 4AH6A 2QEXA 4A93B 3W2DA 1TWHB 1M8AA 5FLXL 1VQIA 4WORA 2VL6A 1QVGA 4Y52H 1MHWC 2WKCA 3KDFA 5EPKA 4C56C 3HOWB 3JAME 3NP8A 5JVH3 3MXNA 1SEBD 3CC7A 2JA8B 2BDOA 2D0OA 2R61A 2WKDA 3J7AV 2F0OA 2RHSB 3ER0A 5LL6X 5IGDA 2JA7H 3J7A5 1TIID 5JJIA 3QG1A 5AFWA 1KD1C 4PQXA 1CFMA 5CBEE 3CPFA 1S5CD 4A3GB 1PYWD 1KLGD 1OXTA 4HCSA 4Z9CB 4DR5Q 3I90A 2WB1B 4JI2L 2F0DA 1ET9A 3CRKC 1QVFA 3FDTA 2NVTB 1GXDC 4DV7L 3O13A 3GD7A 3HZXA 2EIFA 3HKZB 1PMRA 5BN4A 5EJWA 4DR6L 3BDCA 3I55A 3R2IA 4V0BA 2X6GA 5IGEA 3J81j 2KCNA 5E4XA 3I8ZA 4A3BH 2L1BA 3Q0AA 1Q12A 3K0XA 3Q24A 5E7NA 2A6HD 4FF3A 1GKHA 4FVMA 5I6WA 5BR8L 1A2TA 1Y14B 3KF6A 5C4JB 1J9OA 2LY7A 2RSNA 5M3FG 2YU9H 4G7HC 3QB3A 3J7AF 4QQBX 1AFPA 1YIJA 3R8BA 3U58A 1KABA 2QGQA 4IN3A 1P8LA 1B53A 4GN5A 5C4ZA 1XTDA 4KJOA 4DA2A 1TWCH 4IUNA 2K7VA 2ZJQA 2F0JA 2PZUA 4DR1Q 3OTOQ 2LKVA 4FXKC 1FD7D 1YHBA 2N55A 2DNCA 5E4WC 4CKBA 3OPOA 4DV6L 1XMOL 1BO0A 3QIAA 4X65L 4UAIA 2PW7A 3GTLB 1A62A 1TS5A 1KDBA 4OX9Q 3SR1A 1IBKL 1PH3A 1M4VA 5M5YB 2SDFA 2ASBA 1SN8A 4A93H 1HRJA 1TWHH 2OTJA 3UE0A 3NENA 4JI6Q 5I6YA 1X6OA 4JYAQ 1DZ1A 2ZTCA 3CU7A 4LF6Q 3D31A 3HOWH 1WTHA 1SMYD 4KKUA 1VQ4A 1QOHA 2VQFQ 5TSSA 4NXMQ 2F0FA 1XXGA 1U4PA 2F0MA 4ZKBB 1QVCA 4NW2A 3NWTA 2K32A 5HURA 3GV6A 3ZYYX 1PFNA 1RL2A 2B39A 4P2CB 1NR4A 1S3OA 3F2BA 2GVBA 1SYDA 4LAAA 4KKSA 1S5DD 4JI0L 3PO2G 2IL8A 3K5OA 4A3GH 2F03A 4KHPL 3HOUB 1SNMA 5IP7H 4ZUJA 3PGZA 4QB4A 2HHHL 4NXNL 2I07B 2VUMG 2NVTH 3AYHB 4HCEA 3N6RA 1EY5A 2EPBA 4DKAC 5D65A 3C46A 4OWXB 4X3UA 3W1GA 1PH2A 2DUDA 2N88A 1BBWA 2B2UA 2PQEA 1E2ZA 3A7AB 1I4XA 4NDXA 1XX8A 1ESRA 4A3JG 2M9VA 3TMEA 1PH5A 2J4XA 2JK8A 4RHRA 1VQGA 1T9HA 4B3SL 4A3DG 2CW0C 4B08A 4JI1L 3M85A 1EZ6A 4DV1Q 3MA2B 5K36G 5FLXc 1D5MC 1SYEA 3EA6A 1VF7A 1EFID 1Q82C 3ICEA 1GHJA 1X54A 1SYFA 2XIWA 1YZ6A 5FLXE 3J80L 3AFQA 4MHEA 4XT1B 1JORA 4LF9L 1AZQA 2SOBA 1XMQQ 1UE7A 5C0XH 1EIYB 1ENFA 1SE8A 1HZCA 4JC0A 1K28A 2N8NA 1HNWQ 1CZGA 4DK3C 5IYBH 1S5ED 2F3WA 3BZKA 1R4PB 1PYBA 5I4DA 2VQEQ 5C3XA 3P7JA 1F77A 4JI4L 5CV7A 2HIVA 3OOCA 2OF1A 3DXJC 3J81L 3H15A 2A68C 4JI8L 1YNJC 3F2CA 3EFXD 3SK4A 3GTLH 2LFNA 1V43A 1L0XB 3A0JA 1CSPA 4A76A 3MWYW 2B3GA 2CQOA 2EYFA 3JC66 2IX3A 1E7ZA 3HGBA 4C3HH 5M5YH 5GAEC 3CXCA 3M3YB 2MGSA 1HUNA 5CV6A 1QCBD 2NTTA 1PFBA 2R93B 1Y1WB 2B2YA 1QWYA 2BOSA 4TKOB 4P73A 2QDLA 4C2MB 1X3GA 4QF4A 1HFNA 4IPHA 1ZKOA 4JI2Q 3NUCA 4LUOA 2Z6BA 2L4NA 2E8GA 2F4IA 1N34L 4OO1G 1LTGD 4GOPA 1RKNA 3G6JB 3KLSX 3SEBA 4XQNA 4DV7Q 5C0XI 1ZYRD 1VQ5A 2MUYA 5CV5A 4IUUA 4L63B 1C48A 4DAMA 1PTOC 3BZDB 2KCCA 3K8AA 3T53B 3HOUH 2EY6A 3NELA 4F88A 4DR6Q 3AFPA 5C5MA 3V2TA 3TP7A 5EBDA 3BVZA 2F0TA 4KKTA 2UXBQ 2TSSA 1UNSA 1VDZA 2PPBC 3G7LA 2FINB 2MP1A 1J5EL 4OXPA 4DN4M 3GV3A 5C44B 4POGA 4M8AA 4IUTA 1JJCB 2RCFA 3G48A 4P74A 4ZCKA 4DV4Q 1X9NA 4A75A 5BR8Q 1SNPA 2N78A 1CZWA 3ND9A 2HT1A 3D3RA 1JB3A 3LNNA 3IAYA 1KHIA 5ELNA 3PO2B 2B63G 3TZDA 4A3IG 1NSNS 1FNUA 3I3CA 2VY3A 1EY4A 1FNVA 4A3MB 4WRDA 1TT2A 2B29A 3B6YA 3FPPA 4J6HA 4B9WA 4DV6Q 1PV4A 5FK9C 4RA8A 1XMOQ 3GTGB 2Q2TA 3K59A 4WFN3 1EL0A 3HKZE 4V190 1EUJA 4X65Q 3U9OA 4ME3A 2QA4A 2RQXA 4G7OC 1MBYA 3CC4A 3S1MB 1ASZA 2KHJA 1K73C 2MO0A 1IBKQ 2SNMA 2TMPA 2F52A 4B3RL 1Z6HA 1HA6A 2AQ1B 3IFTA 4B9XA 2XRQD 2DN8A 1YJNA 1CT1D 2NZ1D 4R4QA 5HGQA 1EZ8A 4HJ8A 3M4QA 4A3EB 4HIKA 4DV0L 4DR4L 1PRTF 2UUAL 2OEOA 4JK1C 2DGYA 3VR2A 1OXUA 3CCRA 3HOVG 1EY9A 4DPGA 1I3QB 1B7YB 3M3YH 1PH6A 4R1JA 3QOJA 1YJWA 1B1ZA 2JE6I 1GJXA 1JC7A 3BG3A 2LSSA 4IO9A 2R93H 4R4IA 4P71A 3IFDA 4JI0Q 1K0SA 3R2TA 1ZEQX 4KHPQ 2KHSA 2KCMA 1EYGA 2R7FA 1A2UA 4LUZA 2CH4A 5J1ZA 1Y8NB 2HHHQ 4NXNQ 3PMFA 2BE5D 3CHBD 4HIDA 1D5XC 3J80c 3UDXA 2UU9L 1BBXC 3MXPA 1MJEA 4KTAA 2JA5G 3C3LA 2N49A 1G6ZA 3J80E 3GDEA 1HNXQ 3A7LA 4UY8C 1D1KA 1DM0B 4O0AA 4PV1C 1EU3A 5ELBA 4UPAA 1BCPF 2RDHA 4JI1Q 4KN7C 3HOYB 2E2JB 1CKMA 3BZCA 2YTYA 3GP7A 4R4TA 3J81c 4BA2I 1I4GA 1HTLD 1Y8PB 2OQ0A 4PNYA 5C6AA 1VQLA 1JICA 1E0BA 3R93A 3BVGA 4TSSA 5C4XG 4LF9Q 1STHA 3PO2H 3CCLA 4MNOA 3H3VC 1EYAA 4ILWA 1HCZA 4IUVA 3U50C 2HUGA 4HTHA 3S16B 4DAVA 2Q2HA 4UP7A 4HEDA 1E1OA 4DNRB 5IYDG 3CCVA 2O2LD 1IYJB 4X62Q 1VQOA 4XYQA 4JI4Q 1FVIA 3OYYA 1NAPA 3GTGH 4JI8Q 3OTOL 2MO1A 1MI2A 4HJAA 1SE2A 3E0JA 3M4OH 1B2TA 1XPUA 1GUSA 1K0RA 1RTOA 2K5VA 3S1MH 2XGTA 1TXYA 5G3LD 3CMAA 1PHJA 3MAQA 2P5ZX 2F0QA 4E6IA 4B3ML 1Z9FA 4A3DH 5JJLA 1LTLA 2B63B 1DXMA 3AMUA 2QW7A 4F8MA 3MVVA 2HQLA 3DUZA 3N52A 3Q23A 5JVG3 5CGKA 2O5IC 4JI6L 3KYHC 2BH2A 2CVRA 1VQPA 3I56A 1I4QA 4DNIA 5EGTA 1L1OB 2Q2UA 1I3QH 4NXML 1N34Q
chains in the Genus database with same CATH topology
5IIFA 5EPLA 5DEHA 4J1MA 5E1FA 4ZLTF 3FPUB 1X3PA 4CJ2C 2DNEA 1SJHD 1S5FD 1CA6A 2V4DA 2FFKB 2PNRC 1B4OA 2L11A 1EEID 1AP0A 4K6DA 5I9OA 2Z4HA 2OXPA 4FF4A 4ME5A 2ENBA 3RMHA 1OXVA 2F0KA 1ESFA 1H9RA 3TBIB 2F0VA 2RVLA 5C3WA 2VB2X 3K5NA 2I46A 1IL8A 3K0YA 4ZUIA 1I4RA 1LV9A 3K6OA 1PRTC 4OO1H 1QJOA 1NR2A 2HCCA 1K83B 2QEJC 2ZXPA 1C4QA 5LL6S 5IODA 1CA5A 1AN8A 2EOTA 1GUGA 3ERQA 1OO9B 1DOKA 4K2KA 1CHQD 3NTHA 3OSOA 1C8CA 1SYBA 3HRZC 1PDQA 1G2SA 4ZYSA 3S9WA 1LT4D 1B44D 4I7ZC 3OIPA 1QB5D 2KUMA 4O42A 5NUCA 5C4XB 5JAVA 5IGCA 1HQMC 1TVXA 1EWHA 2LS01 1WTOA 4Q5VA 1DYQA 4X3SA 1BCPC 1EQTA 3S1QB 4L6TB 3X3NA 3PIP3 2RDFA 4XYOA 4U68A 2EE1A 2VXWA 4OO1I 3T4AC 1VMPA 3SHLA 2NVYB 2DY8A 4Y7NB 1QG7A 1MGSA 1TKWB 2Z8LA 2B8GA 3HS0C 3SDZA 1LTRD 2L12A 1SNDA 1QE6A 2KEEA 3C1EA 1A3UA 3D4RA 1TR5A 1YNJD 1SYCA 2BA1A 1R9TB 1RJTA 3MXUA 1I4PA 1IW7D 2WIIB 4YIJA 4TRDA 3NQTA 1X3QA 1PLFA 1BR9A 2X6LA 3T51B 1BUVT 4KN4C 3UI2A 4KY7A 2NTSA 4IURA 1UUPA 1PTOF 3D8GA 1F9RA 2AQ2B 4ABNA 5J22A 2R92B 3IL8A 4MIUA 3NPPA 4KV6A 3NK9A 2E76C 5T1GA 4RKLA 3SVMA 4IFDG 3PO3B 3RZOB 2ZXOA 2PO4A 3MZ5A 1LO5D 3OMCA 5ELEA 1STNA 2JSOA 3S2HB 4EQPA 4C3HB 1PZID 1FNWA 3Q22A 5KYIA 4CKEA 3H09A 1EQVA 3PIO3 4G4KA 4FXDA 2B2TC 3S17B 2BDNA 1W6JA 1JR0D 1CQFA 1EU4A 1CTMA 4S3SA 1WTWA 1V1OA 4RGMA 3WDNA 2K05A 3E6ZX 3I70A 2B2YC 1QNKA 3LWUA 3NHHA 3SK6A 2C5CA 4GZYC 3DMUA 3BDLA 4H7BA 4OHJA 1ENAA 1F2LA 2MJ8A 2Q8RE 1Y8OB 5ELFA 2JP1A 1E2WA 3K5MA 3KLSA 4QIWB 4DF7A 1AZPA 1HQRD 2XSCA 4RFBA 1CM9A 1II3A 1F9QA 3D4WA 2ID0A 3HG9A 2K5QA 3P1HA 5KGUA 4RH6A 3PUXA 4KJNA 3L9AX 4H0LC 1TS4A 3MTSA 3DWPA 1U4MA 3Q6SA 5KNBA 1VF5C 5BN3A 1LTBD 3MHBA 2F0GA 1HHVA 4C1NK 1LTSD 1HPCA 2NN6H 4IQZA 1A3VA 3VR4A 2A73B 2D5DA 3MEHA 1SFOB 2DY7A 1E2VA 2NVQB 3SK8A 2L9HA 5BN5A 4C3JG 3MFYA 5M3FB 1SE4A 1LT3D 5D3DA 4DAPA 1RCVD 2SEBD 3OWFA 3BYTB 3K5LA 2IWHA 1S4ZA 4ZKCB 2VNUD 4HMIA 1RTNA 4K5VA 2A6HC 1WD0A 3OIQA 1WTVA 2QF7A 1Q3LA 