2JU3A

Solution-state nmr structures of apo-lfabp (liver fatty acid-binding protein)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
b'MNFSGKYQVQSQENFEPFMKAMGLPEDLIQKGKDIKGVSEIVHEGKKVKLTITYGSKVIHNEFTLGEECELETMTGEKVKAVVKMEGDNKMVTTFKGIKSVTEFNGDTITNTMTLGDIVYKRVSKRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fatty acid-binding protein, liver
publication title Solution-State Molecular Structure of Apo and Oleate-Liganded Liver Fatty Acid-Binding Protein
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Lipid binding protein
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14651 Lipocalin_7 Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2ju3A00
3FR2A 1EIIA 1EPAA 1KT7A 2JU8A 5EEDA 3STKA 4IMNA 4GE1A 1SXUA 2CM9A 1E02A 1CBSA 5L8IA 1CBIA 2A2UA 3PH5A 3FR4A 1ICNA 2XKLA 4YMYA 5HCCC 5LJEA 2G78A 3FW4A 4K19A 4YGGA 4CK4A 5IO6A 3CR6A 2A0AA 4GH7A 4MVIA 1LNMA 1DZMA 1RBPA 1TOWA 1CBQA 5FENA 1A18A 4ZHCA 1O1VA 1YWAA 2CBRA 5D45A 2POAA 1XKIA 2KTDA 3B2LA 3KFHA 4NP1A 4LZVA 1L6MA 4Y0RA 3F8AA 3NPOA 1OEJA 1ERBA 3P6FA 5C0NA 3P6EA 2NNDA 4I3DA 3BRNA 1VYFA 4NNTA 3D96A 1S2PA 5F1EA 1IKEA 1OPAA 4WFVA 1T8VA 3JSQA 1MUPA 4AZRA 1GXAA 1LIBA 1CJ5A 1HMRA 1DZPA 4IAXA 3ZQ3A 2K23A 2E4JA 2AKQA 2L67A 3WJEA 2OVEA 5EEEA 2MM3A 1LIFA 4AZMA 1GM6A 3APWA 1GT4A 3FR5A 5DG4A 4IMOA 1OEKA 4HPAA 4MVKA 2JN3A 3UEXA 5EPQA 3NR3A 4HPBA 1X8UA 4XMFA 4QGXA 1QFVA 2RCQA 1T68X 1OBPA 4A1YA 4YGZA 2FLJA 2OFRX 1GX9A 2N93A 4OMXA 3NX1A 1B0OA 1YP7A 2W2AA 1BSOA 4HFOA 4HPDA 2OVAA 5H9KA 1I05A 2LB6A 1E06A 3WVMA 4ALOA 2QOSC 5D47A 1OPBA 1H91A 4ZH6A 3C77X 1NP1A 2AH7X 4BQUA 4WBKA 4NNSA 5HCDC 3PECA 2L9CA 2QO6A 2CZTA 3FEPA 3GAQA 1LIDA 1BRQA 5H9AA 1DFVA 4XMCA 4D6AA 2FT9A 4RUNA 4DQ3A 1A2DA 2CZUA 1ZNDA 4LKTA 3WJFA 4QAEA 2JU7A 1QY1A 4A1HA 3HK1A 3K3LA 5EDCA 4GNYA 2GJ5A 1ML7A 1GKAA 4GNWA 1I4UA 1GGLA 5IO5A 4OS0A 2GC9A 1ICMA 1N0SA 2BLGA 2LBVA 1BRPA 2A2GA 1MDCA 4BVMA 5LJKA 4HPCA 2AT5X 3VG7A 5F6BA 3P6GA 1HBQA 4Y0PA 3FIQA 1UZ2X 1SXWA 3RSWA 1YWDA 2MO5A 4TNNA 3BSZE 5KIDA 1E5PA 4RUUA 4DQ4A 2HNXA 3JS1A 4I3CA 4XMHA 5B27A 4LZUA 1QY0A 4N7CA 1BSYA 1B4MA 2RD7C 5LJGA 4ZHGA 2AT3X 1G7NA 5F6ZA 4ORYA 4UU2A 2LFOA 2NNEA 3EBKA 5HWZA 1KZXA 1S7DA 3FA6A 1LF7A 4QYNA 1GT1A 1LKEA 4I9SA 2RCTA 4ORRA 1BSQA 1IFBA 1JZUA 3B2KA 4TLJA 3BS2A 5LJCA 1DF3A 3NADA 5FFHA 2QO5A 1T0VA 4I9RA 4XMDA 3BY0A 4WFUA 5H9LA 4NLIA 1YP6A 3TGAA 3U03A 1G5WA 1EIOA 3VG2A 1HN2A 1O8VA 3MBTA 1OBUA 1KT5A 1CBRA 4ORUA 2R74A 1X8NA 4M7MA 3F9DA 5L8OA 3EYCA 3U0DA 1X8OA 2WQAE 3PH6A 1KT3A 2HZRA 2F73A 2WSJA 1X71A 2WR6A 2EU7X 1EQDA 4ES7A 1U0XA 4BOEA 2W2FA 4IB6A 4R0BA 4YKMA 3MVFA 3TZSA 5HZ8A 5HTDA 4D6BA 2A13A 1SY0A 1QFTA 5K06A 1SXXA 2OVDA 4ORSA 1EW3A 3O22A 3KFGA 2Q9SA 1TXLA 3QKGA 5F58A 4YKOA 1SY1A 2G79A 2OZQA 4QYPA 1TVQA 3FENA 3KQ0A 1GKAB 3APVA 5HA1A 5BVQA 1R0UA 2NP1A 4ODDA 1ACDA 2L68A 1ADLA 2L5PA 2RA6A 1KGLA 1FEMA 2O62A 4AW8A 4YDAA 4YFRA 4N7DA 3BDRA 1LFOA 2DM5A 2Q39A 4ZFXA 4ZHHA 4IB8A 1MX8A 5HZ6A 1BM5A 1NGLA 3NQ3A 5HZ5A 4O9SA 4YCHA 3S26A 1EUOA 2WQ9A 4M6SA 4KIIA 4NYRA 1PMPA 3OJYC 2W2BA 5IO7A 3CBSA 3WJBA 2Q2MA 1GX8A 4NYQA 1BBPA 4OS3A 1FTPA 3TF6A 2IFBA 5HZ9A 3STMX 1KT6A 3P6CA 5EDBA 1I04A 3AKNA 2HLVA 1FE3A 1MVGA 2AL0X 2FWVA 2FR2A 5D8JA 1FELA 2YG2A 4IB9A 3VG5A 3I17A 1HMSA 1GT5A 3VG4A 1KZWA 1ZNLA 1AQBA 4ORWA 3EMMA 2X46A 3NQ9A 2X45A 3EM0A 4EEJA 1KT4A 1O1UA 1OEEA 5KHPA 1U18A 3D97A 1BLRA 2AT6X 4YCEA 3PEDA 1A57A 4PSQA 4ZHFA 1ALBA 1IKJA 4ZH9A 1SA8A 4TKHA 5BVSA 3BX7A 3BLGA 1A3YA 1X8QA 3AKMA 1SY3A 3APUA 3BU1A 3CWKA 3BU9A 1FDQA 1QABE 2JOZA 5EZ2A 5FAZA 5LJDA 4ZJ0A 3PPTA 2KT4B 3TGCA 1ERXA 4YGHA 1P6PA 3D95A 3B2IA 1HQPA 4ALBA 1DZKA 3SAOA 2CM4A 2MJIA 3FEKA 1GT3A 1BJ7A 3CQRA 4AZNA 1IW2A 5H8TA 3FMZA 2QM9A 4IBAA 5D48A 1MX7A 1JBHA 1LPJA 5CE4A 5H9NA 1YUPA 1JYJA 4IB7A 2ASNX 1DV9A 2GTFX 2ALLX 3O2YA 2R56A 1VPRA 2RQ0A 2OFMX 1EALA 1ZNGA 1RLBE 3DTQA 1JJXA 1TOUA 1JJJA 1BWYA 3I0AA 4XMEA 3ELZA 4XMGA 1DC9A 3EBWA 1KOIA 1OBQA 1EPBA 4OS8A 3C76X 2CBSA 4MVLA 5KICA 1D2UA 4I3BA 1HMTA 3CMPA 1YIVA 2R73A 3FELA 1IFCA 1I06A 2ACPX 3NP1A 4QZTA 4TQ2A 4A60A 3WJCA 3B2JA 5D4AA 5BVTA 3UEWA 4GRJA 3WXQA 3HWEA 4TKBA 1KQXA 1AB0A 1AVGI 3UEUA 4QGVA 4ARHA 1Z24A 3P6DA 2AT8X 1ZRYA 4EXZA 5HBSA 4A8ZA 3TGBA 5F7GA 2NNQA 4YDBA 1IIUA 1PBOA 5AQ6A 1LIEA 3FLLA 5HCEC 2HYSA 3NX2A 4LKPA 1FENA 3APXA 3VG6A 2AMMX 3KFFA 3ZUOA 1X89A 2P8GA 1JYDA 2QO4A 4EFGA 1KXOA 1KQWA 5HTEA 1BEBA 1DZJA 3KZAA 3WJGA 1SXYA 1ZNKA 3DSZA 4ZHDA 2Q4NA 4GETA 1U17A 1ZNHA 2PY1A 1ZNEA 4AZPA 4EDEA 4YH0A 4TKJA 1TW4A 5HA0A 4ZGUA 1PEEA 1VYGA 1NP4A 1G85A 4AYHA 4UU3A 5HAEA 2FR3A 1CRBA 2FTBA 2WEWA 3G7XA 3T1DA 1XCAA 1SY2A 1S44A 3PP6A 4IAWA 1QG5A 3STNA 2JU3A 3WBGA 5DPQA 5HZQA 3VG3A 4Y0SA 4Y0QA 4YBUA 2WWPA 3U9PC 1HBPA 4ZCBA 5B29A 1QY2A 2AT0X 2XSTA 1AELA 2LBAA 1E00A 1G74A 1JV4A 3B2HA 4QZUA 2A3FX 5LKFA 3C78X 5LKEA 1B8EA 3IA8A 3FA8A 4GKCA 3HWDA 1QQSA 1UREA 1LICA 2HMBA 2WUTA 1YWBA 3KFIA 4YFPA 5LJHA 2FRSA 3RZYA 5JR8A 2ANSA 2G7BA 4ORXA 4YFQA 3FA7A 3CBCA 1B56A 1PM1X 2HZQA 2LKKA 5L8NA 1D3SA 3ZUIA 4TJZA 1EXSA 2ACOA 3BX8A 1X8PA 3ELXA 3FA9A 3Q6LA 4AZQA 4ZR2A 3HWFA 2FS7A 3P6HA 4YBPA 3FW5A 3UEVA 3O19A 4NLJA 4QGWA 3L4RA 2K62A 3IFBA 1YWCA 3CQNA 5LJBA 3HWGA 1QWDA 3WJDA 4AZOA 2WEXA 2Q2PA 4OMWA 2FS6A
chains in the Genus database with same CATH superfamily