1DOLA 3L7ZC 1AW7A 4K5XA 1DCZA 2AUJD 4LMQD 2XNAC 4XQQA 4CBVA 5DAUA 4DU9A 1EIGA 5CV8A 2K6AA 1BQQT 4EGVA 2NN6I 1WTQA 5CYUA 2EY5A 4KI0A 4KD4A 2GA4B 5FO8B 1HFGA 2IJ0A 2XN9C 3T56B 2JEAI 2L5TA 4IZ8A 5JEAG 3NE5B 2Z1CA 3KBGA 1CK1A 5IT9L 1LT6D 1WD1A 3IKJA 1G2TA 1SMYC 5EKKA 2VUMB 4FYDA 4IUPA 4RCOA 5C4HA 2FMMA 3QO2A 5CR3A 3M4OB 1F2ZA 4KHVA 4XXEA 2LMCB 4FNFA 4A3JB 1ML0D 2NUCA 4O1NA 2F0HA 5DM73 4A3DB 3D6WA 1KNAA 2E75C 4IFDJ 2EDGA 4EQNA 2PZTA 2PW5A 5E3FA 4CJ0B 4ZK9B 4I65A 1EIHA 3ITPA 2F0IA 2B2WC 2IX1A 2E2HB 3RUZA 1IHZA 2EYJA 3DWAA 4OGQC 2HCIA 1EYCA 1KTKA 4IFDH 4OIJA 4FXGC 1JOQA 2QILA 3H6MA 2MHVA 3FRPB 2K03A 1HUMA 2EJMA 1NCVA 2D9UA 2G9DA 4C3JB 5C5LA 3PUVA 3I4NB 3RD4A 4XT3B 2NB0A 1TWGB 3EJIA 2KECA 4K8IA 3CKIB 1BCPB 5I2XA 1PZJD 1O78A 1X32A 1D6EC 2A74C 4KD3A 2NYZD 2A5HA 1A15A 2IT1A 1BCPD 3GTQB 4RWSC 4BS9A 3I91A 2EZVA 3A8KE 3U9SA 4HSVA 5CMDA 2F0EA 2HDLA 4XIGS 3TP5A 4IFDI 4U673 1RD9D 2EJGC 1XYIA 3QJYA 4ZQ3A 1K8MA 1WTPA 3QOLA 2RBMA 4HN7A 5ELCA 3WOFA 5JPNC 4RGNA 2KQ3A 3H0GB 3A54A 3AB9A 3NQIA 3HOXB 5DM63 4ZRZA 3EQLC 3OMGA 5I2YA 2PMZB 5KNCA 4A3IB 3S14B 3LWEA 5LHY1 5K36H 2XWBB 2PZWA 3PV0A 1H9MA 4K14A 1TY2A 2FMCA 4DAYA 1VCIA 3VA5A 5D14A 2F3VA 4QMGA 1ICWA 3VR3A 4DGZA 4K2LA 2J7ZA 3V05A 1Q1EA 2XVSA 4KY6A 3VYTA 4R9WA 4UDUC 2RA4A 4RKBA 5JPMC 5IT9E 1DD2A 1RF2D 1ILQA 3URYA 3HOVB 3W3AA 1SNQA 4C1NI 1DOMA 1H9JA 3FVQA 3A8IE 5FO7B 2ZT9C 4ID6A 4FO2A 3TP6A 1GUTA 1O7YA 4EVOA 2KVMA 3CQZB 3AU7A 3BYYB 3V96A 4BWGB 2Z4IA 5JEAJ 1Z7TA 3J7YW 1KNEA 3EVQA 2JA5B 2EYMA 1TU2B 1BXTA 2D62A 2CQAA 1GUWA 1MD2D 1PZKD 4IUQA 3GTOB 5IOCA 1D5ZC 2BE5C 4QUFA 2WAQB 4F87A 2B2VA 2K04A 1I6VC 3BDOA 2KEDA 2B8FA 2F0NA 2RKSA 3S15B 2A6EC 2CW0D 3VR6A 2EYLA 1TQOA 4QUCA 4F7XA 4XTCS 3BVMA 4K8JA 3FMCA 5F2DA 1H9SB 1LTID 4A3FB 2A69C 5KEEA 4JBWA 3TSSA 2O5JC 5D3IB 4XDXA 1YNNC 1XWEA 4NMZA 3WOEA 1STYA 1ILPA 2JEBI 2KOLA 1FR3A 3ONAB 4R8IA 2OT2A 4X3TA 1I4HA 2XWJB 1JWSD 3M4YA 2A68D 5K5PA 4H13C 4G7ZC 3KUPA 3HP3A 1STEA 1IKMA 2JYOA 3DHQA 4BA1I 2K5WA 1GHKA 2ZXRA 4K5WA 2B2UC 2L55A 2HQEA 1I50B 3K57A 4PMWA 1ENCA 1L0YB 1PTOB 1LTAD 3TDQA 3MC0B 5A2QL 4CJ1B 1S5BD 3OW7A 4KY5A 2IX0A 3TN2A 1PFMA 3C2PA 1B3AA 5IGGA 1EY8A 1G291 1PTOD 2R7ZB 1D1IA 2X69A 1V1PB 1F9SA 1Y1VB 5JJZA 3MXGA 2BA0A 3GTPB 3DEPA 3ND8A 4HMJA 3A56A 3NBHA 4CGYB 4MN3A 1JE4A 1IKLA 4BY7B 2CHBD 1JQYD 4C3IG 2PYKA 4N9PA 1F2MA 4NP5A 1EWCA 5HGTA 4RGTA 1BF4A 5CORA 1HTPA 1PXUA 2F0UA 2RDGA 3E5SA 2Q8TA 1BDOA 2KA7A 5EKIA 2EJFC 3A55A 4X3KA 2AUKA 1GOZA 1RDPD 1GUOA 4N9TA 3DM1A 2EY2A 3SK5A 4R8NA 4K6LA 1KDAA 3T13A 5A35A 2VB3X 3GQBA 4DNTB 1A3TA 2J0TD 1RHPA 4RHSA 1JOKA 4IALA 5M9OA 2SNSA 4HSPA 5EBCA 2JXMB 1A6XA 1SJED 4H44C 5EKLA 2NWGA 5C0XJ 2Q8IB 1TS2A 5KNDA 1QILA 3K7AB 1PTOH 1SNCA 3I4LA 5T1IA 1Q8IA 3HOZB 3GTMB 2QKIC 1RODA 3GO5A 1R4QB 4AYBB 2HDMA 3FEWX 3NXWA 2E74C 1STBA 3D6CA 3DEOA 4TQUS 4FF1A 3VYSA 2K01A 1TY0A 2MPMA 5CC4A 3MFGA 1B9MA 2YYZA 1LTTD 1B50A 1IW7C 3M7GA 5C3EB 3BS1A 2FJ2A 1STAA 1WVLA 4J8QA 2B2TA 1TWAB 3VYRA 2O4XA 1SXTA 1CHPD 4ULLA 5EPJA 1VMCA 2K1BA 4BBRB 5ISRA 2WACA 1T5EA 5CV9A 1U4RA 2EXZA 4QCLA 1EY6A 5FO9B 4CHTB 1MSGA 2IW3A 5A2QE 4KMUC 4BBSB 4C3IB 4OIKA 1EY7A 4EQOA 3FKIB 3M7NA 1EOTA 5KRUA 2WV6D 3F2UA 3QWNA 3GTKB 4DK1A 4FF2A 3S1NB 1O7LA 1HXYD 3NSWA 1JWUD 3NTIA 4DFAA 3S1RB 1SDFA 4A3KB 2L0CA 1SE3A 1I6HB 3S2DB 3NBIA 3SXHA 4ODGA 1H9SA 1UEAB 1U9RA 1KLUD 1U4LA 5I9PA 1EEFD 1PRTB 4RAUC 2ICEC 3EROA 1GUNA 2JA6B 2F0SA 3RLFA 3SE0A 2EYHA 4LJZC 3I72A 4XQJA 2M2LA 1DJRD 2R6GA 1UAPA 1PRTD 4L8JA 1LLRD 1SAPA 1LABA 3C1FA 2QCPX 5KIXA 1H9KA 4WJWA 3VYUA 3VR5A 3GTJB 2BCOA 1DONA 3OHXC 3PUYA 3H94A 5EQ0A 4Q0FA 2C9OA 3PUZA 1FYCA 3LX0A 4LK1C 1JWMD 4CKCA 5M5WB 5IGFA 3JAML 2EVBA 1WCMB 5M5XB 4M1UB 2WP8J 2NBFA 2K33A 1SNOA 2NVXB 3I4MB 3TZUA 4BY1B 1Y69U 2XRSD 1ET6A 1V1PA 3A8JE 4OL7A 4NKLA 2A6ED 1G91A 3PUWA 5FKAC 3RZDB 3HEJA 5COYA 1TS3A 1Q1BA 1V8QA 4RGOS 1EY0A 1Q90A 4DK0A 5IGBA 4DXFA 5M3MB 2A69D 3P75A 3J81E 1F2YA 1Z47A 1YNND 1BOSA 4DXGA 1EYDA 3I73A 3CRLC 2EY1A 2K5DA 1ZYRC 2D2CC 5G3LF 4PMBA 3KF8A 1CI3M 1BNZA 2E2DC 1IYVA 1TWFB 1T5XD 4ZAIA 2E2IB 2AQ3B 2H4OA 1XTCD 4FP5D 2B2VC 4G57A 1KDCA 1J8IA 5ELDA 2AWNA 1HA5A 2B2WA 1OXXK 1LACA 1K8OA 1KAAA 3TP8A 3X3MA 1IYUA 1D2BA 1NUCA 5J39A 5JOBA 2JA7B 1ONLA 1WTXA 1CQVA 2EYPA 3NTKA 1JOOA 3OWEB 2AWOA 1LT5D 3L3OC 3KK7A 5KYLA 5FOBB 3K58A 2WINB 2H1EA 3R3OA 1AEXA 2PCFB 5C0XG 1JCKB 2FHTA 5DNFA 4KK7A 1B9NA 4PMCA 2RSOA 2KJXA 3T16A 3DWQA 2NN6G 2F0PA 4A3BB 1FGBD 1OXSC 3H91A 4HAEA 2EYOA 1WTRA 5CV4A 5CBAE 1SBBB 1SSOA 4C3HG 2YU9B 2QDBA 3P20A 4HR7B 2R3ZA 2F1MA 3D4DA 2F0LA 1ZXTA 4RCNA 3KBXA 1TWCB 1O80A 2ICIA 1G8ZD 1SYGA 2M00A 2IPKD 5JEAH 2F0WA 1F9PA 1O7ZA 2Y0SB 2K28A 3NWSA 2G9HD 3VA7A 1QNUA 4KHZA 1W6KA 1MSHA 1STGA 3KLRA 4A93B 3W2DA 1TWHB 1M8AA 5FLXL 4WORA 4C56C 2WKCA 5EPKA 3HOWB 3JAME 3NP8A 5JVH3 3MXNA 1SEBD 2JA8B 2BDOA 2R61A 2WKDA 3J7AV 2F0OA 5LL6X 5IGDA 1TIID 3QG1A 5AFWA 4PQXA 1CFMA 5CBEE 1S5CD 4A3GB 1PYWD 1KLGD 1OXTA 4HCSA 4Z9CB 3I90A 2WB1B 2F0DA 1ET9A 3CRKC 3FDTA 2NVTB 1GXDC 3GD7A 3HZXA 3O13A 3HKZB 1PMRA 5BN4A 5EJWA 3BDCA 3R2IA 4V0BA 2X6GA 5IGEA 2KCNA 5E4XA 3I8ZA 2L1BA 3Q0AA 1Q12A 3Q24A 2A6HD 4FF3A 4FVMA 5I6WA 1A2TA 5C4JB 1J9OA 2LY7A 2RSNA 4G7HC 3QB3A 3J7AF 1AFPA 3R8BA 1KABA 4IN3A 1B53A 5C4ZA 4KJOA 4DA2A 4IUNA 2K7VA 2F0JA 2PZUA 2LKVA 4FXKC 1FD7D 2N55A 2DNCA 5E4WC 4CKBA 3OPOA 1BO0A 3QIAA 4UAIA 2PW7A 3GTLB 1TS5A 1KDBA 3SR1A 1M4VA 5M5YB 2SDFA 1HRJA 5I6YA 1DZ1A 3CU7A 3D31A 1SMYD 4KKUA 1QOHA 5TSSA 2F0FA 1XXGA 1U4PA 2F0MA 4ZKBB 4NW2A 3NWTA 2K32A 5HURA 3GV6A 3ZYYX 1PFNA 2B39A 4P2CB 1NR4A 1SYDA 4LAAA 4KKSA 1S5DD 2IL8A 3K5OA 2F03A 3HOUB 1SNMA 4ZUJA 4QB4A 2I07B 4HCEA 3N6RA 1EY5A 2EPBA 5D65A 3C46A 4X3UA 2N88A 2B2UA 2PQEA 1E2ZA 3A7AB 1I4XA 4NDXA 1XX8A 1ESRA 2M9VA 3TMEA 2J4XA 4RHRA 2CW0C 4B08A 3M85A 1EZ6A 3MA2B 5K36G 1D5MC 1SYEA 3EA6A 1VF7A 1EFID 1GHJA 1SYFA 2XIWA 5FLXE 3J80L 4MHEA 4XT1B 1JORA 1AZQA 2SOBA 5C0XH 1ENFA 1CZGA 1S5ED 2F3WA 1R4PB 5I4DA 5C3XA 3P7JA 1F77A 5CV7A 3OOCA 2OF1A 3DXJC 3J81L 2A68C 1YNJC 3EFXD 3SK4A 2LFNA 1V43A 1L0XB 3MWYW 2EYFA 2IX3A 3HGBA 3M3YB 2MGSA 1HUNA 5CV6A 1QCBD 2NTTA 1PFBA 2R93B 1Y1WB 2B2YA 1QWYA 2BOSA 4TKOB 4C2MB 4QF4A 1HFNA 1ZKOA 3NUCA 2L4NA 2F4IA 4OO1G 1LTGD 1RKNA 3G6JB 3KLSX 3SEBA 4XQNA 5C0XI 1ZYRD 2MUYA 5CV5A 4IUUA 4L63B 1C48A 1PTOC 3BZDB 2KCCA 3T53B 2EY6A 4F88A 5C5MA 3V2TA 3TP7A 5EBDA 3BVZA 2F0TA 4KKTA 2TSSA 1UNSA 1VDZA 2PPBC 3G7LA 2FINB 2MP1A 4DN4M 3GV3A 5C44B 4M8AA 4IUTA 1SNPA 1CZWA 3ND9A 3D3RA 1JB3A 3LNNA 3IAYA 3PO2B 3TZDA 1NSNS 1FNUA 3I3CA 1EY4A 1FNVA 4A3MB 4WRDA 1TT2A 3FPPA 4J6HA 4B9WA 5FK9C 4RA8A 3GTGB 3K59A 4WFN3 1EL0A 4V190 3U9OA 2RQXA 4G7OC 1MBYA 3S1MB 2SNMA 2TMPA 1Z6HA 1HA6A 2AQ1B 3IFTA 4B9XA 2XRQD 2DN8A 1CT1D 2NZ1D 1EZ8A 4A3EB 1PRTF 2OEOA 4JK1C 3VR2A 1OXUA 1EY9A 1I3QB 3QOJA 1B1ZA 2JE6I 1GJXA 1JC7A 3BG3A 3IFDA 3R2TA 1ZEQX 2KHSA 1A2UA 5J1ZA 1Y8NB 3PMFA 2BE5D 3CHBD 1D5XC 1BBXC 3MXPA 4KTAA 3C3LA 1G6ZA 3J80E 3A7LA 1DM0B 1D1KA 4PV1C 1EU3A 5ELBA 1BCPF 2RDHA 4KN7C 3HOYB 2E2JB 3GP7A 4BA2I 1I4GA 1HTLD 1Y8PB 4PNYA 5C6AA 1JICA 1E0BA 3R93A 3BVGA 4TSSA 1STHA 3H3VC 1EYAA 4ILWA 1HCZA 4IUVA 2HUGA 4HTHA 3S16B 4DAVA 4HEDA 4DNRB 2O2LD 4XYQA 1NAPA 1MI2A 1SE2A 3E0JA 1B2TA 1GUSA 1RTOA 5G3LD 3MAQA 2F0QA 4E6IA 2B63B 1DXMA 3AMUA 4F8MA 3MVVA 3N52A 3DUZA 3Q23A 5JVG3 5CGKA 2O5IC 2CVRA 1I4QA 5EGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JSO A;  4HN7 A;  2RQX A; 
#chains in the Genus database with same CATH topology
 5IIF A;  5EPL A;  5DEH A;  1JB7 A;  1LYL A;  4J1M A;  1KQS A;  5E1F A;  4ZLT F;  3FPU B;  1X3P A;  4CJ2 C;  2DNE A;  1SJH D;  1NMG A;  2A8V A;  1NMF A;  1S5F D;  1LM0 A;  1CA6 A;  1PH8 A;  3EBE A;  2V4D A;  2FFK B;  2PNR C;  1HZA A;  1B4O A;  2L11 A;  3RN5 A;  1EEI D;  1AP0 A;  4K6D A;  1X3F A;  2R92 G;  5I9O A;  2Z4H A;  1J5E Q;  1VQA A;  1C0A A;  1B8A A;  4JPB W;  2OXP A;  4FF4 A;  4ME5 A;  2ENB A;  3RMH A;  1W2B A;  1OXV A;  2F0K A;  1ESF A;  2R7Z G;  1H9R A;  3TBI B;  4QGU A;  2F0V A;  2RVL A;  5C3W A;  1YVC A;  2VB2 X;  1Y1V G;  3K5N A;  2I46 A;  1IL8 A;  3K0Y A;  4ZUI A;  3HOY H;  2E2J H;  1I4R A;  1LV9 A;  3K6O A;  3U4V A;  4DR3 L;  1PRT C;  3PIP A;  5LMU L;  4LFC L;  4OO1 H;  1QJO A;  1NR2 A;  2V1C C;  2HCC A;  1K83 B;  4LF7 L;  2QEJ C;  2ZXP A;  1C4Q A;  5LL6 S;  5IOD A;  1CA5 A;  1D7Q A;  1AN8 A;  2EOT A;  5IE8 A;  1GUG A;  1XMQ L;  3ERQ A;  3ERS X;  1OO9 B;  3L2P A;  1JMC A;  2OWO A;  4B3R Q;  1DOK A;  4K2K A;  1CHQ D;  4LWC A;  3CCQ A;  3NTH A;  3OSO A;  1C8C A;  1SYB A;  3HRZ C;  1PDQ A;  1G2S A;  4DK6 C;  4ZYS A;  3S9W A;  1LT4 D;  1B44 D;  2GN5 A;  4I7Z C;  4JI3 L;  4DV0 Q;  4DR4 Q;  2UUA Q;  3OIP A;  1GVP A;  1QB5 D;  2KUM A;  4O42 A;  3JAM c;  5NUC A;  3I2Z A;  5C4X B;  1PH9 A;  5IP9 G;  1G51 A;  5JAV A;  5IGC A;  2ZM6 L;  1HQM C;  1TVX A;  2HIX A;  4A3I H;  2B63 H;  1EWH A;  2LS0 1;  5FLM G;  1WTO A;  4Q5V A;  3LGJ A;  3U4Z A;  1DYQ A;  4X3S A;  1BCP C;  1EQT A;  4QJF A;  3S1Q B;  4L6T B;  3STB D;  1PA6 A;  1HR0 L;  3X3N A;  3PIP 3;  1HZB A;  1JE5 A;  2RDF A;  4XYO A;  4U68 A;  2EE1 A;  2VXW A;  4OO1 I;  1H95 A;  3T4A C;  1VMP A;  3SHL A;  5GAH C;  1YJ9 A;  2NVY B;  2DY8 A;  4Y7N B;  1QG7 A;  3A74 A;  1MGS A;  4KLK A;  2Z6K A;  1TKW B;  2OCE A;  2Z8L A;  2B8G A;  3HS0 C;  3SDZ A;  1WOC A;  2UU9 Q;  4OWT B;  4YWK A;  3K80 C;  1LTR D;  2L12 A;  5LMN W;  2YTV A;  1SND A;  1QE6 A;  2KEE A;  3C1E A;  1A3U A;  2HD3 A;  4YWL A;  3D4R A;  1TR5 A;  1L0W A;  4UP8 A;  1YNJ D;  1SYC A;  2BA1 A;  2UXB L;  1R9T B;  4MTN A;  4EQ5 A;  1RJT A;  3MXU A;  1I4P A;  1IL2 A;  1IW7 D;  2YV5 A;  4IJL A;  2ALY B;  4YCW A;  2WII B;  4YIJ A;  1EIF A;  4AYB G;  4TRD A;  3NQT A;  4QY7 A;  3PIO A;  1X3Q A;  1PLF A;  4DV4 L;  1BR9 A;  2X6L A;  3T51 B;  1BUV T;  4YCU A;  1PH7 A;  4KN4 C;  1KL9 A;  4RG1 A;  3UI2 A;  4KY7 A;  2MQH A;  2NTS A;  4IUR A;  1UUP A;  1PTO F;  2FXQ A;  3D8G A;  1NJI C;  1F9R A;  2AQ2 B;  4ABN A;  5J22 A;  1BVS A;  1K83 H;  2R92 B;  3IL8 A;  4MIU A;  3NPP A;  4KV6 A;  3NK9 A;  2E76 C;  1K3R A;  5T1G A;  4RKL A;  3SVM A;  4IFD G;  3PO3 B;  3RZO B;  2ZXO A;  2PO4 A;  4A4I A;  3MZ5 A;  1PH4 A;  1CKN B;  1LO5 D;  3OMC A;  4AIM A;  5ELE A;  1STN A;  2JSO A;  4B3M Q;  3S2H B;  1RIP A;  3QR8 A;  4BBR G;  4GNX B;  4EQP A;  4C3H B;  1PZI D;  1FNW A;  1U0L A;  3Q22 A;  3GTO H;  2IHF A;  5KYI A;  4CKE A;  3H09 A;  5GAD C;  1EQV A;  4N8F A;  1E3P A;  2I5H A;  3PIO 3;  4G4K A;  5C4X H;  4FXD A;  1NBW A;  4DUY L;  2B2T C;  3S17 B;  2BDN A;  1W6J A;  1JR0 D;  1OTC A;  1CQF A;  4HIM A;  3KLW A;  1EU4 A;  3S1Q H;  1CTM A;  5IYD H;  4S3S A;  1WTW A;  4MZ9 A;  1V1O A;  4RGM A;  3E0E A;  3WDN A;  2K05 A;  3I7F A;  2L15 A;  3E6Z X;  1Q46 A;  3I70 A;  2NVY H;  2B2Y C;  1QNK A;  3LWU A;  3JAM i;  3NHH A;  4Y7N H;  3SK6 A;  2C5C A;  4GZY C;  3DMU A;  1QUQ B;  3BDL A;  4H7B A;  4OHJ A;  1ENA A;  2RHQ B;  1F2L A;  2MJ8 A;  2Q8R E;  4A3C G;  5L37 A;  1Y8O B;  5AJ3 L;  5ELF A;  5JJK A;  2JP1 A;  1E2W A;  2K50 A;  1SR3 A;  3K5M A;  4GKJ L;  4A3K G;  4DAY B;  3KLS A;  1Q81 C;  4QIW B;  2PQA B;  4DF7 A;  1AZP A;  1HNX L;  1HQR D;  2XSC A;  2ZJP A;  3CCS A;  1R9T H;  4RFB A;  1CM9 A;  1XJV A;  2KEN A;  1II3 A;  4DR3 Q;  1F9Q A;  5LMU Q;  3D4W A;  4LFC Q;  2ID0 A;  3HG9 A;  2K5Q A;  1VQH A;  3P1H A;  5KGU A;  4LF7 Q;  4RH6 A;  3PUX A;  4KJN A;  3L9A X;  4LF8 Q;  4H0L C;  1TS4 A;  3MTS A;  3DWP A;  1U4M A;  3Q6S A;  1C9O A;  1K8A C;  4I7A A;  1SLJ A;  5KNB A;  1VF5 C;  5BN3 A;  1LTB D;  3MHB A;  2F0G A;  1XPR A;  2R92 H;  1HHV A;  1L1O A;  1PFS A;  4X62 L;  4B3T L;  4C1N K;  3IRB A;  1LTS D;  3PO3 H;  3RZO H;  1HPC A;  3HFZ B;  3RNU A;  2NN6 H;  4JI3 Q;  4IQZ A;  1A3V A;  3VR4 A;  1EOV A;  2VW9 A;  2A73 B;  2D5D A;  1AE3 A;  3MEH A;  1SFO B;  2NZO A;  4JI7 L;  2DY7 A;  1E2V A;  1E24 A;  3S2H H;  2NVQ B;  2ZM6 Q;  3CCM A;  4X64 L;  3SK8 A;  2L9H A;  1VQD A;  5BN5 A;  4C3J G;  3S24 A;  1IBM L;  3MFY A;  5M3F B;  1SE4 A;  1LT3 D;  1KIX A;  5D3D A;  1HR0 Q;  4DAP A;  3I4N G;  1RCV D;  1X65 A;  2SEB D;  1N33 L;  3OWF A;  1WCM G;  2KCT A;  3BYT B;  3K5L A;  3S17 H;  1HH2 P;  2IWH A;  1S4Z A;  4ZKC B;  2VNU D;  4HMI A;  1RTN A;  1E22 A;  3G6E A;  4K5V A;  2A6H C;  1WD0 A;  3OIQ A;  1WTV A;  2QF7 A;  1Q3L A;  1DOL A;  3L7Z C;  1AW7 A;  4K5X A;  1DCZ A;  2AUJ D;  1BBU A;  4LMQ D;  5H1S E;  4DR2 L;  1P16 A;  2XNA C;  4XQQ A;  4CBV A;  5DAU A;  4DU9 A;  4X66 L;  3CCU A;  5IY0 A;  1EIG A;  2CWP A;  5CV8 A;  2K6A A;  4DUZ L;  1BQQ T;  4EGV A;  2NN6 I;  1WTQ A;  5CYU A;  3CD6 A;  2EY5 A;  4KI0 A;  4KD4 A;  5M3M G;  2GA4 B;  5FO8 B;  1HFG A;  2IJ0 A;  2XN9 C;  3T56 B;  4WJ4 A;  1N32 L;  2JEA I;  4DV5 L;  3TEH B;  2L5T A;  5FLM H;  4IZ8 A;  3H0G G;  5JEA G;  2ATW A;  3NE5 B;  3HOX G;  2Z1C A;  3KBG A;  1CK1 A;  5IT9 L;  1LT6 D;  1WD1 A;  3IKJ A;  4JOI A;  1G2T A;  1SMY C;  5EKK A;  2VUM B;  4FYD A;  1JT8 A;  4IUP A;  3RN2 A;  