3FR2A 1EIIA 1SWHA 1EPAA 1KT7A 2JU8A 5EEDA 3STKA 2KW1A 2ZAIA 4IMNA 4CDEA 2G8CO 4GE1A 2BS6A 1SXUA 2CM9A 1E02A 1CBSA 5L8IA 1CBIA 2A2UA 3PH5A 4KH8A 3HTYA 5F2BA 3FR4A 1ICNA 4Z27A 1HY2A 2XKLA 1SRGA 2RTPB 3LHNA 4YMYA 5HCCC 5LJEA 2G78A 3FW4A 1SLDB 1SWRA 4K19A 3RBYA 4YGGA 4CK4A 1Y55X 5IO6A 3CR6A 2A0AA 4GH7A 4MVIA 3ZW0B 1LNMA 1DZMA 2RTKA 3RY2A 1W6FA 1RBPA 2G5LA 1AVDA 1TOWA 1CBQA 3RDMA 1WBIA 5FENA 2Z4HA 4CPHB 1A18A 4DNEA 1O1VA 1YWAA 4ZHCA 2CBRA 5D45A 1SWFA 1JIWI 2POAA 1XKIA 2KTDA 2MHDA 3B2LA 4GDZA 3RDUA 3RE5A 2RTOB 3KFHA 4NP1A 3LV4A 4LZVA 1L6MA 4Y0RA 3F8AA 3NPOA 1OEJA 1ERBA 3P6FA 4ID2A 2I5ZO 3Q34A 5C0NA 2IZHB 4O49A 3P6EA 1DF8A 2NNDA 5AJCA 4I3DA 4EKVA 3BRNA 2WPUA 3PQUA 1VYFA 1FJ1E 2OY8A 4NNTA 4CPEA 3D96A 1IJ8A 3CKGA 1S2PA 5F1EA 1IKEA 1OPAA 4WFVA 1T8VA 3D9WA 1MUPA 3JSQA 1GXAA 1LIBA 3E3CA 4AZRA 2Z4IA 1CJ5A 1N4JA 2FGSA 1DZPA 1HMRA 4IAXA 1SLEB 3ZQ3A 2FHLA 2K23A 2E4JA 2AKQA 2L67A 3F6ZB 2X56A 3WJEA 3AEHA 1MOYA 1PTSA 2OVEA 2QOMA 2CAMA 2RTBB 2JGSA 5EEEA 2MM3A 1LIFA 4AZMA 1GM6A 1JMXA 3APWA 5CSEA 1PBYA 1GT4A 3FR5A 5DG4A 1SWTA 1OEKA 4HPAA 4IMOA 2JN3A 4MVKA 4QQ1A 4ON1A 1SRHA 4U46A 3UEXA 4PJ2A 5EPQA 3NR3A 2GTLO 3QQ2A 4FBVA 4HPBA 1SLGB 2IZFB 5JD2A 1X8UA 4XMFA 4QGXA 1QFVA 3OD9A 2RCQA 2UYWA 1T68X 1OBPA 4A1YA 1WUBA 4YGZA 3RKGA 2FLJA 2OFRX 1GX9A 2N93A 2FKGA 4OMXA 2OL8O 4GJSA 4DCBA 4GGZA 3NX1A 1B0OA 1YP7A 3VHMA 3T1DA 1LUQA 2W2AA 1VWJB 1BSOA 1KL5A 4HFOA 2OVAA 4HPDA 4WHIA 5H9KA 4O3ZA 1I05A 4I6SA 2LB6A 1E06A 3WVMA 2KTSA 4ALOA 2X8SA 1VWKB 1VWEB 2QOSC 5D47A 1OPBA 4IABA 2X8TA 1H91A 4ZH6A 3AUMO 3C77X 1NP1A 1VWQB 2AH7X 4GU8A 3SLTA 2A5CA 4WBKA 4BQUA 1K3BA 4NNSA 5B5GA 5HCDC 3PECA 2L9CA 2QO6A 2CZTA 2JMBA 3FEPA 2ZSCA 3GAQA 3NBXX 3UAQA 3VGWA 2BC3A 2RTMA 2RTDB 2VFCA 1LIDA 1BRQA 5H9AA 1DFVA 1MK5A 4XMCA 4D6AA 2FT9A 4RUNA 4DQ3A 1A2DA 1ZNDA 2CZUA 2OF8A 4GZVA 4LKTA 4U8UO 2OY5O 3WJFA 2RN4A 4U9CA 4QAEA 3RE6A 2JU7A 1QY1A 2HKDA 4A1HA 3WZOA 3HK1A 3K3LA 5EDCA 4OEMA 4BCSA 4GNYA 2GJ5A 1ML7A 1GKAA 4GNWA 1I4UA 1GGLA 2IZAA 2OY1O 4NV8A 2GC9A 4OS0A 5IO5A 1OSPO 2IZIA 2JW1A 1STSB 1LDOA 3HOEA 1ICMA 1N0SA 3T2XA 1SWQA 2BLGA 2LBVA 4BGFA 1BRPA 2A2GA 1MDCA 3VU1A 4BVMA 4ZGFA 5LJKA 4HPCA 3EW1A 3EC5A 2AT5X 3ZZVA 2Y3EA 3VG7A 5F6BA 3P6GA 3GE2A 1HBQA 4Y0PA 3FIQA 1UZ2X 1SXWA 1SRFA 4YVBA 3RSWA 1SWPA 1YWDA 2BT9A 2MO5A 2I5VO 3MX7A 4TNNA 3BSZE 5KIDA 4GGRA 1SWUA 1E5PA 4RUUA 4DQ4A 2HNXA 3JS1A 4I3CA 4LQZA 3SZJA 1VWRB 4XMHA 5B27A 3ZW2A 2RTEB 4LZUA 1QY0A 2IZJA 3MG5A 4N7CA 1BSYA 1B4MA 3VHIA 2OY7A 2RD7C 5LJGA 4ZHGA 1STPA 2AT3X 4KT5A 1G7NA 5F6ZA 4ORYA 4UU2A 2LFOA 2NNEA 3EBKA 5HWZA 1KZXA 1S7DA 3FA6A 1LF7A 4QYNA 1GT1A 1LKEA 2C4IA 4I9SA 2RCTA 5IXGA 4ORRA 1BSQA 1IFBA 1JZUA 3B2KA 2FKJA 4TLJA 1N9MA 3BS2A 2FHNX 5FQ6E 5LJCA 2BSZA 1DF3A 3NADA 5FFHA 2QO5A 3HPEA 1T0VA 4I9RA 4XMDA 4GDAA 3BY0A 4WFUA 5H9LA 2X8FA 4NLIA 1YP6A 3TGAA 3U03A 5B29A 1G5WA 1SWKA 2X32A 1EIOA 4JO6A 3VG2A 1HN2A 1O8VA 4QRLA 3MBTA 3WYPA 1OBUA 3WOVA 1KT5A 1VWLB 1CBRA 2IZEB 4ORUA 2R74A 2C1SA 4OKAA 1X8NA 1SRIA 1Y9LA 2IZCB 1NQMA 4M7MA 3F9DA 5L8OA 3EYCA 4HWMA 3U0DA 1X8OA 2WQAE 3PH6A 4O4OA 1KT3A 2HZRA 3VPJE 1W4TA 2F73A 4O3YA 2WSJA 1X71A 2WR6A 2EU7X 4B55A 1EQDA 4ES7A 1STRB 1U0XA 2OVSA 4BOEA 2W2FA 4IB6A 4R0BA 4YKMA 3MVFA 3TZSA 5HZ8A 5HTDA 4D6BA 1Y52X 2A13A 3ZW1A 5K68A 1SY0A 1QFTA 5K06A 1VWAB 2AF5A 3X00A 1SXXA 2OVDA 1VYOA 1EW3A 1MM9A 1VWDB 4ORSA 3O22A 3KFGA 5AJBA 2Q9SA 1TXLA 3QKGA 1SWAA 4IRWA 1LCZA 4YKOA 5F58A 1SY1A 2G79A 2OZQA 4QYPA 1TVQA 3FENA 3KQ0A 1GKAB 3APVA 5HA1A 5BVQA 1R0UA 2NP1A 1I78A 1SWBA 4ODDA 1ACDA 3S5VA 3FIDA 4CDFA 2L68A 1ADLA 2L5PA 3KVNA 2A5BA 2RA6A 1KGLA 1FEMA 4MEEA 1RXHA 2O62A 1VWOB 1HXLA 2OFAA 4AW8A 3SOTA 2OYBO 2DJFA 2RTNB 4YDAA 2GH7A 4YFRA 3VE1A 3S60A 4N7DA 3BDRA 1LFOA 2DM5A 2Q39A 4ZFXA 4ZHHA 4IB8A 1MX8A 5HZ6A 2RTLA 3FYFA 1BM5A 1NGLA 2RTFB 2X55A 5B2AO 3NQ3A 3PQSA 4O9SA 1VWPB 4YCHA 3S26A 1EUOA 5HZ5A 2WQ9A 4M6SA 1SWLA 4KIIA 5BYPA 4NYRA 1PMPA 4EQAC 1SWGA 2W2BA 3OJYC 5IO7A 3CBSA 3WJBA 2Q2MA 1GX8A 1SMPI 4NYQA 1BBPA 1Y9TA 4OS3A 2A8GA 1FTPA 3TF6A 3D4RA 3N91A 2IFBA 5HZ9A 3WYQA 3STMX 2UZ2A 1KT6A 2FS6A 2OL6O 1SRJA 3P6CA 3PK2A 1I04A 5EDBA 3VHHA 3PDFA 3AKNA 2HLVA 1FE3A 1MVGA 2AL0X 2FWVA 2FR2A 3CKFA 1FELA 5D8JA 2YG2A 1Y0GA 4IB9A 3VG5A 1VWFB 2MWHA 1HMSA 1GT5A 3I17A 3VG4A 1ZNLA 1KZWA 1AQBA 4ORWA 5FQ8E 3EMMA 1SWJA 2X46A 3NQ9A 2X45A 3EM0A 1HQQA 1UYNX 1KT4A 1O1UA 1RXKA 4EEJA 1OEEA 5KHPA 1U18A 3SZHA 3V8UA 3D97A 3MM0A 1BLRA 1SWSA 2AT6X 4YCEA 1JJUA 3P02A 1Y53X 3PEDA 1A57A 4PSQA 2IZLB 3S5XA 1ALBA 1IKJA 4O3XB 4ZHFA 4ZH9A 1NQNA 1SA8A 4MISA 4OMWA 4TKHA 5BVSA 3BX7A 3BLGA 4GK9A 1A3YA 4ML7B 5L3YA 1X8QA 1N43A 3AKMA 1SY3A 3APUA 3BU1A 3CWKA 3BU9A 1FDQA 1QABE 2JOZA 5EZ2A 2RTGB 2RTHB 5FAZA 5LJDA 4ZJ0A 2PI3O 3PPTA 5CHKA 5IRUA 2M4LA 2KT4B 3TGCA 3WZQA 1ERXA 4YGHA 1P6PA 2LA7A 3D95A 2DJGA 1SWEA 3OBLA 2IZDB 3B2IA 1HQPA 4FBOA 4ALBA 1DZKA 3SAOA 5B3MO 2CM4A 2MJIA 3FEKA 4BX6A 1GT3A 4Y59A 1BJ7A 3CQRA 4AZNA 1IW2A 1RAVA 5H8TA 2X4MA 3FMZA 1LCWA 1UYOX 3ZW1B 5FQ7E 4Z2VA 3HOLA 2QM9A 4IBAA 5D48A 1MX7A 1JBHA 3RDSA 1LPJA 5CE4A 5H9NA 1YUPA 1JYJA 4MIRA 4JHQA 5B10O 4CPIA 1MEPA 4IB7A 2ASNX 1DV9A 2GTFX 1VWGB 2ALLX 3O2YA 2R56A 3RY1A 1VPRA 1NDJA 2RQ0A 3LTWA 2OFMX 1EALA 1ZNGA 1EI5A 1RLBE 3DTQA 1TOUA 4NV7A 5CYBA 1BWYA 1JJJA 1JJXA 3I0AA 4XMEA 4Z6JA 4MVEA 2BS5A 3ELZA 1K24A 4XMGA 1DC9A 3EBWA 4Y5DA 3RDOA 1KOIA 4I60A 1OBQA 1EPBA 4OS8A 3C76X 2CBSA 2RTIB 1NBXA 4KCAA 4MVLA 5KICA 1D2UA 4I3BA 4JGLA 2YMSA 4BJ8A 4BX5A 1HMTA 3CMPA 1YIVA 2RTJA 2R73A 3FELA 3RDQA 1IFCA 1I06A 2ACPX 3NP1A 4QZTA 4TQ2A 4A60A 5AEOA 3WJCA 3B2JA 5D4AA 5BVTA 3RWXA 4I95A 3UEWA 3H3IA 3WZPA 4GRJA 3WXQA 5K67A 2QMIA 3HWEA 2F01A 1KQXA 1AB0A 1AVGI 3UEUA 4TKBA 2VFBA 4QGVA 4O3WA 1Z24A 3P6DA 4ARHA 2IZGB 2AT8X 1ZRYA 4BX7A 4EXZA 5HBSA 4A8ZA 3TGBA 3RDXA 4CDCA 2OL7A 4FQBB 2NNQA 5F7GA 5IRAA 4YDBA 1E2TA 2GTLM 2ZAGA 3NQKA 1IIUA 