1Q7Y C;  4IPD A;  4RCO A;  5C4H A;  2FMM A;  3QO2 A;  5CR3 A;  4P75 A;  3M4O B;  1F2Z A;  4KHV A;  4XXE A;  3G71 A;  4CDF C;  2LMC B;  1K8G A;  4FNF A;  4A3J B;  3T1H L;  1M1K C;  1ML0 D;  2NUC A;  4IJH A;  4O1N A;  2F0H A;  5DM7 3;  4A3D B;  1VQE A;  3D6W A;  1KNA A;  2E75 C;  1W3S A;  3CC2 A;  2MFI A;  4IFD J;  2EDG A;  3F2D A;  4EQN A;  1X55 A;  2PZT A;  5EAY A;  2PW5 A;  4JVZ A;  1SFO H;  4LF5 L;  3RR5 A;  3A5Z B;  4BXX G;  4YCV A;  5E3F A;  4CJ0 B;  2NVQ H;  4ZK9 B;  4DUY Q;  4I65 A;  4YHH L;  5M3F H;  1EIH A;  3ITP A;  3EN2 A;  2WFW A;  2F0I A;  2B2W C;  3H3V H;  2IX1 A;  2E2H B;  1YNX A;  1IHZ A;  3RUZ A;  3BJU A;  2EYJ A;  4UHV A;  3DWA A;  4OGQ C;  2HCI A;  2UUB L;  1EYC A;  1KTK A;  4IFD H;  4OIJ A;  2LXK A;  4FXG C;  1JOQ A;  1SRO A;  2QIL A;  1KC8 C;  1FJG L;  3H6M A;  2MHV A;  3FRP B;  2K03 A;  2ZTD A;  5AJ3 Q;  1HUM A;  1PH1 A;  1UE1 A;  2EJM A;  3G4S A;  1NCV A;  1NNX A;  3NBH B;  4H02 A;  4GKJ Q;  2D9U A;  2G9D A;  4C3J B;  3TRE A;  1YBY A;  5C5L A;  1D8L A;  3PUV A;  4HJ5 A;  3I4N B;  2OQK A;  4IOC A;  3RD4 A;  1CUK A;  4XT3 B;  2NB0 A;  1TWG B;  3EJI A;  2KEC A;  4K8I A;  3CKI B;  1BCP B;  3MEF A;  5I2X A;  4X6A H;  2CFM A;  1CSQ A;  1PZJ D;  4DV3 Q;  1O78 A;  2D0P A;  1JJG A;  1X32 A;  1CKN A;  1D6E C;  2WAQ G;  2A74 C;  2F4V L;  4KD3 A;  2NYZ D;  2A5H A;  4GNX A;  1A15 A;  2IT1 A;  1BCP D;  2Y0S G;  2YTX A;  3GTQ B;  2CH4 W;  4RWS C;  4GLA C;  4BS9 A;  3I91 A;  2EZV A;  3A8K E;  3M4P A;  1VQ9 A;  3U9S A;  3OW2 A;  4HSV A;  3GTK H;  2HDL A;  1E1T A;  2F0E A;  4XIG S;  5CMD A;  3TP5 A;  4IFD I;  5ELO A;  1RD9 D;  4U67 3;  2EJG C;  2JJQ A;  2VUM H;  1XYI A;  1XNR L;  4A3C H;  4B3T Q;  3QJY A;  2NZH A;  4ZQ3 A;  2H5X A;  1K8M A;  1WTP A;  4A3K H;  3QOL A;  2JA8 G;  4FDB A;  2RBM A;  1I6H H;  4HN7 A;  5ELC A;  3WOF A;  1JJ2 A;  5JPN C;  4QIW E;  4RGN A;  4A3F G;  4JI7 Q;  2KQ3 A;  3H0G B;  3A54 A;  3AB9 A;  3NQI A;  4A3J H;  4X64 Q;  3HOX B;  1IBM Q;  5DM6 3;  4HIO A;  3TQY A;  4ZRZ A;  3EQL C;  3OMG A;  4L5Q A;  5I2Y A;  1QUQ A;  2PMZ B;  4P72 A;  5KNC A;  4A3I B;  3LWE A;  3S14 B;  5LHY 1;  2EQS A;  5K36 H;  2XWB B;  2PZW A;  1EWI A;  1N33 Q;  3PV0 A;  1H9M A;  4K14 A;  2EXD A;  2WB1 G;  4LFB L;  1TY2 A;  2FMC A;  4DAY A;  1VCI A;  3VA5 A;  2Z0S A;  4RMF A;  5D14 A;  4J15 A;  2F3V A;  2PQA A;  3CPW A;  4QMG A;  1VQ6 A;  1ICW A;  2E2H H;  3VR3 A;  5FJ8 G;  4DGZ A;  4DR2 Q;  4K2L A;  2MNA A;  1PVO A;  2J7Z A;  4CDD C;  3V05 A;  4X66 Q;  3GTJ H;  5GRO A;  1Q1E A;  2XVS A;  4KY6 A;  3VYT A;  4R9W A;  4DUZ Q;  2A1A A;  4HJ9 A;  1XNQ L;  4AYB E;  4UDU C;  2RA4 A;  4RKB A;  5JPM C;  5IT9 E;  1DD2 A;  1RF2 D;  2Z6K C;  1ILQ A;  3URY A;  1N32 Q;  3HOV B;  4DV5 Q;  4C3J H;  3W3A A;  3UDI A;  1FGU A;  1SNQ A;  4C1N I;  1DOM A;  1H9J A;  3I4N H;  3FVQ A;  3I4O A;  3A8I E;  5FO7 B;  2ZT9 C;  4ID6 A;  4FO2 A;  1NY4 A;  1TWG H;  3TP6 A;  1GUT A;  1O7Y A;  4EVO A;  2KVM A;  3CQZ B;  5IYB G;  3AU7 A;  1IZ6 A;  2C35 B;  3BYY B;  3V96 A;  1GD7 A;  1YIT A;  2N3S A;  4BWG B;  3CF5 A;  1QZH A;  3J80 i;  1ICF B;  2Z4I A;  4LUV A;  5JEA J;  3GTQ H;  1Z7T A;  4BY7 G;  2XTI A;  3J7Y W;  1KNE A;  3EVQ A;  4LF8 L;  4IPC A;  2JA5 B;  5IYC G;  2EYM A;  2K52 A;  1TU2 B;  3J7Z C;  3K7U C;  4YWM A;  3T1H Q;  1BXT A;  2D62 A;  2CQA A;  5M3M H;  4JBM A;  1YEZ A;  1GUW A;  1MD2 D;  1PZK D;  4IUQ A;  3J81 i;  2F3I A;  3GTO B;  5IOC A;  1D5Z C;  2BE5 C;  3PQI A;  4QUF A;  4LF5 Q;  2WAQ B;  4F87 A;  3H0G H;  2B2V A;  3HOX H;  1S72 A;  2K04 A;  1I6V C;  4YHH Q;  3BDO A;  1V9P A;  2KED A;  2PI2 E;  2B8F A;  1A0I A;  3S14 H;  2F0N A;  2CKZ B;  1GM5 A;  2RKS A;  3VDY A;  3S15 B;  2A6E C;  2CW0 D;  4K0K L;  4PZ7 A;  3VR6 A;  2UUB Q;  2EYL A;  1TQO A;  4QUC A;  4F7X A;  2E5L L;  3SGI A;  4XTC S;  3BVM A;  1FJG Q;  1HNZ L;  4K8J A;  1Q86 C;  3FMC A;  5F2D A;  1H9S B;  1LTI D;  1VQF A;  4A3F B;  2A69 C;  1CKO A;  5KEE A;  4JBW A;  3TSS A;  2PI2 A;  2O5J C;  5D3I B;  4XDX A;  1YNN C;  1KXL A;  1XWE A;  4NMZ A;  1FL0 A;  3WOE A;  4L5T A;  1STY A;  1ILP A;  2JEB I;  2KOL A;  1FR3 A;  1AE2 A;  3ONA B;  4R8I A;  2OT2 A;  1I94 Q;  4X3T A;  2AKW B;  1I4H A;  4O2D A;  2XWJ B;  1JWS D;  3M4Y A;  3HOZ G;  4BXX H;  2A68 D;  4R4C A;  5K5P A;  4H13 C;  4G7Z C;  3HOV H;  1VS0 A;  3KUP A;  3HP3 A;  1VQB A;  1STE A;  2F4V Q;  1IKM A;  2JYO A;  3DHQ A;  4BA1 I;  2K5W A;  1GHK A;  2ZXR A;  1YHA A;  4K5W A;  2CCZ A;  2UXD L;  2B2U C;  4NB3 A;  3M9B A;  3CQZ H;  2L55 A;  2HQE A;  1I50 B;  3K57 A;  4PMW A;  1ENC A;  1L0Y B;  1EQQ A;  1PTO B;  1LTA D;  1XNR Q;  3TDQ A;  3MC0 B;  5A2Q L;  4CJ1 B;  1YI2 A;  1X3E A;  4UP9 A;  2IHE A;  4JI5 L;  5C3E G;  1S5B D;  3OW7 A;  4KY5 A;  2IX0 A;  3TN2 A;  1UWV A;  1PFM A;  2JA5 H;  1B3A A;  3C2P A;  5IGG A;  1EY8 A;  1G29 1;  1PTO D;  1UEB A;  2R7Z B;  1D1I A;  2X69 A;  3NEM A;  4QL5 A;  1VQM A;  2R7D A;  1V1P B;  1F9S A;  1Y1V B;  4JBK A;  3ULL A;  3TS2 A;  2R93 G;  2K5H A;  2LXJ A;  1L1O C;  2DJF C;  3FP9 A;  5JJZ A;  1Y1W G;  3MXG A;  1SMX A;  2BA0 A;  3GTP B;  3DEP A;  4LFA L;  3ND8 A;  4HMJ A;  4LFB Q;  3A56 A;  3NBH A;  4CGY B;  4MN3 A;  5GAG C;  3HKS A;  1JE4 A;  3TS0 A;  3UDF A;  1IKL A;  1V1Q A;  4BY7 B;  2CHB D;  3KJO A;  4BBS G;  1JQY D;  4C3I G;  3S15 H;  2PYK A;  4AQY Q;  4N9P A;  3FKI G;  2AMC B;  1F2M A;  4YY3 L;  4NP5 A;  1EWC A;  5HGT A;  4RGT A;  1BF4 A;  1O7I A;  5COR A;  1HTP A;  1PXU A;  2F0U A;  1QZG A;  2RDG A;  3E5S A;  3KF8 B;  1BDO A;  2Q8T A;  1XNQ Q;  5C44 G;  2JA8 H;  2KA7 A;  5EKI A;  2ES2 A;  4L5S A;  2EJF C;  3A55 A;  4A3F H;  4X3K A;  2AUK A;  1GOZ A;  1RDP D;  1GUO A;  4N9T A;  3DM3 A;  4L5R C;  3DM1 A;  4GOP C;  1WYD A;  2EY2 A;  4OEL B;  3AQQ A;  1IBL L;  3SK5 A;  1M90 C;  4OWW B;  1N9W A;  1A8V A;  1BKB A;  4R8N A;  2VZA A;  2PMZ E;  4K6L A;  1KDA A;  3T13 A;  5A35 A;  5J3B A;  2VB3 X;  3GQB A;  4A3M G;  4DNT B;  1A3T A;  2J0T D;  1RHP A;  4RHS A;  1JOK A;  4IAL A;  5M9O A;  2SNS A;  1VQ8 A;  4DV3 L;  3ULP A;  4HSP A;  5EBC A;  2JXM B;  1A6X A;  1SJE D;  2UXC L;  3PF4 A;  5FJ8 H;  2CWA A;  4H44 C;  5EKL A;  2NWG A;  2JA6 G;  1J6Q A;  5C0X J;  2Q8I B;  1TS2 A;  2I5M X;  5KND A;  1KRS A;  1QIL A;  3K7A B;  1I50 H;  1UE6 A;  1PTO H;  1SNC A;  3F8T A;  3I4L A;  5T1I A;  3STB C;  2PNH A;  4A3E G;  1Q8I A;  3HOZ B;  3GTM B;  3CCE A;  2QKI C;  4JOI C;  1ROD A;  3GO5 A;  2UUC L;  4NPS A;  1R4Q B;  5C4J H;  2DJG C;  4JW0 A;  4AYB B;  2R7Z H;  2Z9H A;  3WWV A;  2HDM A;  1ASY A;  3FEW X;  3NXW A;  2E74 C;  1VQN A;  1STB A;  1Y1V H;  3D6C A;  3DEO A;  4TQU S;  4FF1 A;  3VYS A;  4K0K Q;  3GTP H;  1LUZ A;  2K01 A;  5DLQ E;  2K14 A;  1TY0 A;  2MPM A;  5CC4 A;  3MFG A;  1B9M A;  1PYS B;  2YYZ A;  1LTT D;  1B50 A;  1IW7 C;  3M7G A;  5C3E B;  3BS1 A;  2FJ2 A;  2E5L Q;  1STA A;  4BY7 H;  3I4M G;  1C7Y A;  1WVL A;  4J8Q A;  2B2T A;  1HNZ Q;  1SRU A;  1KAW A;  3UDG A;  5IYC H;  4BY1 G;  3TRZ A;  1NE3 A;  1TWA B;  3VYR A;  2O4X A;  3BU2 A;  1SXT A;  1CHP D;  3RLO A;  4ULL A;  5EPJ A;  1VMC A;  2BH8 A;  2K1B A;  4BBR B;  5ISR A;  2WAC A;  1B3Q A;  4A3L G;  1T5E A;  1XPO A;  3HOY G;  2I5L X;  5CV9 A;  1U4R A;  2WAQ E;  2EXZ A;  4QCL A;  1EY6 A;  3E3X A;  1EQR A;  5FO9 B;  4CHT B;  1MSG A;  3KFU A;  5IP9 H;  2IW3 A;  2Y0S E;  2RCN A;  3W5O A;  5A2Q E;  1WJJ A;  4KMU C;  3KDF B;  4BBS B;  4C3I B;  4CDC C;  4OIK A;  1EY7 A;  1HR0 W;  4EQO A;  2UXD Q;  4LF4 L;  3MXN B;  3FKI B;  3DLL A;  3T1Y L;  1MKH A;  3M7N A;  1EOT A;  4LNQ A;  3L0O A;  5KRU A;  2WV6 D;  3F2U A;  3QWN A;  3GTK B;  4DK1 A;  4FF2 A;  1HZ9 A;  3S1N B;  1O7L A;  2K75 A;  4JI5 Q;  4OEM B;  1HXY D;  1KRT A;  3NSW A;  1JWU D;  3NTI A;  4DV2 L;  4DFA A;  4JV5 L;  4GNX C;  3S1R B;  2JQO A;  3CW2 C;  3K7A H;  5IWA L;  1SDF A;  4TVA B;  4A3K B;  2L0C A;  1SE3 A;  1I6H B;  3S2D B;  4JCV E;  4IPG A;  3UE1 A;  3NBI A;  1N8R C;  3GTM H;  3HOZ H;  3SXH A;  3KJP A;  2WB1 E;  2JA7 G;  2GVA A;  4CDE C;  4ODG A;  3PCO B;  3CP0 A;  4GKK L;  1H9S A;  1UEA B;  1U9R A;  4LFA Q;  4DR7 L;  1KLU D;  1U4L A;  1N36 L;  5I9P A;  1VQK A;  1EEF D;  1PRT B;  4RAU C;  2OTL A;  2ICE C;  3ERO A;  4PZ6 A;  1GUN A;  2JA6 B;  3A5U A;  2F0S A;  3RLF A;  4OON A;  3SE0 A;  2EYH A;  4LJZ C;  3I72 A;  4XQJ A;  2M2L A;  4YY3 Q;  1DJR D;  2R6G A;  3KF6 B;  1WI5 A;  5LMN L;  4POF A;  1UAP A;  1PRT D;  4L8J A;  1LLR D;  1SAP A;  1LAB A;  4GS3 A;  2G5D A;  2KBN A;  3C1F A;  5C3E H;  2QCP X;  5KIX A;  1H9K A;  4WJW A;  3VYU A;  3VR5 A;  3GTJ B;  2BCO A;  4GN3 B;  1DON A;  1DGS A;  3OHX C;  3PUY A;  3H94 A;  4Q0F A;  5EQ0 A;  4A3B G;  1TWA H;  2A19 A;  1IBL Q;  1MIU A;  2C9O A;  1A63 A;  3PUZ A;  1FYC A;  4BBR H;  3W1B A;  4R4O A;  1Y1W H;  4C2M H;  3LX0 A;  4LK1 C;  4ALP A;  1I94 L;  3FHW A;  4PG3 A;  1JWM D;  4CKC A;  5M5W B;  5IGF A;  3JAM L;  2EVB A;  1WCM B;  5M5X B;  2RF4 A;  4M1U B;  2WP8 J;  4DR5 L;  2VS1 A;  2NBF A;  1WFQ A;  2K33 A;  1SNO A;  5HY6 A;  3PF5 A;  2NVX B;  3I4M B;  4BBS H;  3TZU A;  4C3I H;  2UXC Q;  4BY1 B;  1Y69 U;  2XRS D;  3CME A;  1ET6 A;  1V1P A;  3FKI H;  2ZJR A;  1AH9 A;  3A8J E;  4OL7 A;  4NKL A;  2A6E D;  3H3V I;  1G91 A;  3D0F A;  4IOA A;  3PUW A;  5FKA C;  3RZD B;  3HEJ A;  5COY A;  1TS3 A;  4B3S Q;  1HJP A;  1Q1B A;  5C44 H;  1X56 A;  3E9H A;  1V8Q A;  4RGO S;  3S1N H;  4JBJ A;  1EY0 A;  1U5K A;  4A93 G;  1Q90 A;  2K4K A;  4DK0 A;  3EIV A;  3PSI A;  5IGB A;  1K9M C;  2UUC Q;  4DXF A;  1VQJ A;  5M3M B;  3S1R H;  2A69 D;  3P75 A;  3HOW G;  3J81 E;  1F2Y A;  1Z47 A;  3F1Z A;  1YNN D;  1BOS A;  1Q8K A;  3Q8D A;  3S2D H;  4DXG A;  1G6P A;  1EYD A;  3I73 A;  3CRL C;  3CAM A;  2EY1 A;  2K5D A;  1ZYR C;  4A3M H;  2D2C C;  2JN4 A;  5G3L F;  3K81 C;  4PMB A;  3KF8 A;  1CI3 M;  1BNZ A;  2E2D C;  1IYV A;  2AHO B;  1TWF B;  1T5X D;  1VQC A;  4ZAI A;  2E2I B;  2AQ3 B;  4GLX A;  4A3G G;  3RLN A;  2ZTE A;  2H4O A;  4DR1 L;  1K3B C;  1XTC D;  4FP5 D;  5IP7 G;  2JA6 H;  1UE5 A;  3AEV A;  2B2V C;  2Q2I A;  4G57 A;  4GN4 B;  1KDC A;  1J8I A;  1S40 A;  5ELD A;  2AWN A;  1HA5 A;  4OX9 L;  4GLV B;  2B2W A;  1OXX K;  1LAC A;  3HKZ G;  4MTK A;  4A3E H;  1K8O A;  1KAA A;  4AQY L;  3TP8 A;  3X3M A;  1IYU A;  1D2B A;  1NUC A;  5J39 A;  5JOB A;  2JA7 B;  2IY5 B;  1B70 B;  2KHI A;  3E9I A;  4JYA L;  1ONL A;  1WTX A;  1CQV A;  5IT9 c;  4LF6 L;  2EYP A;  3NTK A;  1JOO A;  2VQF L;  4WJ3 M;  3OWE B;  2AWO A;  1LT5 D;  1GO3 E;  3L3O C;  3KK7 A;  5KYL A;  1VQ7 A;  5FOB B;  3K58 A;  2WIN B;  2H1E A;  3R3O A;  4LF4 Q;  1NTG A;  1AEX A;  2PCF B;  3T1Y Q;  1I5F A;  5C0X G;  5M5W H;  1JCK B;  2FHT A;  5DNF A;  1WCM H;  5M5X H;  4KK7 A;  2NVX H;  1B9N A;  3I4M H;  4PMC A;  2RSO A;  4APV A;  2KJX A;  3ULJ A;  3T16 A;  3CCJ A;  4BY1 H;  3PO3 G;  3DWQ A;  2NN6 G;  2F0P A;  4A3B B;  1FGB D;  5GQO A;  3ZJY C;  4DV2 Q;  1OXS C;  3H91 A;  4JV5 Q;  4HAE A;  2EYO A;  1WTR A;  5IWA Q;  3RZD H;  1L2F A;  1MJC A;  5CV4 A;  4GOP B;  5CBA E;  1SBB B;  1SSO A;  4A3L H;  4C3H G;  4PZ8 A;  1YHQ A;  1IXR A;  2YU9 B;  2QDB A;  3P20 A;  4HR7 B;  4DV1 L;  2R3Z A;  2F1M A;  3D4D A;  2F0L A;  1ZXT A;  4RCN A;  4GKK Q;  4EX5 A;  3KBX A;  4JG2 A;  4DR7 Q;  4HJ7 A;  1TWC B;  1N36 Q;  2I0Q A;  1O80 A;  2ICI A;  2JA9 A;  1EFW A;  1G8Z D;  1SYG A;  2M00 A;  2IPK D;  3S16 H;  5JEA H;  3KOJ A;  2F0W A;  4N8X 1;  1F9P A;  1O7Z A;  2Y0S B;  2K28 A;  2K5N A;  3NWS A;  1HNW L;  1TWF H;  4LW1 A;  2G9H D;  2E2I H;  3VA7 A;  1QNU A;  4KHZ A;  1W6K A;  5LMN Q;  1MSH A;  1STG A;  3KLR A;  2VQE L;  3HOU G;  4AH6 A;  2QEX A;  4A93 B;  3W2D A;  1TWH B;  1M8A A;  5FLX L;  1VQI A;  4WOR A;  2VL6 A;  1QVG A;  4Y52 H;  1MHW C;  2WKC A;  3KDF A;  5EPK A;  4C56 C;  3HOW B;  3JAM E;  3NP8 A;  5JVH 3;  3MXN A;  1SEB D;  3CC7 A;  2JA8 B;  2BDO A;  2D0O A;  2R61 A;  2WKD A;  3J7A V;  2F0O A;  2RHS B;  3ER0 A;  5LL6 X;  5IGD A;  2JA7 H;  3J7A 5;  1TII D;  5JJI A;  3QG1 A;  5AFW A;  1KD1 C;  4PQX A;  1CFM A;  5CBE E;  3CPF A;  1S5C D;  4A3G B;  1PYW D;  1KLG D;  1OXT A;  4HCS A;  4Z9C B;  4DR5 Q;  3I90 A;  2WB1 B;  4JI2 L;  2F0D A;  1ET9 A;  3CRK C;  1QVF A;  3FDT A;  2NVT B;  1GXD C;  4DV7 L;  3O13 A;  3GD7 A;  3HZX A;  2EIF A;  3HKZ B;  1PMR A;  5BN4 A;  5EJW A;  4DR6 L;  3BDC A;  3I55 A;  3R2I A;  4V0B A;  2X6G A;  5IGE A;  3J81 j;  2KCN A;  5E4X A;  3I8Z A;  4A3B H;  2L1B A;  3Q0A A;  1Q12 A;  3K0X A;  3Q24 A;  5E7N A;  2A6H D;  4FF3 A;  1GKH A;  4FVM A;  5I6W A;  5BR8 L;  1A2T A;  1Y14 B;  3KF6 A;  5C4J B;  1J9O A;  2LY7 A;  2RSN A;  5M3F G;  2YU9 H;  4G7H C;  3QB3 A;  3J7A F;  4QQB X;  1AFP A;  1YIJ A;  3R8B A;  3U58 A;  1KAB A;  2QGQ A;  4IN3 A;  1P8L A;  1B53 A;  4GN5 A;  5C4Z A;  1XTD A;  4KJO A;  4DA2 A;  1TWC H;  4IUN A;  2K7V A;  2ZJQ A;  2F0J A;  2PZU A;  4DR1 Q;  3OTO Q;  