1PBOA 1SWDA 5AQ6A 1LIEA 3FLLA 5HCEC 1VWHB 4KC7A 2HYSA 3NX2A 4LKPA 1AVEA 1FENA 3APXA 3VG6A 2AMMX 3KFFA 3ZUOA 1X89A 2P8GA 1RSUB 1JYDA 1VWMB 2F09A 1KXOA 2QO4A 4JNJA 4EFGA 1KQWA 2GTLN 1BEBA 4L1NA 1DZJA 5HTEA 3KZAA 3WJGA 2OF9A 1HXZA 1SXYA 3VG3A 4FBRA 1ZNKA 3DSZA 4ZHDA 2Q4NA 4COTA 4GETA 1U17A 1ZNHA 1SLFB 2PY1A 1ZNEA 4U3QA 4AZPA 4FGIB 2Y32A 2C1QA 4EDEA 4YH0A 4TKJA 1RXJA 4Z2PA 3JQOA 4GD9A 1TW4A 1LELA 5HA0A 4ZGUA 1PEEA 1VYGA 1NP4A 1G85A 4AYHA 3ZW0A 2VDFA 4UU3A 5HAEA 2FR3A 2KD2A 2QCBA 4O4SA 4GJVA 1LCVA 1CRBA 1SWOA 3T6FA 1N9YA 2FTBA 3ZWEA 2WEWA 3G7XA 4INNA 1XCAA 1SY2A 1S44A 2RTQB 3PP6A 1QG5A 1SWNA 4IAWA 4QNIA 4U8UM 1W5RA 4Z28A 3STNA 4BX6B 2JU3A 3WBGA 5DPQA 3OE3A 5HZQA 2RTAA 2Y3FA 4Y0SA 4Y0QA 4YBUA 2WWPA 3SLOA 1HBPA 2IZKA 4ZCBA 5B11O 3T6LA 3U9PC 1QY2A 2AT0X 2XSTA 3P24A 4L3RA 4OELA 2LBAA 2RTRB 1AELA 1E00A 3WZNA 2X34A 4U8UN 1G74A 4CV7A 1JV4A 3B2HA 4QZUA 2A3FX 5LKFA 2AVIA 2MF6A 3SLJA 4CPHA 3C78X 5LKEA 2RTCB 1B8EA 3IA8A 3FA8A 4BBOA 3T2WA 4GKCA 1VWCB 3HWDA 4KC8A 1QQSA 1RSTB 1UREA 1LICA 2HMBA 2WUTA 3VE2A 1YWBA 3KFIA 4YFPA 1SREA 5LJHA 2FRSA 3EW2A 4BX5B 3RZYA 1KFFA 4C5PA 1KL3A 4CPFA 2ANSA 2G7BA 4ORXA 5JR8A 4YFQA 3FA7A 3CBCA 4O4UA 5IRWA 1VWIB 1I9HA 1VWBB 2OFBA 1SWCA 3SZIA 3ZI8A 1B56A 1PM1X 2HZQA 2LKKA 5L8NA 1D3SA 3ZUIA 3FDCA 4NW4A 4GGTA 1EXSA 2ACOA 3BX8A 1X8PA 3ELXA 3FA9A 3Q6LA 1JQPA 4TJZA 4AZQA 4CSBA 4ZR2A 3HWFA 1KL4A 2BHVA 2FS7A 1JMZA 3P6HA 4YBPA 1N7YA 4BX7B 4Z2OA 3FW5A 1GX3A 4GUZA 3UEVA 5B5FA 2IZBA 3O19A 4NLJA 4QGWA 3L4RA 2K62A 3IFBA 4CDDA 1YWCA 3CQNA 5LJBA 3HWGA 1QWDA 1VWNB 3WJDA 4AZOA 2WEXA 1NC9A 2Q2PA 4O4XA 1LDQA
chains in the Genus database with same CATH topology
3FR2A 1EIIA 1EPAA 1KT7A 2JU8A 5EEDA 3STKA 2KW1A 2ZAIA 4IMNA 4GE1A 2BS6A 1SXUA 2CM9A 1E02A 1CBSA 5L8IA 1CBIA 2A2UA 3PH5A 4KH8A 3HTYA 3FR4A 1ICNA 2XKLA 4YMYA 3LHNA 5HCCC 5LJEA 2G78A 3FW4A 4K19A 3RBYA 4YGGA 4CK4A 5IO6A 3CR6A 2A0AA 4GH7A 4MVIA 3ZW0B 1LNMA 1DZMA 1RBPA 1TOWA 1CBQA 5FENA 2Z4HA 1A18A 4ZHCA 1O1VA 1YWAA 2CBRA 5D45A 1JIWI 2POAA 1XKIA 2KTDA 2MHDA 3B2LA 4GDZA 3KFHA 4NP1A 3LV4A 4LZVA 1L6MA 4Y0RA 3F8AA 3NPOA 1OEJA 1ERBA 3P6FA 4ID2A 5C0NA 4O49A 3P6EA 2NNDA 5AJCA 4I3DA 3BRNA 3PQUA 1VYFA 4NNTA 3D96A 1S2PA 5F1EA 1IKEA 1OPAA 4WFVA 1T8VA 3JSQA 1MUPA 4AZRA 1GXAA 1LIBA 3E3CA 2Z4IA 1CJ5A 1HMRA 1DZPA 4IAXA 3ZQ3A 2K23A 2E4JA 2AKQA 2L67A 3F6ZB 3WJEA 2OVEA 5EEEA 2MM3A 1LIFA 4AZMA 1GM6A 3APWA 1GT4A 3FR5A 5DG4A 4IMOA 1OEKA 4HPAA 4MVKA 2JN3A 4QQ1A 3UEXA 4ON1A 4PJ2A 5EPQA 3NR3A 2GTLO 4FBVA 4HPBA 1X8UA 4XMFA 4QGXA 1QFVA 3OD9A 2RCQA 1T68X 1OBPA 4A1YA 4YGZA 3RKGA 2FLJA 2OFRX 1GX9A 2N93A 4OMXA 3NX1A 1B0OA 1YP7A 2W2AA 1BSOA 4HFOA 4HPDA 2OVAA 4WHIA 5H9KA 4O3ZA 1I05A 4I6SA 2LB6A 1E06A 3WVMA 2KTSA 4ALOA 2X8SA 2QOSC 5D47A 1OPBA 4IABA 2X8TA 1H91A 4ZH6A 3C77X 1NP1A 2AH7X 4GU8A 4BQUA 4WBKA 4NNSA 5HCDC 3PECA 2L9CA 2QO6A 2CZTA 2JMBA 3FEPA 3NBXX 3GAQA 3UAQA 1LIDA 1BRQA 5H9AA 1DFVA 4XMCA 4D6AA 2FT9A 4RUNA 4DQ3A 1A2DA 2CZUA 1ZNDA 4GZVA 4LKTA 4U8UO 3WJFA 2RN4A 4U9CA 4QAEA 2JU7A 1QY1A 4A1HA 3HK1A 3K3LA 5EDCA 4GNYA 2GJ5A 1ML7A 1GKAA 4GNWA 1I4UA 1GGLA 5IO5A 4OS0A 2GC9A 2JW1A 3HOEA 1ICMA 1N0SA 2BLGA 2LBVA 1BRPA 2A2GA 1MDCA 3VU1A 4BVMA 4ZGFA 5LJKA 4HPCA 3ZZVA 2AT5X 3VG7A 5F6BA 3P6GA 3GE2A 1HBQA 4Y0PA 3FIQA 1UZ2X 1SXWA 3RSWA 1YWDA 2BT9A 2MO5A 3MX7A 4TNNA 3BSZE 5KIDA 1E5PA 4RUUA 4DQ4A 2HNXA 3JS1A 4I3CA 4LQZA 4XMHA 5B27A 3ZW2A 4LZUA 1QY0A 4N7CA 1BSYA 1B4MA 2RD7C 5LJGA 4ZHGA 2AT3X 4KT5A 1G7NA 5F6ZA 4ORYA 4UU2A 2LFOA 2NNEA 3EBKA 5HWZA 1KZXA 1S7DA 3FA6A 1LF7A 4QYNA 1GT1A 1LKEA 4I9SA 2RCTA 4ORRA 1BSQA 1IFBA 1JZUA 3B2KA 4TLJA 3BS2A 5FQ6E 5LJCA 1DF3A 3NADA 5FFHA 2QO5A 1T0VA 4I9RA 4XMDA 3BY0A 4WFUA 5H9LA 2X8FA 4NLIA 1YP6A 3TGAA 3U03A 1G5WA 1EIOA 3VG2A 1HN2A 1O8VA 4QRLA 3MBTA 1OBUA 3WOVA 1KT5A 1CBRA 4ORUA 2R74A 1X8NA 1Y9LA 4M7MA 3F9DA 5L8OA 3EYCA 4HWMA 3U0DA 1X8OA 2WQAE 3PH6A 4O4OA 1KT3A 2HZRA 3VPJE 2F73A 4O3YA 2WSJA 1X71A 2WR6A 2EU7X 1EQDA 4ES7A 1U0XA 2OVSA 4BOEA 2W2FA 4IB6A 4R0BA 4YKMA 3MVFA 3TZSA 5HZ8A 5HTDA 4D6BA 2A13A 3ZW1A 1SY0A 1QFTA 5K06A 1SXXA 2OVDA 4ORSA 1EW3A 3O22A 3KFGA 5AJBA 2Q9SA 1TXLA 3QKGA 5F58A 4YKOA 1SY1A 2G79A 2OZQA 4QYPA 1TVQA 3FENA 3KQ0A 1GKAB 3APVA 5HA1A 5BVQA 1R0UA 2NP1A 4ODDA 1ACDA 3S5VA 2L68A 1ADLA 2L5PA 2RA6A 1KGLA 1FEMA 2O62A 4AW8A 3SOTA 4YDAA 4YFRA 3VE1A 3S60A 4N7DA 3BDRA 1LFOA 2DM5A 2Q39A 4ZFXA 4ZHHA 4IB8A 1MX8A 5HZ6A 3FYFA 1BM5A 1NGLA 3NQ3A 3PQSA 4O9SA 4YCHA 3S26A 5HZ5A 1EUOA 2WQ9A 4M6SA 4KIIA 5BYPA 4NYRA 1PMPA 4EQAC 3OJYC 2W2BA 5IO7A 3CBSA 3WJBA 2Q2MA 1GX8A 1SMPI 4NYQA 1BBPA 1Y9TA 4OS3A 1FTPA 3TF6A 3D4RA 3N91A 2IFBA 5HZ9A 3STMX 1KT6A 3P6CA 5EDBA 1I04A 5FQ8E 3AKNA 2HLVA 1FE3A 1MVGA 2AL0X 2FWVA 2FR2A 5D8JA 1FELA 2YG2A 4IB9A 3VG5A 3I17A 2MWHA 1HMSA 1GT5A 3VG4A 1KZWA 1ZNLA 1AQBA 4ORWA 3EMMA 2X46A 3NQ9A 2X45A 3EM0A 4EEJA 1KT4A 1O1UA 1OEEA 5KHPA 1U18A 3V8UA 3D97A 1BLRA 2AT6X 4YCEA 3P02A 3PEDA 1A57A 4PSQA 4ZHFA 3S5XA 1ALBA 1IKJA 4O3XB 4ZH9A 1SA8A 4OMWA 4MISA 4TKHA 5BVSA 3BX7A 3BLGA 4GK9A 1A3YA 4ML7B 1X8QA 3AKMA 1SY3A 3APUA 3BU1A 3CWKA 3BU9A 1FDQA 1QABE 2JOZA 5EZ2A 5FAZA 5LJDA 4ZJ0A 3PPTA 2M4LA 2KT4B 3TGCA 1ERXA 4YGHA 1P6PA 2LA7A 3D95A 3OBLA 3B2IA 1HQPA 4FBOA 4ALBA 1DZKA 3SAOA 2CM4A 2MJIA 3FEKA 1GT3A 1BJ7A 3CQRA 4AZNA 1IW2A 5H8TA 3FMZA 3ZW1B 5FQ7E 3HOLA 2QM9A 4IBAA 5D48A 1MX7A 1JBHA 1LPJA 5CE4A 5H9NA 1YUPA 1JYJA 4MIRA 4IB7A 2ASNX 1DV9A 2GTFX 2ALLX 3O2YA 2R56A 1VPRA 2RQ0A 2OFMX 1EALA 1ZNGA 1EI5A 1RLBE 3DTQA 1TOUA 1JJJA 5CYBA 1BWYA 1JJXA 3I0AA 4XMEA 4MVEA 2BS5A 3ELZA 4XMGA 1DC9A 3EBWA 1KOIA 1OBQA 1EPBA 4OS8A 