2LKV A;  4FXK C;  1FD7 D;  1YHB A;  2N55 A;  2DNC A;  5E4W C;  4CKB A;  3OPO A;  4DV6 L;  1XMO L;  1BO0 A;  3QIA A;  4X65 L;  4UAI A;  2PW7 A;  3GTL B;  1A62 A;  1TS5 A;  1KDB A;  4OX9 Q;  3SR1 A;  1IBK L;  1PH3 A;  1M4V A;  5M5Y B;  2SDF A;  2ASB A;  1SN8 A;  4A93 H;  1HRJ A;  1TWH H;  2OTJ A;  3UE0 A;  3NEN A;  4JI6 Q;  5I6Y A;  1X6O A;  4JYA Q;  1DZ1 A;  2ZTC A;  3CU7 A;  4LF6 Q;  3D31 A;  3HOW H;  1WTH A;  1SMY D;  4KKU A;  1VQ4 A;  1QOH A;  2VQF Q;  5TSS A;  4NXM Q;  2F0F A;  1XXG A;  1U4P A;  2F0M A;  4ZKB B;  1QVC A;  4NW2 A;  3NWT A;  2K32 A;  5HUR A;  3GV6 A;  3ZYY X;  1PFN A;  1RL2 A;  2B39 A;  4P2C B;  1NR4 A;  1S3O A;  3F2B A;  2GVB A;  1SYD A;  4LAA A;  4KKS A;  1S5D D;  4JI0 L;  3PO2 G;  2IL8 A;  3K5O A;  4A3G H;  2F03 A;  4KHP L;  3HOU B;  1SNM A;  5IP7 H;  4ZUJ A;  3PGZ A;  4QB4 A;  2HHH L;  4NXN L;  2I07 B;  2VUM G;  2NVT H;  3AYH B;  4HCE A;  3N6R A;  1EY5 A;  2EPB A;  4DKA C;  5D65 A;  3C46 A;  4OWX B;  4X3U A;  3W1G A;  1PH2 A;  2DUD A;  2N88 A;  1BBW A;  2B2U A;  2PQE A;  1E2Z A;  3A7A B;  1I4X A;  4NDX A;  1XX8 A;  1ESR A;  4A3J G;  2M9V A;  3TME A;  1PH5 A;  2J4X A;  2JK8 A;  4RHR A;  1VQG A;  1T9H A;  4B3S L;  4A3D G;  2CW0 C;  4B08 A;  4JI1 L;  3M85 A;  1EZ6 A;  4DV1 Q;  3MA2 B;  5K36 G;  5FLX c;  1D5M C;  1SYE A;  3EA6 A;  1VF7 A;  1EFI D;  1Q82 C;  3ICE A;  1GHJ A;  1X54 A;  1SYF A;  2XIW A;  1YZ6 A;  5FLX E;  3J80 L;  3AFQ A;  4MHE A;  4XT1 B;  1JOR A;  4LF9 L;  1AZQ A;  2SOB A;  1XMQ Q;  1UE7 A;  5C0X H;  1EIY B;  1ENF A;  1SE8 A;  1HZC A;  4JC0 A;  1K28 A;  2N8N A;  1HNW Q;  1CZG A;  4DK3 C;  5IYB H;  1S5E D;  2F3W A;  3BZK A;  1R4P B;  1PYB A;  5I4D A;  2VQE Q;  5C3X A;  3P7J A;  1F77 A;  4JI4 L;  5CV7 A;  2HIV A;  3OOC A;  2OF1 A;  3DXJ C;  3J81 L;  3H15 A;  2A68 C;  4JI8 L;  1YNJ C;  3F2C A;  3EFX D;  3SK4 A;  3GTL H;  2LFN A;  1V43 A;  1L0X B;  3A0J A;  1CSP A;  4A76 A;  3MWY W;  2B3G A;  2CQO A;  2EYF A;  3JC6 6;  2IX3 A;  1E7Z A;  3HGB A;  4C3H H;  5M5Y H;  5GAE C;  3CXC A;  3M3Y B;  2MGS A;  1HUN A;  5CV6 A;  1QCB D;  2NTT A;  1PFB A;  2R93 B;  1Y1W B;  2B2Y A;  1QWY A;  2BOS A;  4TKO B;  4P73 A;  2QDL A;  4C2M B;  1X3G A;  4QF4 A;  1HFN A;  4IPH A;  1ZKO A;  4JI2 Q;  3NUC A;  4LUO A;  2Z6B A;  2L4N A;  2E8G A;  2F4I A;  1N34 L;  4OO1 G;  1LTG D;  4GOP A;  1RKN A;  3G6J B;  3KLS X;  3SEB A;  4XQN A;  4DV7 Q;  5C0X I;  1ZYR D;  1VQ5 A;  2MUY A;  5CV5 A;  4IUU A;  4L63 B;  1C48 A;  4DAM A;  1PTO C;  3BZD B;  2KCC A;  3K8A A;  3T53 B;  3HOU H;  2EY6 A;  3NEL A;  4F88 A;  4DR6 Q;  3AFP A;  5C5M A;  3V2T A;  3TP7 A;  5EBD A;  3BVZ A;  2F0T A;  4KKT A;  2UXB Q;  2TSS A;  1UNS A;  1VDZ A;  2PPB C;  3G7L A;  2FIN B;  2MP1 A;  1J5E L;  4OXP A;  4DN4 M;  3GV3 A;  5C44 B;  4POG A;  4M8A A;  4IUT A;  1JJC B;  2RCF A;  3G48 A;  4P74 A;  4ZCK A;  4DV4 Q;  1X9N A;  4A75 A;  5BR8 Q;  1SNP A;  2N78 A;  1CZW A;  3ND9 A;  2HT1 A;  3D3R A;  1JB3 A;  3LNN A;  3IAY A;  1KHI A;  5ELN A;  3PO2 B;  2B63 G;  3TZD A;  4A3I G;  1NSN S;  1FNU A;  3I3C A;  2VY3 A;  1EY4 A;  1FNV A;  4A3M B;  4WRD A;  1TT2 A;  2B29 A;  3B6Y A;  3FPP A;  4J6H A;  4B9W A;  4DV6 Q;  1PV4 A;  5FK9 C;  4RA8 A;  1XMO Q;  3GTG B;  2Q2T A;  3K59 A;  4WFN 3;  1EL0 A;  3HKZ E;  4V19 0;  1EUJ A;  4X65 Q;  3U9O A;  4ME3 A;  2QA4 A;  2RQX A;  4G7O C;  1MBY A;  3CC4 A;  3S1M B;  1ASZ A;  2KHJ A;  1K73 C;  2MO0 A;  1IBK Q;  2SNM A;  2TMP A;  2F52 A;  4B3R L;  1Z6H A;  1HA6 A;  2AQ1 B;  3IFT A;  4B9X A;  2XRQ D;  2DN8 A;  1YJN A;  1CT1 D;  2NZ1 D;  4R4Q A;  5HGQ A;  1EZ8 A;  4HJ8 A;  3M4Q A;  4A3E B;  4HIK A;  4DV0 L;  4DR4 L;  1PRT F;  2UUA L;  2OEO A;  4JK1 C;  2DGY A;  3VR2 A;  1OXU A;  3CCR A;  3HOV G;  1EY9 A;  4DPG A;  1I3Q B;  1B7Y B;  3M3Y H;  1PH6 A;  4R1J A;  3QOJ A;  1YJW A;  1B1Z A;  2JE6 I;  1GJX A;  1JC7 A;  3BG3 A;  2LSS A;  4IO9 A;  2R93 H;  4R4I A;  4P71 A;  3IFD A;  4JI0 Q;  1K0S A;  3R2T A;  1ZEQ X;  4KHP Q;  2KHS A;  2KCM A;  1EYG A;  2R7F A;  1A2U A;  4LUZ A;  2CH4 A;  5J1Z A;  1Y8N B;  2HHH Q;  4NXN Q;  3PMF A;  2BE5 D;  3CHB D;  4HID A;  1D5X C;  3J80 c;  3UDX A;  2UU9 L;  1BBX C;  3MXP A;  1MJE A;  4KTA A;  2JA5 G;  3C3L A;  2N49 A;  1G6Z A;  3J80 E;  3GDE A;  1HNX Q;  3A7L A;  4UY8 C;  1D1K A;  1DM0 B;  4O0A A;  4PV1 C;  1EU3 A;  5ELB A;  4UPA A;  1BCP F;  2RDH A;  4JI1 Q;  4KN7 C;  3HOY B;  2E2J B;  1CKM A;  3BZC A;  2YTY A;  3GP7 A;  4R4T A;  3J81 c;  4BA2 I;  1I4G A;  1HTL D;  1Y8P B;  2OQ0 A;  4PNY A;  5C6A A;  1VQL A;  1JIC A;  1E0B A;  3R93 A;  3BVG A;  4TSS A;  5C4X G;  4LF9 Q;  1STH A;  3PO2 H;  3CCL A;  4MNO A;  3H3V C;  1EYA A;  4ILW A;  1HCZ A;  4IUV A;  3U50 C;  2HUG A;  4HTH A;  3S16 B;  4DAV A;  2Q2H A;  4UP7 A;  4HED A;  1E1O A;  4DNR B;  5IYD G;  3CCV A;  2O2L D;  1IYJ B;  4X62 Q;  1VQO A;  4XYQ A;  4JI4 Q;  1FVI A;  3OYY A;  1NAP A;  3GTG H;  4JI8 Q;  3OTO L;  2MO1 A;  1MI2 A;  4HJA A;  1SE2 A;  3E0J A;  3M4O H;  1B2T A;  1XPU A;  1GUS A;  1K0R A;  1RTO A;  2K5V A;  3S1M H;  2XGT A;  1TXY A;  5G3L D;  3CMA A;  1PHJ A;  3MAQ A;  2P5Z X;  2F0Q A;  4E6I A;  4B3M L;  1Z9F A;  4A3D H;  5JJL A;  1LTL A;  2B63 B;  1DXM A;  3AMU A;  2QW7 A;  4F8M A;  3MVV A;  2HQL A;  3DUZ A;  3N52 A;  3Q23 A;  5JVG 3;  5CGK A;  2O5I C;  4JI6 L;  3KYH C;  2BH2 A;  2CVR A;  1VQP A;  3I56 A;  1I4Q A;  4DNI A;  5EGT A;  1L1O B;  2Q2U A;  1I3Q H;  4NXM L;  1N34 Q; 
#chains in the Genus database with same CATH homology