3C76X 2CBSA 4KCAA 4MVLA 5KICA 1D2UA 4I3BA 4JGLA 2YMSA 1HMTA 3CMPA 1YIVA 2R73A 3FELA 1IFCA 1I06A 2ACPX 3NP1A 4QZTA 4TQ2A 4A60A 5AEOA 3WJCA 3B2JA 5D4AA 5BVTA 3RWXA 4I95A 3UEWA 3H3IA 4GRJA 3WXQA 2QMIA 3HWEA 4TKBA 1KQXA 1AB0A 1AVGI 3UEUA 4QGVA 4O3WA 1Z24A 3P6DA 4ARHA 2AT8X 1ZRYA 4EXZA 5HBSA 4A8ZA 3TGBA 4FQBB 5F7GA 2NNQA 4YDBA 2GTLM 2ZAGA 3NQKA 1IIUA 1PBOA 5AQ6A 1LIEA 3FLLA 5HCEC 4KC7A 2HYSA 3NX2A 4LKPA 1FENA 3APXA 3VG6A 2AMMX 3KFFA 3ZUOA 1X89A 2P8GA 2F09A 1JYDA 2QO4A 4EFGA 1KXOA 1KQWA 2GTLN 1BEBA 4L1NA 1DZJA 5HTEA 3KZAA 3WJGA 1SXYA 4FBRA 1ZNKA 3DSZA 4ZHDA 2Q4NA 4COTA 4GETA 1U17A 1ZNHA 2PY1A 1ZNEA 4U3QA 4AZPA 4FGIB 4EDEA 4YH0A 4TKJA 3JQOA 1TW4A 5HA0A 4ZGUA 1PEEA 1VYGA 1NP4A 1G85A 4AYHA 3ZW0A 4UU3A 5HAEA 2FR3A 2KD2A 4O4SA 1CRBA 2FTBA 3ZWEA 2WEWA 3G7XA 4INNA 1XCAA 1SY2A 1S44A 3PP6A 4IAWA 1QG5A 4QNIA 4U8UM 3T1DA 3STNA 2JU3A 3WBGA 5DPQA 3OE3A 5HZQA 3VG3A 4Y0SA 4Y0QA 4YBUA 2WWPA 3U9PC 1HBPA 4ZCBA 5B29A 1QY2A 2AT0X 2XSTA 3P24A 4L3RA 1AELA 2LBAA 1E00A 4U8UN 1G74A 4CV7A 1JV4A 3B2HA 4QZUA 2A3FX 5LKFA 3C78X 5LKEA 1B8EA 3IA8A 3FA8A 4GKCA 3HWDA 4KC8A 1QQSA 1UREA 1LICA 2HMBA 2WUTA 3VE2A 1YWBA 3KFIA 4YFPA 5LJHA 2FRSA 3RZYA 5JR8A 2ANSA 2G7BA 4ORXA 4YFQA 3FA7A 3CBCA 4O4UA 3ZI8A 1B56A 1PM1X 2HZQA 2LKKA 5L8NA 1D3SA 3ZUIA 4NW4A 4TJZA 1EXSA 2ACOA 3BX8A 1X8PA 3ELXA 3FA9A 3Q6LA 4AZQA 4CSBA 4ZR2A 3HWFA 2BHVA 2FS7A 3P6HA 4YBPA 3FW5A 3UEVA 3O19A 4NLJA 4QGWA 3L4RA 2K62A 3IFBA 1YWCA 3CQNA 5LJBA 3HWGA 1QWDA 3WJDA 4AZOA 2WEXA 2Q2PA 4O4XA 2FS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FR2 A;  1EII A;  1EPA A;  1KT7 A;  2JU8 A;  5EED A;  3STK A;  4IMN A;  4GE1 A;  1SXU A;  2CM9 A;  1E02 A;  1CBS A;  5L8I A;  1CBI A;  2A2U A;  3PH5 A;  3FR4 A;  1ICN A;  2XKL A;  4YMY A;  5HCC C;  5LJE A;  2G78 A;  3FW4 A;  4K19 A;  4YGG A;  4CK4 A;  5IO6 A;  3CR6 A;  2A0A A;  4GH7 A;  4MVI A;  1LNM A;  1DZM A;  1RBP A;  1TOW A;  1CBQ A;  5FEN A;  1A18 A;  4ZHC A;  1O1V A;  1YWA A;  2CBR A;  5D45 A;  2POA A;  1XKI A;  2KTD A;  3B2L A;  3KFH A;  4NP1 A;  4LZV A;  1L6M A;  4Y0R A;  3F8A A;  3NPO A;  1OEJ A;  1ERB A;  3P6F A;  5C0N A;  3P6E A;  2NND A;  4I3D A;  3BRN A;  1VYF A;  4NNT A;  3D96 A;  1S2P A;  5F1E A;  1IKE A;  1OPA A;  4WFV A;  1T8V A;  3JSQ A;  1MUP A;  4AZR A;  1GXA A;  1LIB A;  1CJ5 A;  1HMR A;  1DZP A;  4IAX A;  3ZQ3 A;  2K23 A;  2E4J A;  2AKQ A;  2L67 A;  3WJE A;  2OVE A;  5EEE A;  2MM3 A;  1LIF A;  4AZM A;  1GM6 A;  3APW A;  1GT4 A;  3FR5 A;  5DG4 A;  4IMO A;  1OEK A;  4HPA A;  4MVK A;  2JN3 A;  3UEX A;  5EPQ A;  3NR3 A;  4HPB A;  1X8U A;  4XMF A;  4QGX A;  1QFV A;  2RCQ A;  1T68 X;  1OBP A;  4A1Y A;  4YGZ A;  2FLJ A;  2OFR X;  1GX9 A;  2N93 A;  4OMX A;  3NX1 A;  1B0O A;  1YP7 A;  2W2A A;  1BSO A;  4HFO A;  4HPD A;  2OVA A;  5H9K A;  1I05 A;  2LB6 A;  1E06 A;  3WVM A;  4ALO A;  2QOS C;  5D47 A;  1OPB A;  1H91 A;  4ZH6 A;  3C77 X;  1NP1 A;  2AH7 X;  4BQU A;  4WBK A;  4NNS A;  5HCD C;  3PEC A;  2L9C A;  2QO6 A;  2CZT A;  3FEP A;  3GAQ A;  1LID A;  1BRQ A;  5H9A A;  1DFV A;  4XMC A;  4D6A A;  2FT9 A;  4RUN A;  4DQ3 A;  1A2D A;  2CZU A;  1ZND A;  4LKT A;  3WJF A;  4QAE A;  2JU7 A;  1QY1 A;  4A1H A;  3HK1 A;  3K3L A;  5EDC A;  4GNY A;  2GJ5 A;  1ML7 A;  1GKA A;  4GNW A;  1I4U A;  1GGL A;  5IO5 A;  4OS0 A;  2GC9 A;  1ICM A;  1N0S A;  2BLG A;  2LBV A;  1BRP A;  2A2G A;  1MDC A;  4BVM A;  5LJK A;  4HPC A;  2AT5 X;  3VG7 A;  5F6B A;  3P6G A;  1HBQ A;  4Y0P A;  3FIQ A;  1UZ2 X;  1SXW A;  3RSW A;  1YWD A;  2MO5 A;  4TNN A;  3BSZ E;  5KID A;  1E5P A;  4RUU A;  4DQ4 A;  2HNX A;  3JS1 A;  4I3C A;  4XMH A;  5B27 A;  4LZU A;  1QY0 A;  4N7C A;  1BSY A;  1B4M A;  2RD7 C;  5LJG A;  4ZHG A;  2AT3 X;  1G7N A;  5F6Z A;  4ORY A;  4UU2 A;  2LFO A;  2NNE A;  3EBK A;  5HWZ A;  1KZX A;  1S7D A;  3FA6 A;  1LF7 A;  4QYN A;  1GT1 A;  1LKE A;  4I9S A;  2RCT A;  4ORR A;  1BSQ A;  1IFB A;  1JZU A;  3B2K A;  4TLJ A;  3BS2 A;  5LJC A;  1DF3 A;  3NAD A;  5FFH A;  2QO5 A;  1T0V A;  4I9R A;  4XMD A;  3BY0 A;  4WFU A;  5H9L A;  4NLI A;  1YP6 A;  3TGA A;  3U03 A;  1G5W A;  1EIO A;  3VG2 A;  1HN2 A;  1O8V A;  3MBT A;  1OBU A;  1KT5 A;  1CBR A;  4ORU A;  2R74 A;  1X8N A;  4M7M A;  3F9D A;  5L8O A;  3EYC A;  3U0D A;  1X8O A;  2WQA E;  3PH6 A;  1KT3 A;  2HZR A;  2F73 A;  2WSJ A;  1X71 A;  2WR6 A;  2EU7 X;  1EQD A;  4ES7 A;  1U0X A;  4BOE A;  2W2F A;  4IB6 A;  4R0B A;  4YKM A;  3MVF A;  3TZS A;  5HZ8 A;  5HTD A;  4D6B A;  2A13 A;  1SY0 A;  1QFT A;  5K06 A;  1SXX A;  2OVD A;  4ORS A;  1EW3 A;  3O22 A;  3KFG A;  2Q9S A;  1TXL A;  3QKG A;  5F58 A;  4YKO A;  1SY1 A;  2G79 A;  2OZQ A;  4QYP A;  1TVQ A;  3FEN A;  3KQ0 A;  1GKA B;  3APV A;  5HA1 A;  5BVQ A;  1R0U A;  2NP1 A;  4ODD A;  1ACD A;  2L68 A;  1ADL A;  2L5P A;  2RA6 A;  1KGL A;  1FEM A;  2O62 A;  4AW8 A;  4YDA A;  4YFR A;  4N7D A;  3BDR A;  1LFO A;  2DM5 A;  2Q39 A;  4ZFX A;  4ZHH A;  4IB8 A;  1MX8 A;  5HZ6 A;  1BM5 A;  1NGL A;  3NQ3 A;  5HZ5 A;  4O9S A;  4YCH A;  3S26 A;  1EUO A;  2WQ9 A;  4M6S A;  4KII A;  4NYR A;  1PMP A;  3OJY C;  2W2B A;  5IO7 A;  3CBS A;  3WJB A;  2Q2M A;  1GX8 A;  4NYQ A;  1BBP A;  4OS3 A;  1FTP A;  3TF6 A;  2IFB A;  5HZ9 A;  3STM X;  1KT6 A;  3P6C A;  5EDB A;  1I04 A;  3AKN A;  2HLV A;  1FE3 A;  1MVG A;  2AL0 X;  2FWV A;  2FR2 A;  5D8J A;  1FEL A;  2YG2 A;  4IB9 A;  3VG5 A;  3I17 A;  1HMS A;  1GT5 A;  3VG4 A;  1KZW A;  1ZNL A;  1AQB A;  4ORW A;  3EMM A;  2X46 A;  3NQ9 A;  2X45 A;  3EM0 A;  4EEJ A;  1KT4 A;  1O1U A;  1OEE A;  5KHP A;  1U18 A;  3D97 A;  1BLR A;  2AT6 X;  4YCE A;  3PED A;  1A57 A;  4PSQ A;  4ZHF A;  1ALB A;  1IKJ A;  4ZH9 A;  1SA8 A;  4TKH A;  5BVS A;  3BX7 A;  3BLG A;  1A3Y A;  1X8Q A;  3AKM A;  1SY3 A;  3APU A;  3BU1 A;  3CWK A;  3BU9 A;  1FDQ A;  1QAB E;  2JOZ A;  5EZ2 A;  5FAZ A;  5LJD A;  4ZJ0 A;  3PPT A;  2KT4 B;  3TGC A;  1ERX A;  4YGH A;  1P6P A;  3D95 A;  3B2I A;  1HQP A;  4ALB A;  1DZK A;  3SAO A;  2CM4 A;  2MJI A;  3FEK A;  1GT3 A;  1BJ7 A;  3CQR A;  4AZN A;  1IW2 A;  5H8T A;  3FMZ A;  2QM9 A;  4IBA A;  5D48 A;  1MX7 A;  1JBH A;  1LPJ A;  5CE4 A;  5H9N A;  1YUP A;  1JYJ A;  4IB7 A;  2ASN X;  1DV9 A;  2GTF X;  2ALL X;  3O2Y A;  2R56 A;  1VPR A;  2RQ0 A;  2OFM X;  1EAL A;  1ZNG A;  1RLB E;  3DTQ A;  1JJX A;  1TOU A;  1JJJ A;  1BWY A;  3I0A A;  4XME A;  3ELZ A;  4XMG A;  1DC9 A;  3EBW A;  1KOI A;  1OBQ A;  1EPB A;  4OS8 A;  3C76 X;  2CBS A;  4MVL A;  5KIC A;  1D2U A;  4I3B A;  1HMT A;  3CMP A;  1YIV A;  2R73 A;  3FEL A;  1IFC A;  1I06 A;  2ACP X;  3NP1 A;  4QZT A;  4TQ2 A;  4A60 A;  3WJC A;  3B2J A;  5D4A A;  5BVT A;  3UEW A;  4GRJ A;  3WXQ A;  3HWE A;  4TKB A;  1KQX A;  1AB0 A;  1AVG I;  3UEU A;  4QGV A;  4ARH A;  1Z24 A;  3P6D A;  2AT8 X;  1ZRY A;  4EXZ A;  5HBS A;  4A8Z A;  3TGB A;  5F7G A;  2NNQ A;  4YDB A;  1IIU A;  1PBO A;  5AQ6 A;  1LIE A;  3FLL A;  5HCE C;  2HYS A;  3NX2 A;  4LKP A;  1FEN A;  3APX A;  3VG6 A;  2AMM X;  3KFF A;  3ZUO A;  1X89 A;  2P8G A;  1JYD A;  2QO4 A;  4EFG A;  1KXO A;  1KQW A;  5HTE A;  1BEB A;  1DZJ A;  3KZA A;  3WJG A;  1SXY A;  1ZNK A;  3DSZ A;  4ZHD A;  2Q4N A;  4GET A;  1U17 A;  1ZNH A;  2PY1 A;  1ZNE A;  4AZP A;  4EDE A;  4YH0 A;  4TKJ A;  1TW4 A;  5HA0 A;  4ZGU A;  1PEE A;  1VYG A;  1NP4 A;  1G85 A;  4AYH A;  4UU3 A;  5HAE A;  2FR3 A;  1CRB A;  2FTB A;  2WEW A;  3G7X A;  3T1D A;  1XCA A;  1SY2 A;  1S44 A;  3PP6 A;  4IAW A;  1QG5 A;  3STN A;  2JU3 A;  3WBG A;  5DPQ A;  5HZQ A;  3VG3 A;  4Y0S A;  4Y0Q A;  4YBU A;  2WWP A;  3U9P C;  1HBP A;  4ZCB A;  5B29 A;  1QY2 A;  2AT0 X;  2XST A;  1AEL A;  2LBA A;  1E00 A;  1G74 A;  1JV4 A;  3B2H A;  4QZU A;  2A3F X;  5LKF A;  3C78 X;  5LKE A;  1B8E A;  3IA8 A;  3FA8 A;  4GKC A;  3HWD A;  1QQS A;  1URE A;  1LIC A;  2HMB A;  2WUT A;  1YWB A;  3KFI A;  4YFP A;  5LJH A;  2FRS A;  3RZY A;  5JR8 A;  2ANS A;  2G7B A;  4ORX A;  4YFQ A;  3FA7 A;  3CBC A;  1B56 A;  1PM1 X;  2HZQ A;  2LKK A;  5L8N A;  1D3S A;  3ZUI A;  4TJZ A;  1EXS A;  2ACO A;  3BX8 A;  1X8P A;  3ELX A;  3FA9 A;  3Q6L A;  4AZQ A;  4ZR2 A;  3HWF A;  2FS7 A;  3P6H A;  4YBP A;  3FW5 A;  3UEV A;  3O19 A;  4NLJ A;  4QGW A;  3L4R A;  2K62 A;  3IFB A;  1YWC A;  3CQN A;  5LJB A;  3HWG A;  1QWD A;  3WJD A;  4AZO A;  2WEX A;  2Q2P A;  4OMW A;  2FS6 A; 
#chains in the Genus database with same CATH topology
 3FR2 A;  1EII A;  1SWH A;  1EPA A;  1KT7 A;  2JU8 A;  5EED A;  3STK A;  2KW1 A;  2ZAI A;  4IMN A;  4CDE A;  2G8C O;  4GE1 A;  2BS6 A;  1SXU A;  2CM9 A;  1E02 A;  1CBS A;  5L8I A;  1CBI A;  2A2U A;  3PH5 A;  4KH8 A;  3HTY A;  5F2B A;  3FR4 A;  1ICN A;  4Z27 A;  1HY2 A;  2XKL A;  1SRG A;  2RTP B;  3LHN A;  4YMY A;  5HCC C;  5LJE A;  2G78 A;  3FW4 A;  1SLD B;  1SWR A;  4K19 A;  3RBY A;  4YGG A;  4CK4 A;  1Y55 X;  5IO6 A;  3CR6 A;  2A0A A;  4GH7 A;  4MVI A;  3ZW0 B;  1LNM A;  1DZM A;  2RTK A;  3RY2 A;  1W6F A;  1RBP A;  2G5L A;  1AVD A;  1TOW A;  1CBQ A;  3RDM A;  1WBI A;  5FEN A;  2Z4H A;  4CPH B;  1A18 A;  4DNE A;  1O1V A;  1YWA A;  4ZHC A;  2CBR A;  5D45 A;  1SWF A;  1JIW I;  2POA A;  1XKI A;  2KTD A;  2MHD A;  3B2L A;  4GDZ A;  3RDU A;  3RE5 A;  2RTO B;  3KFH A;  4NP1 A;  3LV4 A;  4LZV A;  1L6M A;  4Y0R A;  3F8A A;  3NPO A;  1OEJ A;  1ERB A;  3P6F A;  4ID2 A;  2I5Z O;  3Q34 A;  5C0N A;  2IZH B;  4O49 A;  3P6E A;  1DF8 A;  2NND A;  5AJC A;  4I3D A;  4EKV A;  3BRN A;  2WPU A;  3PQU A;  1VYF A;  1FJ1 E;  2OY8 A;  4NNT A;  4CPE A;  3D96 A;  1IJ8 A;  3CKG A;  1S2P A;  5F1E A;  1IKE A;  1OPA A;  4WFV A;  1T8V A;  3D9W A;  1MUP A;  3JSQ A;  1GXA A;  1LIB A;  3E3C A;  4AZR A;  2Z4I A;  1CJ5 A;  1N4J A;  2FGS A;  1DZP A;  1HMR A;  4IAX A;  1SLE B;  3ZQ3 A;  2FHL A;  2K23 A;  2E4J A;  2AKQ A;  2L67 A;  3F6Z B;  2X56 A;  3WJE A;  3AEH A;  1MOY A;  1PTS A;  2OVE A;  2QOM A;  2CAM A;  2RTB B;  2JGS A;  5EEE A;  2MM3 A;  1LIF A;  4AZM A;  1GM6 A;  1JMX A;  3APW A;  5CSE A;  1PBY A;  1GT4 A;  3FR5 A;  5DG4 A;  1SWT A;  1OEK A;  4HPA A;  4IMO A;  2JN3 A;  4MVK A;  4QQ1 A;  4ON1 A;  1SRH A;  4U46 A;  3UEX A;  4PJ2 A;  5EPQ A;  3NR3 A;  2GTL O;  3QQ2 A;  4FBV A;  4HPB A;  1SLG B;  2IZF B;  5JD2 A;  1X8U A;  4XMF A;  4QGX A;  1QFV A;  3OD9 A;  2RCQ A;  2UYW A;  1T68 X;  1OBP A;  4A1Y A;  1WUB A;  4YGZ A;  3RKG A;  2FLJ A;  2OFR X;  1GX9 A;  2N93 A;  2FKG A;  4OMX A;  2OL8 O;  4GJS A;  4DCB A;  4GGZ A;  3NX1 A;  1B0O A;  1YP7 A;  3VHM A;  3T1D A;  1LUQ A;  2W2A A;  1VWJ B;  1BSO A;  1KL5 A;  4HFO A;  2OVA A;  4HPD A;  4WHI A;  5H9K A;  4O3Z A;  1I05 A;  4I6S A;  2LB6 A;  1E06 A;  3WVM A;  2KTS A;  4ALO A;  2X8S A;  1VWK B;  1VWE B;  2QOS C;  5D47 A;  1OPB A;  4IAB A;  2X8T A;  1H91 A;  4ZH6 A;  3AUM O;  3C77 X;  1NP1 A;  1VWQ B;  2AH7 X;  4GU8 A;  3SLT A;  2A5C A;  4WBK A;  4BQU A;  1K3B A;  4NNS A;  5B5G A;  5HCD C;  3PEC A;  2L9C A;  2QO6 A;  2CZT A;  2JMB A;  3FEP A;  2ZSC A;  3GAQ A;  3NBX X;  3UAQ A;  3VGW A;  2BC3 A;  2RTM A;  2RTD B;  2VFC A;  1LID A;  1BRQ A;  5H9A A;  1DFV A;  1MK5 A;  4XMC A;  4D6A A;  2FT9 A;  4RUN A;  4DQ3 