 5IIF A;  5EPL A;  5DEH A;  4J1M A;  5E1F A;  4ZLT F;  3FPU B;  1X3P A;  4CJ2 C;  2DNE A;  1SJH D;  1S5F D;  1CA6 A;  2V4D A;  2FFK B;  2PNR C;  1B4O A;  2L11 A;  1EEI D;  1AP0 A;  4K6D A;  5I9O A;  2Z4H A;  2OXP A;  4FF4 A;  4ME5 A;  2ENB A;  3RMH A;  1OXV A;  2F0K A;  1ESF A;  1H9R A;  3TBI B;  2F0V A;  2RVL A;  5C3W A;  2VB2 X;  3K5N A;  2I46 A;  1IL8 A;  3K0Y A;  4ZUI A;  1I4R A;  1LV9 A;  3K6O A;  1PRT C;  4OO1 H;  1QJO A;  1NR2 A;  2HCC A;  1K83 B;  2QEJ C;  2ZXP A;  1C4Q A;  5LL6 S;  5IOD A;  1CA5 A;  1AN8 A;  2EOT A;  1GUG A;  3ERQ A;  1OO9 B;  1DOK A;  4K2K A;  1CHQ D;  3NTH A;  3OSO A;  1C8C A;  1SYB A;  3HRZ C;  1PDQ A;  1G2S A;  4ZYS A;  3S9W A;  1LT4 D;  1B44 D;  4I7Z C;  3OIP A;  1QB5 D;  2KUM A;  4O42 A;  5NUC A;  5C4X B;  5JAV A;  5IGC A;  1HQM C;  1TVX A;  1EWH A;  2LS0 1;  1WTO A;  4Q5V A;  1DYQ A;  4X3S A;  1BCP C;  1EQT A;  3S1Q B;  4L6T B;  3X3N A;  3PIP 3;  2RDF A;  4XYO A;  4U68 A;  2EE1 A;  2VXW A;  4OO1 I;  3T4A C;  1VMP A;  3SHL A;  2NVY B;  2DY8 A;  4Y7N B;  1QG7 A;  1MGS A;  1TKW B;  2Z8L A;  2B8G A;  3HS0 C;  3SDZ A;  1LTR D;  2L12 A;  1SND A;  1QE6 A;  2KEE A;  3C1E A;  1A3U A;  3D4R A;  1TR5 A;  1YNJ D;  1SYC A;  2BA1 A;  1R9T B;  1RJT A;  3MXU A;  1I4P A;  1IW7 D;  2WII B;  4YIJ A;  4TRD A;  3NQT A;  1X3Q A;  1PLF A;  1BR9 A;  2X6L A;  3T51 B;  1BUV T;  4KN4 C;  3UI2 A;  4KY7 A;  2NTS A;  4IUR A;  1UUP A;  1PTO F;  3D8G A;  1F9R A;  2AQ2 B;  4ABN A;  5J22 A;  2R92 B;  3IL8 A;  4MIU A;  3NPP A;  4KV6 A;  3NK9 A;  2E76 C;  5T1G A;  4RKL A;  3SVM A;  4IFD G;  3PO3 B;  3RZO B;  2ZXO A;  2PO4 A;  3MZ5 A;  1LO5 D;  3OMC A;  5ELE A;  1STN A;  2JSO A;  3S2H B;  4EQP A;  4C3H B;  1PZI D;  1FNW A;  3Q22 A;  5KYI A;  4CKE A;  3H09 A;  1EQV A;  3PIO 3;  4G4K A;  4FXD A;  2B2T C;  3S17 B;  2BDN A;  1W6J A;  1JR0 D;  1CQF A;  1EU4 A;  1CTM A;  4S3S A;  1WTW A;  1V1O A;  4RGM A;  3WDN A;  2K05 A;  3E6Z X;  3I70 A;  2B2Y C;  1QNK A;  3LWU A;  3NHH A;  3SK6 A;  2C5C A;  4GZY C;  3DMU A;  3BDL A;  4H7B A;  4OHJ A;  1ENA A;  1F2L A;  2MJ8 A;  2Q8R E;  1Y8O B;  5ELF A;  2JP1 A;  1E2W A;  3K5M A;  3KLS A;  4QIW B;  4DF7 A;  1AZP A;  1HQR D;  2XSC A;  4RFB A;  1CM9 A;  1II3 A;  1F9Q A;  3D4W A;  2ID0 A;  3HG9 A;  2K5Q A;  3P1H A;  5KGU A;  4RH6 A;  3PUX A;  4KJN A;  3L9A X;  4H0L C;  1TS4 A;  3MTS A;  3DWP A;  1U4M A;  3Q6S A;  5KNB A;  1VF5 C;  5BN3 A;  1LTB D;  3MHB A;  2F0G A;  1HHV A;  4C1N K;  1LTS D;  1HPC A;  2NN6 H;  4IQZ A;  1A3V A;  3VR4 A;  2A73 B;  2D5D A;  3MEH A;  1SFO B;  2DY7 A;  1E2V A;  2NVQ B;  3SK8 A;  2L9H A;  5BN5 A;  4C3J G;  3MFY A;  5M3F B;  1SE4 A;  1LT3 D;  5D3D A;  4DAP A;  1RCV D;  2SEB D;  3OWF A;  3BYT B;  3K5L A;  2IWH A;  1S4Z A;  4ZKC B;  2VNU D;  4HMI A;  1RTN A;  4K5V A;  2A6H C;  1WD0 A;  3OIQ A;  1WTV A;  2QF7 A;  1Q3L A;  1DOL A;  3L7Z C;  1AW7 A;  4K5X A;  1DCZ A;  2AUJ D;  4LMQ D;  2XNA C;  4XQQ A;  4CBV A;  5DAU A;  4DU9 A;  1EIG A;  5CV8 A;  2K6A A;  1BQQ T;  4EGV A;  2NN6 I;  1WTQ A;  5CYU A;  2EY5 A;  4KI0 A;  4KD4 A;  2GA4 B;  5FO8 B;  1HFG A;  2IJ0 A;  2XN9 C;  3T56 B;  2JEA I;  2L5T A;  4IZ8 A;  5JEA G;  3NE5 B;  2Z1C A;  3KBG A;  1CK1 A;  5IT9 L;  1LT6 D;  1WD1 A;  3IKJ A;  1G2T A;  1SMY C;  5EKK A;  2VUM B;  4FYD A;  4IUP A;  4RCO A;  5C4H A;  2FMM A;  3QO2 A;  5CR3 A;  3M4O B;  1F2Z A;  4KHV A;  4XXE A;  2LMC B;  4FNF A;  4A3J B;  1ML0 D;  2NUC A;  4O1N A;  2F0H A;  5DM7 3;  4A3D B;  3D6W A;  1KNA A;  2E75 C;  4IFD J;  2EDG A;  4EQN A;  2PZT A;  2PW5 A;  5E3F A;  4CJ0 B;  4ZK9 B;  4I65 A;  1EIH A;  3ITP A;  2F0I A;  2B2W C;  2IX1 A;  2E2H B;  3RUZ A;  1IHZ A;  2EYJ A;  3DWA A;  4OGQ C;  2HCI A;  1EYC A;  1KTK A;  4IFD H;  4OIJ A;  4FXG C;  1JOQ A;  2QIL A;  3H6M A;  2MHV A;  3FRP B;  2K03 A;  1HUM A;  2EJM A;  1NCV A;  2D9U A;  2G9D A;  4C3J B;  5C5L A;  3PUV A;  3I4N B;  3RD4 A;  4XT3 B;  2NB0 A;  1TWG B;  3EJI A;  2KEC A;  4K8I A;  3CKI B;  1BCP B;  5I2X A;  1PZJ D;  1O78 A;  1X32 A;  1D6E C;  2A74 C;  4KD3 A;  2NYZ D;  2A5H A;  1A15 A;  2IT1 A;  1BCP D;  3GTQ B;  4RWS C;  4BS9 A;  3I91 A;  2EZV A;  3A8K E;  3U9S A;  4HSV A;  5CMD A;  2F0E A;  2HDL A;  4XIG S;  3TP5 A;  4IFD I;  4U67 3;  1RD9 D;  2EJG C;  1XYI A;  3QJY A;  4ZQ3 A;  1K8M A;  1WTP A;  3QOL A;  2RBM A;  4HN7 A;  5ELC A;  3WOF A;  5JPN C;  4RGN A;  2KQ3 A;  3H0G B;  3A54 A;  3AB9 A;  3NQI A;  3HOX B;  5DM6 3;  4ZRZ A;  3EQL C;  3OMG A;  5I2Y A;  2PMZ B;  5KNC A;  4A3I B;  3S14 B;  3LWE A;  5LHY 1;  5K36 H;  2XWB B;  2PZW A;  3PV0 A;  1H9M A;  4K14 A;  1TY2 A;  2FMC A;  4DAY A;  1VCI A;  3VA5 A;  5D14 A;  2F3V A;  4QMG A;  1ICW A;  3VR3 A;  4DGZ A;  4K2L A;  2J7Z A;  3V05 A;  1Q1E A;  2XVS A;  4KY6 A;  3VYT A;  4R9W A;  4UDU C;  2RA4 A;  4RKB A;  5JPM C;  5IT9 E;  1DD2 A;  1RF2 D;  1ILQ A;  3URY A;  3HOV B;  3W3A A;  1SNQ A;  4C1N I;  1DOM A;  1H9J A;  3FVQ A;  3A8I E;  5FO7 B;  2ZT9 C;  4ID6 A;  4FO2 A;  3TP6 A;  1GUT A;  1O7Y A;  4EVO A;  2KVM A;  3CQZ B;  3AU7 A;  3BYY B;  3V96 A;  4BWG B;  2Z4I A;  5JEA J;  1Z7T A;  3J7Y W;  1KNE A;  3EVQ A;  2JA5 B;  2EYM A;  1TU2 B;  1BXT A;  2D62 A;  2CQA A;  1GUW A;  1MD2 D;  1PZK D;  4IUQ A;  3GTO B;  5IOC A;  1D5Z C;  2BE5 C;  4QUF A;  2WAQ B;  4F87 A;  2B2V A;  2K04 A;  1I6V C;  3BDO A;  2KED A;  2B8F A;  2F0N A;  2RKS A;  3S15 B;  2A6E C;  2CW0 D;  3VR6 A;  2EYL A;  1TQO A;  4QUC A;  4F7X A;  4XTC S;  3BVM A;  4K8J A;  3FMC A;  5F2D A;  1H9S B;  1LTI D;  4A3F B;  2A69 C;  5KEE A;  4JBW A;  3TSS A;  2O5J C;  5D3I B;  4XDX A;  1YNN C;  1XWE A;  4NMZ A;  3WOE A;  1STY A;  1ILP A;  2JEB I;  2KOL A;  1FR3 A;  3ONA B;  4R8I A;  2OT2 A;  4X3T A;  1I4H A;  2XWJ B;  1JWS D;  3M4Y A;  2A68 D;  5K5P A;  4H13 C;  4G7Z C;  3KUP A;  3HP3 A;  1STE A;  1IKM A;  2JYO A;  3DHQ A;  4BA1 I;  2K5W A;  1GHK A;  2ZXR A;  4K5W A;  2B2U C;  2L55 A;  2HQE A;  1I50 B;  3K57 A;  4PMW A;  1ENC A;  1L0Y B;  1PTO B;  1LTA D;  3TDQ A;  3MC0 B;  5A2Q L;  4CJ1 B;  1S5B D;  3OW7 A;  4KY5 A;  2IX0 A;  3TN2 A;  1PFM A;  3C2P A;  1B3A A;  5IGG A;  1EY8 A;  1G29 1;  1PTO D;  2R7Z B;  1D1I A;  2X69 A;  1V1P B;  1F9S A;  1Y1V B;  5JJZ A;  3MXG A;  2BA0 A;  3GTP B;  3DEP A;  3ND8 A;  4HMJ A;  3A56 A;  3NBH A;  4CGY B;  4MN3 A;  1JE4 A;  1IKL A;  4BY7 B;  2CHB D;  1JQY D;  4C3I G;  2PYK A;  4N9P A;  1F2M A;  4NP5 A;  1EWC A;  5HGT A;  4RGT A;  1BF4 A;  5COR A;  1HTP A;  1PXU A;  2F0U A;  2RDG A;  3E5S A;  2Q8T A;  1BDO A;  2KA7 A;  5EKI A;  2EJF C;  3A55 A;  4X3K A;  2AUK A;  1GOZ A;  1RDP D;  1GUO A;  4N9T A;  3DM1 A;  2EY2 A;  3SK5 A;  4R8N A;  4K6L A;  1KDA A;  3T13 A;  5A35 A;  2VB3 X;  3GQB A;  4DNT B;  1A3T A;  2J0T D;  1RHP A;  4RHS A;  1JOK A;  4IAL A;  5M9O A;  2SNS A;  4HSP A;  5EBC A;  2JXM B;  1A6X A;  1SJE D;  4H44 C;  5EKL A;  2NWG A;  5C0X J;  2Q8I B;  1TS2 A;  5KND A;  1QIL A;  3K7A B;  1PTO H;  1SNC A;  3I4L A;  5T1I A;  1Q8I A;  3HOZ B;  3GTM B;  2QKI C;  1ROD A;  3GO5 A;  1R4Q B;  4AYB B;  2HDM A;  3FEW X;  3NXW A;  2E74 C;  1STB A;  3D6C A;  3DEO A;  4TQU S;  4FF1 A;  3VYS A;  2K01 A;  1TY0 A;  2MPM A;  5CC4 A;  3MFG A;  1B9M A;  2YYZ A;  1LTT D;  1B50 A;  1IW7 C;  3M7G A;  5C3E B;  3BS1 A;  2FJ2 A;  1STA A;  1WVL A;  4J8Q A;  2B2T A;  1TWA B;  3VYR A;  2O4X A;  1SXT A;  1CHP D;  4ULL A;  5EPJ A;  