A;  1A2D A;  1ZND A;  2CZU A;  2OF8 A;  4GZV A;  4LKT A;  4U8U O;  2OY5 O;  3WJF A;  2RN4 A;  4U9C A;  4QAE A;  3RE6 A;  2JU7 A;  1QY1 A;  2HKD A;  4A1H A;  3WZO A;  3HK1 A;  3K3L A;  5EDC A;  4OEM A;  4BCS A;  4GNY A;  2GJ5 A;  1ML7 A;  1GKA A;  4GNW A;  1I4U A;  1GGL A;  2IZA A;  2OY1 O;  4NV8 A;  2GC9 A;  4OS0 A;  5IO5 A;  1OSP O;  2IZI A;  2JW1 A;  1STS B;  1LDO A;  3HOE A;  1ICM A;  1N0S A;  3T2X A;  1SWQ A;  2BLG A;  2LBV A;  4BGF A;  1BRP A;  2A2G A;  1MDC A;  3VU1 A;  4BVM A;  4ZGF A;  5LJK A;  4HPC A;  3EW1 A;  3EC5 A;  2AT5 X;  3ZZV A;  2Y3E A;  3VG7 A;  5F6B A;  3P6G A;  3GE2 A;  1HBQ A;  4Y0P A;  3FIQ A;  1UZ2 X;  1SXW A;  1SRF A;  4YVB A;  3RSW A;  1SWP A;  1YWD A;  2BT9 A;  2MO5 A;  2I5V O;  3MX7 A;  4TNN A;  3BSZ E;  5KID A;  4GGR A;  1SWU A;  1E5P A;  4RUU A;  4DQ4 A;  2HNX A;  3JS1 A;  4I3C A;  4LQZ A;  3SZJ A;  1VWR B;  4XMH A;  5B27 A;  3ZW2 A;  2RTE B;  4LZU A;  1QY0 A;  2IZJ A;  3MG5 A;  4N7C A;  1BSY A;  1B4M A;  3VHI A;  2OY7 A;  2RD7 C;  5LJG A;  4ZHG A;  1STP A;  2AT3 X;  4KT5 A;  1G7N A;  5F6Z A;  4ORY A;  4UU2 A;  2LFO A;  2NNE A;  3EBK A;  5HWZ A;  1KZX A;  1S7D A;  3FA6 A;  1LF7 A;  4QYN A;  1GT1 A;  1LKE A;  2C4I A;  4I9S A;  2RCT A;  5IXG A;  4ORR A;  1BSQ A;  1IFB A;  1JZU A;  3B2K A;  2FKJ A;  4TLJ A;  1N9M A;  3BS2 A;  2FHN X;  5FQ6 E;  5LJC A;  2BSZ A;  1DF3 A;  3NAD A;  5FFH A;  2QO5 A;  3HPE A;  1T0V A;  4I9R A;  4XMD A;  4GDA A;  3BY0 A;  4WFU A;  5H9L A;  2X8F A;  4NLI A;  1YP6 A;  3TGA A;  3U03 A;  5B29 A;  1G5W A;  1SWK A;  2X32 A;  1EIO A;  4JO6 A;  3VG2 A;  1HN2 A;  1O8V A;  4QRL A;  3MBT A;  3WYP A;  1OBU A;  3WOV A;  1KT5 A;  1VWL B;  1CBR A;  2IZE B;  4ORU A;  2R74 A;  2C1S A;  4OKA A;  1X8N A;  1SRI A;  1Y9L A;  2IZC B;  1NQM A;  4M7M A;  3F9D A;  5L8O A;  3EYC A;  4HWM A;  3U0D A;  1X8O A;  2WQA E;  3PH6 A;  4O4O A;  1KT3 A;  2HZR A;  3VPJ E;  1W4T A;  2F73 A;  4O3Y A;  2WSJ A;  1X71 A;  2WR6 A;  2EU7 X;  4B55 A;  1EQD A;  4ES7 A;  1STR B;  1U0X A;  2OVS A;  4BOE A;  2W2F A;  4IB6 A;  4R0B A;  4YKM A;  3MVF A;  3TZS A;  5HZ8 A;  5HTD A;  4D6B A;  1Y52 X;  2A13 A;  3ZW1 A;  5K68 A;  1SY0 A;  1QFT A;  5K06 A;  1VWA B;  2AF5 A;  3X00 A;  1SXX A;  2OVD A;  1VYO A;  1EW3 A;  1MM9 A;  1VWD B;  4ORS A;  3O22 A;  3KFG A;  5AJB A;  2Q9S A;  1TXL A;  3QKG A;  1SWA A;  4IRW A;  1LCZ A;  4YKO A;  5F58 A;  1SY1 A;  2G79 A;  2OZQ A;  4QYP A;  1TVQ A;  3FEN A;  3KQ0 A;  1GKA B;  3APV A;  5HA1 A;  5BVQ A;  1R0U A;  2NP1 A;  1I78 A;  1SWB A;  4ODD A;  1ACD A;  3S5V A;  3FID A;  4CDF A;  2L68 A;  1ADL A;  2L5P A;  3KVN A;  2A5B A;  2RA6 A;  1KGL A;  1FEM A;  4MEE A;  1RXH A;  2O62 A;  1VWO B;  1HXL A;  2OFA A;  4AW8 A;  3SOT A;  2OYB O;  2DJF A;  2RTN B;  4YDA A;  2GH7 A;  4YFR A;  3VE1 A;  3S60 A;  4N7D A;  3BDR A;  1LFO A;  2DM5 A;  2Q39 A;  4ZFX A;  4ZHH A;  4IB8 A;  1MX8 A;  5HZ6 A;  2RTL A;  3FYF A;  1BM5 A;  1NGL A;  2RTF B;  2X55 A;  5B2A O;  3NQ3 A;  3PQS A;  4O9S A;  1VWP B;  4YCH A;  3S26 A;  1EUO A;  5HZ5 A;  2WQ9 A;  4M6S A;  1SWL A;  4KII A;  5BYP A;  4NYR A;  1PMP A;  4EQA C;  1SWG A;  2W2B A;  3OJY C;  5IO7 A;  3CBS A;  3WJB A;  2Q2M A;  1GX8 A;  1SMP I;  4NYQ A;  1BBP A;  1Y9T A;  4OS3 A;  2A8G A;  1FTP A;  3TF6 A;  3D4R A;  3N91 A;  2IFB A;  5HZ9 A;  3WYQ A;  3STM X;  2UZ2 A;  1KT6 A;  2FS6 A;  2OL6 O;  1SRJ A;  3P6C A;  3PK2 A;  1I04 A;  5EDB A;  3VHH A;  3PDF A;  3AKN A;  2HLV A;  1FE3 A;  1MVG A;  2AL0 X;  2FWV A;  2FR2 A;  3CKF A;  1FEL A;  5D8J A;  2YG2 A;  1Y0G A;  4IB9 A;  3VG5 A;  1VWF B;  2MWH A;  1HMS A;  1GT5 A;  3I17 A;  3VG4 A;  1ZNL A;  1KZW A;  1AQB A;  4ORW A;  5FQ8 E;  3EMM A;  1SWJ A;  2X46 A;  3NQ9 A;  2X45 A;  3EM0 A;  1HQQ A;  1UYN X;  1KT4 A;  1O1U A;  1RXK A;  4EEJ A;  1OEE A;  5KHP A;  1U18 A;  3SZH A;  3V8U A;  3D97 A;  3MM0 A;  1BLR A;  1SWS A;  2AT6 X;  4YCE A;  1JJU A;  3P02 A;  1Y53 X;  3PED A;  1A57 A;  4PSQ A;  2IZL B;  3S5X A;  1ALB A;  1IKJ A;  4O3X B;  4ZHF A;  4ZH9 A;  1NQN A;  1SA8 A;  4MIS A;  4OMW A;  4TKH A;  5BVS A;  3BX7 A;  3BLG A;  4GK9 A;  1A3Y A;  4ML7 B;  5L3Y A;  1X8Q A;  1N43 A;  3AKM A;  1SY3 A;  3APU A;  3BU1 A;  3CWK A;  3BU9 A;  1FDQ A;  1QAB E;  2JOZ A;  5EZ2 A;  2RTG B;  2RTH B;  5FAZ A;  5LJD A;  4ZJ0 A;  2PI3 O;  3PPT A;  5CHK A;  5IRU A;  2M4L A;  2KT4 B;  3TGC A;  3WZQ A;  1ERX A;  4YGH A;  1P6P A;  2LA7 A;  3D95 A;  2DJG A;  1SWE A;  3OBL A;  2IZD B;  3B2I A;  1HQP A;  4FBO A;  4ALB A;  1DZK A;  3SAO A;  5B3M O;  2CM4 A;  2MJI A;  3FEK A;  4BX6 A;  1GT3 A;  4Y59 A;  1BJ7 A;  3CQR A;  4AZN A;  1IW2 A;  1RAV A;  5H8T A;  2X4M A;  3FMZ A;  1LCW A;  1UYO X;  3ZW1 B;  5FQ7 E;  4Z2V A;  3HOL A;  2QM9 A;  4IBA A;  5D48 A;  1MX7 A;  1JBH A;  3RDS A;  1LPJ A;  5CE4 A;  5H9N A;  1YUP A;  1JYJ A;  4MIR A;  4JHQ A;  5B10 O;  4CPI A;  1MEP A;  4IB7 A;  2ASN X;  1DV9 A;  2GTF X;  1VWG B;  2ALL X;  3O2Y A;  2R56 A;  3RY1 A;  1VPR A;  1NDJ A;  2RQ0 A;  3LTW A;  2OFM X;  1EAL A;  1ZNG A;  1EI5 A;  1RLB E;  3DTQ A;  1TOU A;  4NV7 A;  5CYB A;  1BWY A;  1JJJ A;  1JJX A;  3I0A A;  4XME A;  4Z6J A;  4MVE A;  2BS5 A;  3ELZ A;  1K24 A;  4XMG A;  1DC9 A;  3EBW A;  4Y5D A;  3RDO A;  1KOI A;  4I60 A;  1OBQ A;  1EPB A;  4OS8 A;  3C76 X;  2CBS A;  2RTI B;  1NBX A;  4KCA A;  4MVL A;  5KIC A;  1D2U A;  4I3B A;  4JGL A;  2YMS A;  4BJ8 A;  4BX5 A;  1HMT A;  3CMP A;  1YIV A;  2RTJ A;  2R73 A;  3FEL A;  3RDQ A;  1IFC A;  1I06 A;  2ACP X;  3NP1 A;  4QZT A;  4TQ2 