1VMC A;  2K1B A;  4BBR B;  5ISR A;  2WAC A;  1T5E A;  5CV9 A;  1U4R A;  2EXZ A;  4QCL A;  1EY6 A;  5FO9 B;  4CHT B;  1MSG A;  2IW3 A;  5A2Q E;  4KMU C;  4BBS B;  4C3I B;  4OIK A;  1EY7 A;  4EQO A;  3FKI B;  3M7N A;  1EOT A;  5KRU A;  2WV6 D;  3F2U A;  3QWN A;  3GTK B;  4DK1 A;  4FF2 A;  3S1N B;  1O7L A;  1HXY D;  3NSW A;  1JWU D;  3NTI A;  4DFA A;  3S1R B;  1SDF A;  4A3K B;  2L0C A;  1SE3 A;  1I6H B;  3S2D B;  3NBI A;  3SXH A;  4ODG A;  1H9S A;  1UEA B;  1U9R A;  1KLU D;  1U4L A;  5I9P A;  1EEF D;  1PRT B;  4RAU C;  2ICE C;  3ERO A;  1GUN A;  2JA6 B;  2F0S A;  3RLF A;  3SE0 A;  2EYH A;  4LJZ C;  3I72 A;  4XQJ A;  2M2L A;  1DJR D;  2R6G A;  1UAP A;  1PRT D;  4L8J A;  1LLR D;  1SAP A;  1LAB A;  3C1F A;  2QCP X;  5KIX A;  1H9K A;  4WJW A;  3VYU A;  3VR5 A;  3GTJ B;  2BCO A;  1DON A;  3OHX C;  3PUY A;  3H94 A;  5EQ0 A;  4Q0F A;  2C9O A;  3PUZ A;  1FYC A;  3LX0 A;  4LK1 C;  1JWM D;  4CKC A;  5M5W B;  5IGF A;  3JAM L;  2EVB A;  1WCM B;  5M5X B;  4M1U B;  2WP8 J;  2NBF A;  2K33 A;  1SNO A;  2NVX B;  3I4M B;  3TZU A;  4BY1 B;  1Y69 U;  2XRS D;  1ET6 A;  1V1P A;  3A8J E;  4OL7 A;  4NKL A;  2A6E D;  1G91 A;  3PUW A;  5FKA C;  3RZD B;  3HEJ A;  5COY A;  1TS3 A;  1Q1B A;  1V8Q A;  4RGO S;  1EY0 A;  1Q90 A;  4DK0 A;  5IGB A;  4DXF A;  5M3M B;  2A69 D;  3P75 A;  3J81 E;  1F2Y A;  1Z47 A;  1YNN D;  1BOS A;  4DXG A;  1EYD A;  3I73 A;  3CRL C;  2EY1 A;  2K5D A;  1ZYR C;  2D2C C;  5G3L F;  4PMB A;  3KF8 A;  1CI3 M;  1BNZ A;  2E2D C;  1IYV A;  1TWF B;  1T5X D;  4ZAI A;  2E2I B;  2AQ3 B;  2H4O A;  1XTC D;  4FP5 D;  2B2V C;  4G57 A;  1KDC A;  1J8I A;  5ELD A;  2AWN A;  1HA5 A;  2B2W A;  1OXX K;  1LAC A;  1K8O A;  1KAA A;  3TP8 A;  3X3M A;  1IYU A;  1D2B A;  1NUC A;  5J39 A;  5JOB A;  2JA7 B;  1ONL A;  1WTX A;  1CQV A;  2EYP A;  3NTK A;  1JOO A;  3OWE B;  2AWO A;  1LT5 D;  3L3O C;  3KK7 A;  5KYL A;  5FOB B;  3K58 A;  2WIN B;  2H1E A;  3R3O A;  1AEX A;  2PCF B;  5C0X G;  1JCK B;  2FHT A;  5DNF A;  4KK7 A;  1B9N A;  4PMC A;  2RSO A;  2KJX A;  3T16 A;  3DWQ A;  2NN6 G;  2F0P A;  4A3B B;  1FGB D;  1OXS C;  3H91 A;  4HAE A;  2EYO A;  1WTR A;  5CV4 A;  5CBA E;  1SBB B;  1SSO A;  4C3H G;  2YU9 B;  2QDB A;  3P20 A;  4HR7 B;  2R3Z A;  2F1M A;  3D4D A;  2F0L A;  1ZXT A;  4RCN A;  3KBX A;  1TWC B;  1O80 A;  2ICI A;  1G8Z D;  1SYG A;  2M00 A;  2IPK D;  5JEA H;  2F0W A;  1F9P A;  1O7Z A;  2Y0S B;  2K28 A;  3NWS A;  2G9H D;  3VA7 A;  1QNU A;  4KHZ A;  1W6K A;  1MSH A;  1STG A;  3KLR A;  4A93 B;  3W2D A;  1TWH B;  1M8A A;  5FLX L;  4WOR A;  4C56 C;  2WKC A;  5EPK A;  3HOW B;  3JAM E;  3NP8 A;  5JVH 3;  3MXN A;  1SEB D;  2JA8 B;  2BDO A;  2R61 A;  2WKD A;  3J7A V;  2F0O A;  5LL6 X;  5IGD A;  1TII D;  3QG1 A;  5AFW A;  4PQX A;  1CFM A;  5CBE E;  1S5C D;  4A3G B;  1PYW D;  1KLG D;  1OXT A;  4HCS A;  4Z9C B;  3I90 A;  2WB1 B;  2F0D A;  1ET9 A;  3CRK C;  3FDT A;  2NVT B;  1GXD C;  3GD7 A;  3HZX A;  3O13 A;  3HKZ B;  1PMR A;  5BN4 A;  5EJW A;  3BDC A;  3R2I A;  4V0B A;  2X6G A;  5IGE A;  2KCN A;  5E4X A;  3I8Z A;  2L1B A;  3Q0A A;  1Q12 A;  3Q24 A;  2A6H D;  4FF3 A;  4FVM A;  5I6W A;  1A2T A;  5C4J B;  1J9O A;  2LY7 A;  2RSN A;  4G7H C;  3QB3 A;  3J7A F;  1AFP A;  3R8B A;  1KAB A;  4IN3 A;  1B53 A;  5C4Z A;  4KJO A;  4DA2 A;  4IUN A;  2K7V A;  2F0J A;  2PZU A;  2LKV A;  4FXK C;  1FD7 D;  2N55 A;  2DNC A;  5E4W C;  4CKB A;  3OPO A;  1BO0 A;  3QIA A;  4UAI A;  2PW7 A;  3GTL B;  1TS5 A;  1KDB A;  3SR1 A;  1M4V A;  5M5Y B;  2SDF A;  1HRJ A;  5I6Y A;  1DZ1 A;  3CU7 A;  3D31 A;  1SMY D;  4KKU A;  1QOH A;  5TSS A;  2F0F A;  1XXG A;  1U4P A;  2F0M A;  4ZKB B;  4NW2 A;  3NWT A;  2K32 A;  5HUR A;  3GV6 A;  3ZYY X;  1PFN A;  2B39 A;  4P2C B;  1NR4 A;  1SYD A;  4LAA A;  4KKS A;  1S5D D;  2IL8 A;  3K5O A;  2F03 A;  3HOU B;  1SNM A;  4ZUJ A;  4QB4 A;  2I07 B;  4HCE A;  3N6R A;  1EY5 A;  2EPB A;  5D65 A;  3C46 A;  4X3U A;  2N88 A;  2B2U A;  2PQE A;  1E2Z A;  3A7A B;  1I4X A;  4NDX A;  1XX8 A;  1ESR A;  2M9V A;  3TME A;  2J4X A;  4RHR A;  2CW0 C;  4B08 A;  3M85 A;  1EZ6 A;  3MA2 B;  5K36 G;  1D5M C;  1SYE A;  3EA6 A;  1VF7 A;  1EFI D;  1GHJ A;  1SYF A;  2XIW A;  5FLX E;  3J80 L;  4MHE A;  4XT1 B;  1JOR A;  1AZQ A;  2SOB A;  5C0X H;  1ENF A;  1CZG A;  1S5E D;  2F3W A;  1R4P B;  5I4D A;  5C3X A;  3P7J A;  1F77 A;  5CV7 A;  3OOC A;  2OF1 A;  3DXJ C;  3J81 L;  2A68 C;  1YNJ C;  3EFX D;  3SK4 A;  2LFN A;  1V43 A;  1L0X B;  3MWY W;  2EYF A;  2IX3 A;  3HGB A;  3M3Y B;  2MGS A;  1HUN A;  5CV6 A;  1QCB D;  2NTT A;  1PFB A;  2R93 B;  1Y1W B;  2B2Y A;  1QWY A;  2BOS A;  4TKO B;  4C2M B;  4QF4 A;  1HFN A;  1ZKO A;  3NUC A;  2L4N A;  2F4I A;  4OO1 G;  1LTG D;  1RKN A;  3G6J B;  3KLS X;  3SEB A;  4XQN A;  5C0X I;  1ZYR D;  2MUY A;  5CV5 A;  4IUU A;  4L63 B;  1C48 A;  1PTO C;  3BZD B;  2KCC A;  3T53 B;  2EY6 A;  4F88 A;  5C5M A;  3V2T A;  3TP7 A;  5EBD A;  3BVZ A;  2F0T A;  4KKT A;  2TSS A;  1UNS A;  1VDZ A;  2PPB C;  3G7L A;  2FIN B;  2MP1 A;  4DN4 M;  3GV3 A;  5C44 B;  4M8A A;  4IUT A;  1SNP A;  1CZW A;  3ND9 A;  3D3R A;  1JB3 A;  3LNN A;  3IAY A;  3PO2 B;  3TZD A;  1NSN S;  1FNU A;  3I3C A;  1EY4 A;  1FNV A;  4A3M B;  4WRD A;  1TT2 A;  3FPP A;  4J6H A;  4B9W A;  5FK9 C;  4RA8 A;  3GTG B;  3K59 A;  4WFN 3;  1EL0 A;  4V19 0;  3U9O A;  2RQX A;  4G7O C;  1MBY A;  3S1M B;  2SNM A;  2TMP A;  1Z6H A;  1HA6 A;  2AQ1 B;  3IFT A;  4B9X A;  2XRQ D;  2DN8 A;  1CT1 D;  2NZ1 D;  1EZ8 A;  4A3E B;  1PRT F;  2OEO A;  4JK1 C;  3VR2 A;  1OXU A;  1EY9 A;  1I3Q B;  3QOJ A;  1B1Z A;  2JE6 I;  1GJX A;  1JC7 A;  3BG3 A;  3IFD A;  3R2T A;  1ZEQ X;  2KHS A;  1A2U A;  5J1Z A;  1Y8N B;  3PMF A;  2BE5 D;  3CHB D;  1D5X C;  1BBX C;  3MXP A;  4KTA A;  3C3L A;  1G6Z A;  3J80 E;  3A7L A;  1DM0 B;  1D1K A;  4PV1 C;  1EU3 A;  5ELB A;  1BCP F;  2RDH A;  4KN7 C;  3HOY B;  2E2J B;  3GP7 A;  4BA2 I;  1I4G A;  1HTL D;  1Y8P B;  4PNY A;  5C6A A;  1JIC A;  1E0B A;  3R93 A;  3BVG A;  4TSS A;  1STH A;  3H3V C;  1EYA A;  4ILW A;  1HCZ A;  4IUV A;  2HUG A;  4HTH A;  3S16 B;  4DAV A;  4HED A;  4DNR B;  2O2L D;  4XYQ A;  1NAP A;  1MI2 A;  1SE2 A;  3E0J A;  1B2T A;  1GUS A;  1RTO A;  5G3L D;  3MAQ A;  2F0Q A;  4E6I A;  2B63 B;  1DXM A;  3AMU A;  4F8M A;  3MVV A;  3N52 A;  3DUZ A;  3Q23 A;  5JVG 3;  5CGK A;  2O5I C;  2CVR A;  1I4Q A;  5EGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...