A;  4A60 A;  5AEO A;  3WJC A;  3B2J A;  5D4A A;  5BVT A;  3RWX A;  4I95 A;  3UEW A;  3H3I A;  3WZP A;  4GRJ A;  3WXQ A;  5K67 A;  2QMI A;  3HWE A;  2F01 A;  1KQX A;  1AB0 A;  1AVG I;  3UEU A;  4TKB A;  2VFB A;  4QGV A;  4O3W A;  1Z24 A;  3P6D A;  4ARH A;  2IZG B;  2AT8 X;  1ZRY A;  4BX7 A;  4EXZ A;  5HBS A;  4A8Z A;  3TGB A;  3RDX A;  4CDC A;  2OL7 A;  4FQB B;  2NNQ A;  5F7G A;  5IRA A;  4YDB A;  1E2T A;  2GTL M;  2ZAG A;  3NQK A;  1IIU A;  1PBO A;  1SWD A;  5AQ6 A;  1LIE A;  3FLL A;  5HCE C;  1VWH B;  4KC7 A;  2HYS A;  3NX2 A;  4LKP A;  1AVE A;  1FEN A;  3APX A;  3VG6 A;  2AMM X;  3KFF A;  3ZUO A;  1X89 A;  2P8G A;  1RSU B;  1JYD A;  1VWM B;  2F09 A;  1KXO A;  2QO4 A;  4JNJ A;  4EFG A;  1KQW A;  2GTL N;  1BEB A;  4L1N A;  1DZJ A;  5HTE A;  3KZA A;  3WJG A;  2OF9 A;  1HXZ A;  1SXY A;  3VG3 A;  4FBR A;  1ZNK A;  3DSZ A;  4ZHD A;  2Q4N A;  4COT A;  4GET A;  1U17 A;  1ZNH A;  1SLF B;  2PY1 A;  1ZNE A;  4U3Q A;  4AZP A;  4FGI B;  2Y32 A;  2C1Q A;  4EDE A;  4YH0 A;  4TKJ A;  1RXJ A;  4Z2P A;  3JQO A;  4GD9 A;  1TW4 A;  1LEL A;  5HA0 A;  4ZGU A;  1PEE A;  1VYG A;  1NP4 A;  1G85 A;  4AYH A;  3ZW0 A;  2VDF A;  4UU3 A;  5HAE A;  2FR3 A;  2KD2 A;  2QCB A;  4O4S A;  4GJV A;  1LCV A;  1CRB A;  1SWO A;  3T6F A;  1N9Y A;  2FTB A;  3ZWE A;  2WEW A;  3G7X A;  4INN A;  1XCA A;  1SY2 A;  1S44 A;  2RTQ B;  3PP6 A;  1QG5 A;  1SWN A;  4IAW A;  4QNI A;  4U8U M;  1W5R A;  4Z28 A;  3STN A;  4BX6 B;  2JU3 A;  3WBG A;  5DPQ A;  3OE3 A;  5HZQ A;  2RTA A;  2Y3F A;  4Y0S A;  4Y0Q A;  4YBU A;  2WWP A;  3SLO A;  1HBP A;  2IZK A;  4ZCB A;  5B11 O;  3T6L A;  3U9P C;  1QY2 A;  2AT0 X;  2XST A;  3P24 A;  4L3R A;  4OEL A;  2LBA A;  2RTR B;  1AEL A;  1E00 A;  3WZN A;  2X34 A;  4U8U N;  1G74 A;  4CV7 A;  1JV4 A;  3B2H A;  4QZU A;  2A3F X;  5LKF A;  2AVI A;  2MF6 A;  3SLJ A;  4CPH A;  3C78 X;  5LKE A;  2RTC B;  1B8E A;  3IA8 A;  3FA8 A;  4BBO A;  3T2W A;  4GKC A;  1VWC B;  3HWD A;  4KC8 A;  1QQS A;  1RST B;  1URE A;  1LIC A;  2HMB A;  2WUT A;  3VE2 A;  1YWB A;  3KFI A;  4YFP A;  1SRE A;  5LJH A;  2FRS A;  3EW2 A;  4BX5 B;  3RZY A;  1KFF A;  4C5P A;  1KL3 A;  4CPF A;  2ANS A;  2G7B A;  4ORX A;  5JR8 A;  4YFQ A;  3FA7 A;  3CBC A;  4O4U A;  5IRW A;  1VWI B;  1I9H A;  1VWB B;  2OFB A;  1SWC A;  3SZI A;  3ZI8 A;  1B56 A;  1PM1 X;  2HZQ A;  2LKK A;  5L8N A;  1D3S A;  3ZUI A;  3FDC A;  4NW4 A;  4GGT A;  1EXS A;  2ACO A;  3BX8 A;  1X8P A;  3ELX A;  3FA9 A;  3Q6L A;  1JQP A;  4TJZ A;  4AZQ A;  4CSB A;  4ZR2 A;  3HWF A;  1KL4 A;  2BHV A;  2FS7 A;  1JMZ A;  3P6H A;  4YBP A;  1N7Y A;  4BX7 B;  4Z2O A;  3FW5 A;  1GX3 A;  4GUZ A;  3UEV A;  5B5F A;  2IZB A;  3O19 A;  4NLJ A;  4QGW A;  3L4R A;  2K62 A;  3IFB A;  4CDD A;  1YWC A;  3CQN A;  5LJB A;  3HWG A;  1QWD A;  1VWN B;  3WJD A;  4AZO A;  2WEX A;  1NC9 A;  2Q2P A;  4O4X A;  1LDQ A; 
#chains in the Genus database with same CATH homology
 3FR2 A;  1EII A;  1EPA A;  1KT7 A;  2JU8 A;  5EED A;  3STK A;  2KW1 A;  2ZAI A;  4IMN A;  4GE1 A;  2BS6 A;  1SXU A;  2CM9 A;  1E02 A;  1CBS A;  5L8I A;  1CBI A;  2A2U A;  3PH5 A;  4KH8 A;  3HTY A;  3FR4 A;  1ICN A;  2XKL A;  4YMY A;  3LHN A;  5HCC C;  5LJE A;  2G78 A;  3FW4 A;  4K19 A;  3RBY A;  4YGG A;  4CK4 A;  5IO6 A;  3CR6 A;  2A0A A;  4GH7 A;  4MVI A;  3ZW0 B;  1LNM A;  1DZM A;  1RBP A;  1TOW A;  1CBQ A;  5FEN A;  2Z4H A;  1A18 A;  4ZHC A;  1O1V A;  1YWA A;  2CBR A;  5D45 A;  1JIW I;  2POA A;  1XKI A;  2KTD A;  2MHD A;  3B2L A;  4GDZ A;  3KFH A;  4NP1 A;  3LV4 A;  4LZV A;  1L6M A;  4Y0R A;  3F8A A;  3NPO A;  1OEJ A;  1ERB A;  3P6F A;  4ID2 A;  5C0N A;  4O49 A;  3P6E A;  2NND A;  5AJC A;  4I3D A;  3BRN A;  3PQU A;  1VYF A;  4NNT A;  3D96 A;  1S2P A;  5F1E A;  1IKE A;  1OPA A;  4WFV A;  1T8V A;  3JSQ A;  1MUP A;  4AZR A;  1GXA A;  1LIB A;  3E3C A;  2Z4I A;  1CJ5 A;  1HMR A;  1DZP A;  4IAX A;  3ZQ3 A;  2K23 A;  2E4J A;  2AKQ A;  2L67 A;  3F6Z B;  3WJE A;  2OVE A;  5EEE A;  2MM3 A;  1LIF A;  4AZM A;  1GM6 A;  3APW A;  1GT4 A;  3FR5 A;  5DG4 A;  4IMO A;  1OEK A;  4HPA A;  4MVK A;  2JN3 A;  4QQ1 A;  3UEX A;  4ON1 A;  4PJ2 A;  5EPQ A;  3NR3 A;  2GTL O;  4FBV A;  4HPB A;  1X8U A;  4XMF A;  4QGX A;  1QFV A;  3OD9 A;  2RCQ A;  1T68 X;  1OBP A;  4A1Y A;  4YGZ A;  3RKG A;  2FLJ A;  2OFR X;  1GX9 A;  2N93 A;  4OMX A;  3NX1 A;  1B0O A;  1YP7 A;  2W2A A;  1BSO A;  4HFO A;  4HPD A;  2OVA A;  4WHI A;  5H9K A;  4O3Z A;  1I05 A;  4I6S A;  2LB6 A;  1E06 A;  3WVM A;  2KTS A;  4ALO A;  2X8S A;  2QOS C;  5D47 A;  1OPB A;  4IAB A;  2X8T A;  1H91 A;  4ZH6 A;  3C77 X;  1NP1 A;  2AH7 X;  4GU8 A;  4BQU A;  4WBK A;  4NNS A;  5HCD C;  3PEC A;  2L9C A;  2QO6 A;  2CZT A;  2JMB A;  3FEP A;  3NBX X;  3GAQ A;  3UAQ A;  1LID A;  1BRQ A;  5H9A A;  1DFV A;  4XMC A;  4D6A A;  2FT9 A;  4RUN A;  4DQ3 A;  1A2D A;  2CZU A;  1ZND A;  4GZV A;  4LKT A;  4U8U O;  3WJF A;  2RN4 A;  4U9C A;  4QAE A;  2JU7 A;  1QY1 A;  4A1H A;  3HK1 A;  3K3L A;  5EDC A;  4GNY A;  2GJ5 A;  1ML7 A;  1GKA A;  4GNW A;  1I4U A;  1GGL A;  5IO5 A;  4OS0 A;  2GC9 A;  2JW1 A;  3HOE A;  1ICM A;  1N0S A;  2BLG A;  2LBV A;  1BRP A;  2A2G A;  1MDC A;  3VU1 A;  4BVM A;  4ZGF A;  5LJK A;  4HPC A;  3ZZV A;  2AT5 X;  3VG7 A;  5F6B A;  3P6G A;  3GE2 A;  1HBQ A;  4Y0P A;  3FIQ A;  1UZ2 X;  1SXW A;  3RSW A;  1YWD A;  2BT9 A;  2MO5 A;  3MX7 A;  4TNN A;  3BSZ E;  5KID A;  1E5P A;  4RUU A;  4DQ4 A;  2HNX A;  3JS1 A;  4I3C A;  4LQZ A;  4XMH A;  5B27 A;  3ZW2 A;  4LZU A;  1QY0 A;  4N7C A;  1BSY A;  1B4M A;  2RD7 C;  5LJG A;  4ZHG A;  2AT3 X;  4KT5 A;  1G7N A;  5F6Z A;  4ORY A;  4UU2 A;  2LFO A;  2NNE A;  3EBK A;  5HWZ A;  1KZX A;  1S7D A;  3FA6 A;  1LF7 A;  4QYN A;  1GT1 A;  1LKE A;  4I9S A;  2RCT A;  4ORR A;  1BSQ A;  1IFB A;  1JZU A;  3B2K A;  4TLJ A;  3BS2 A;  5FQ6 E;  5LJC A;  1DF3 A;  3NAD A;  5FFH A;  2QO5 A;  1T0V A;  4I9R A;  4XMD A;  3BY0 A;  4WFU A;  5H9L A;  2X8F A;  4NLI A;  1YP6 A;  3TGA A;  3U03 A;  1G5W A;  1EIO A;  3VG2 A;  1HN2 A;  1O8V A;  4QRL A;  3MBT A;  1OBU A;  3WOV A;  1KT5 A;  1CBR A;  4ORU A;  2R74 A;  1X8N A;  1Y9L A;  4M7M A;  3F9D A;  5L8O A;  3EYC A;  4HWM A;  3U0D A;  1X8O A;  2WQA E;  3PH6 A;  4O4O A;  1KT3 A;  2HZR A;  3VPJ E;  2F73 A;  4O3Y A;  2WSJ A;  1X71 A;  2WR6 A;  2EU7 X;  1EQD A;  4ES7 A;  1U0X A;  2OVS A;  4BOE A;  2W2F A;  4IB6 A;  4R0B A;  4YKM A;  3MVF A;  3TZS A;  5HZ8 A;  5HTD A;  4D6B A;  2A13 A;  3ZW1 A;  1SY0 A;  1QFT A;  5K06 A;  1SXX A;  2OVD A;  4ORS A;  1EW3 A;  3O22 A;  3KFG A;  5AJB A;  2Q9S A;  1TXL A;  3QKG A;  5F58 A;  4YKO A;  1SY1 A;  2G79 A;  2OZQ A;  4QYP A;  1TVQ A;  3FEN A;  3KQ0 A;  1GKA B;  3APV A;  5HA1 A;  5BVQ A;  1R0U A;  2NP1 A;  4ODD A;  1ACD A;  3S5V A;  2L68 A;  1ADL A;  2L5P A;  2RA6 A;  1KGL A;  1FEM A;  2O62 A;  4AW8 A;  3SOT A;  4YDA A;  4YFR A;  3VE1 A;  3S60 A;  4N7D A;  3BDR A;  1LFO A;  2DM5 A;  2Q39 A;  4ZFX A;  4ZHH A;  4IB8 A;  1MX8 A;  5HZ6 A;  3FYF A;  1BM5 A;  1NGL A;  3NQ3 A;  3PQS A;  4O9S A;  4YCH A;  3S26 A;  5HZ5 A;  1EUO A;  2WQ9 A;  4M6S A;  4KII A;  5BYP A;  4NYR A;  1PMP A;  4EQA C;  3OJY C;  2W2B A;  5IO7 A;  3CBS A;  3WJB A;  2Q2M A;  1GX8 A;  1SMP I;  4NYQ A;  1BBP A;  1Y9T A;  4OS3 A;  1FTP A;  3TF6 A;  3D4R A;  3N91 A;  2IFB A;  5HZ9 A;  3STM X;  1KT6 A;  3P6C A;  5EDB A;  1I04 A;  5FQ8 E;  3AKN A;  2HLV A;  1FE3 A;  1MVG A;  2AL0 X;  2FWV A;  2FR2 A;  5D8J A;  1FEL A;  2YG2 A;  4IB9 A;  3VG5 A;  3I17 A;  2MWH A;  1HMS A;  1GT5 A;  3VG4 A;  1KZW A;  1ZNL A;  1AQB A;  4ORW A;  3EMM A;  2X46 A;  3NQ9 A;  2X45 A;  3EM0 A;  4EEJ A;  1KT4 A;  1O1U A;  1OEE A;  5KHP A;  1U18 A;  3V8U A;  3D97 A;  1BLR A;  2AT6 X;  4YCE A;  3P02 A;  3PED A;  1A57 A;  4PSQ A;  4ZHF A;  3S5X A;  1ALB A;  1IKJ A;  4O3X B;  4ZH9 A;  1SA8 A;  4OMW A;  4MIS A;  4TKH A;  5BVS A;  3BX7 A;  3BLG A;  4GK9 A;  1A3Y A;  4ML7 B;  1X8Q A;  3AKM A;  1SY3 A;  3APU A;  3BU1 A;  3CWK A;  3BU9 A;  1FDQ A;  1QAB E;  2JOZ A;  5EZ2 A;  5FAZ A;  5LJD A;  4ZJ0 A;  3PPT A;  2M4L A;  2KT4 B;  3TGC A;  1ERX A;  4YGH A;  1P6P A;  2LA7 A;  3D95 A;  3OBL A;  3B2I A;  1HQP A;  4FBO A;  4ALB A;  1DZK A;  3SAO A;  2CM4 A;  2MJI A;  3FEK A;  1GT3 A;  1BJ7 A;  3CQR A;  4AZN A;  1IW2 A;  5H8T A;  3FMZ A;  3ZW1 B;  5FQ7 E;  3HOL A;  2QM9 A;  4IBA A;  5D48 A;  1MX7 A;  1JBH A;  1LPJ A;  5CE4 A;  5H9N A;  1YUP A;  1JYJ A;  4MIR A;  4IB7 A;  2ASN X;  1DV9 A;  2GTF X;  2ALL X;  3O2Y A;  2R56 A;  1VPR A;  2RQ0 A;  2OFM X;  1EAL A;  1ZNG A;  1EI5 A;  1RLB E;  3DTQ A;  1TOU A;  1JJJ A;  5CYB A;  1BWY A;  1JJX A;  3I0A A;  4XME A;  4MVE A;  2BS5 A;  3ELZ A;  4XMG A;  1DC9 A;  3EBW A;  1KOI A;  1OBQ A;  1EPB A;  4OS8 A;  3C76 X;  2CBS A;  4KCA A;  4MVL A;  5KIC A;  1D2U A;  4I3B A;  4JGL A;  2YMS A;  1HMT A;  3CMP A;  1YIV A;  2R73 A;  3FEL A;  1IFC A;  1I06 A;  2ACP X;  3NP1 A;  4QZT A;  4TQ2 A;  4A60 A;  5AEO A;  3WJC A;  3B2J A;  5D4A A;  5BVT A;  3RWX A;  4I95 A;  3UEW A;  3H3I A;  4GRJ A;  3WXQ A;  2QMI A;  3HWE A;  4TKB A;  1KQX A;  1AB0 A;  1AVG I;  3UEU A;  4QGV A;  4O3W A;  1Z24 A;  3P6D A;  4ARH A;  2AT8 X;  1ZRY A;  4EXZ A;  5HBS A;  4A8Z A;  3TGB A;  4FQB B;  5F7G A;  2NNQ A;  4YDB A;  2GTL M;  2ZAG A;  3NQK A;  1IIU A;  1PBO A;  5AQ6 A;  1LIE A;  3FLL A;  5HCE C;  4KC7 A;  2HYS A;  3NX2 A;  4LKP A;  1FEN A;  3APX A;  3VG6 A;  2AMM X;  3KFF A;  3ZUO A;  1X89 A;  2P8G A;  2F09 A;  1JYD A;  2QO4 A;  4EFG A;  1KXO A;  1KQW A;  2GTL N;  1BEB A;  4L1N A;  1DZJ A;  5HTE A;  3KZA A;  3WJG A;  1SXY A;  4FBR A;  1ZNK A;  3DSZ A;  4ZHD A;  2Q4N A;  4COT A;  4GET A;  1U17 A;  1ZNH A;  2PY1 A;  1ZNE A;  4U3Q A;  4AZP A;  4FGI B;  4EDE A;  4YH0 A;  4TKJ A;  3JQO A;  1TW4 A;  5HA0 A;  4ZGU A;  1PEE A;  1VYG A;  1NP4 A;  1G85 A;  4AYH A;  3ZW0 A;  4UU3 A;  5HAE A;  2FR3 A;  2KD2 A;  4O4S A;  1CRB A;  2FTB A;  3ZWE A;  2WEW A;  3G7X A;  4INN A;  1XCA A;  1SY2 A;  1S44 A;  3PP6 A;  4IAW A;  1QG5 A;  4QNI A;  4U8U M;  3T1D A;  3STN A;  2JU3 A;  3WBG A;  5DPQ A;  3OE3 A;  5HZQ A;  3VG3 A;  4Y0S A;  4Y0Q A;  4YBU A;  2WWP A;  3U9P C;  1HBP A;  4ZCB A;  5B29 A;  1QY2 A;  2AT0 X;  2XST A;  3P24 A;  4L3R A;  1AEL A;  2LBA A;  1E00 A;  4U8U N;  1G74 A;  4CV7 A;  1JV4 A;  3B2H A;  4QZU A;  2A3F X;  5LKF A;  3C78 X;  5LKE A;  1B8E A;  3IA8 A;  3FA8 A;  4GKC A;  3HWD A;  4KC8 A;  1QQS A;  1URE A;  1LIC A;  2HMB A;  2WUT A;  3VE2 A;  1YWB A;  3KFI A;  4YFP A;  5LJH A;  2FRS A;  3RZY A;  5JR8 A;  2ANS A;  2G7B A;  4ORX A;  4YFQ A;  3FA7 A;  3CBC A;  4O4U A;  3ZI8 A;  1B56 A;  1PM1 X;  2HZQ A;  2LKK A;  5L8N A;  1D3S A;  3ZUI A;  4NW4 A;  4TJZ A;  1EXS A;  2ACO A;  3BX8 A;  1X8P A;  3ELX A;  3FA9 A;  3Q6L A;  4AZQ A;  4CSB A;  4ZR2 A;  3HWF A;  2BHV A;  2FS7 A;  3P6H A;  4YBP A;  3FW5 A;  3UEV A;  3O19 A;  4NLJ A;  4QGW A;  3L4R A;  2K62 A;  3IFB A;  1YWC A;  3CQN A;  5LJB A;  3HWG A;  1QWD A;  3WJD A;  4AZO A;  2WEX A;  2Q2P A;  4O4X A;  2FS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...