2JUFA

Nmr solution structure of parc cph domain. nesg target hr3443b/sgc-toronto
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
YGEYVQQTLQPGMRVRMLDDYEEISAGDEGEFRQSNNGIPPVQVFWQSTGRTYWVHWHMLEILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords p53-associated parkin-like cytoplasmic protein
publication title NMR Solution Structure of PARC CPH Domain.
rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 13
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2007-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11515 Cul7 Mouse development and cellular proliferation protein Cullin-7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2jufA00
1NJIU 1S72T 1VQ5A 2OTLT 3JAME 1VQOA 1UEBA 1KC8U 1IZ6A 3I55A 5A2QE 1M1KU 3LGLA 1VQOT 3LGFA 3CPFA 3I55T 3LH0A 3CCST 1VQ6A 1NPRA 1NPPA 3CC7A 2E70A 3G4SA 3CD6T 1YI2A 2KVQG 2KDSA 2MWPA 2JUFA 1YIJT 1VQPT 3KBGA 3CC2A 3CC7T 1Q81U 1YJNA 1K8AU 1K9MC 1YJNT 2XHCA 1Q86U 3CCRA 2LQ8A 1VQNT 5FLXE 1S72A 2OTLA 2DO3A 3CCRT 5J3BA 1Q82C 1QVFS 1KD1U 3J81E 3CCLT 3CCSA 1N8RU 3CMET 3ER0A 1KHIA 5DM7R 3CCEA 1K73U 3CCQA 1VQ4A 1BKBA 3DB3A 3CCET 3CD6A 2QA4A 4QQDA 1VQPA 1YIJA 3CCQT 1VQ4T 1YHQA 4ZN1A 3HKSA 3G6EA 3CCMA 2QA4T 1M90U 1KQSS 1QVFA 2L3RA 3CPWS 1YHQT 3G6ET 3CCMT 1VQNA 2LCLA 4RG2A 1W2BS 1SSFA 4X34A 3CMAA 1Q7YC 1VQ8A 1KQSA 1VQMA 3DB4A 3CPWA 3CCLA 1VQ8T 1NJIC 3CMAT 2EIFA 3CCVA 1YJ9T 3CMEA 1VQLT 2JNGA 5LL6S 1VQMT 1M1GA 3CCVT 1KC8C 1XNIA 1W2BA 3OYYA 2OTJA 2MI6A 1M1KC 1VQ9T 1VQKT 3OW2S 1YITT 2OTJT 1JJ2S 3CCJA 3CCUT 1K9MU 5J26A 3P8BB 3G71A 3CCJT 2JOYA 4CRIA 5IAYA 1NZ9A 4TVRA 3J7AF 3J80E 4YTLA 3G71T 1X6OA 3CXCS 1Q81C 1K8AC 3OW2A 1QVGS 1JJ2A 1YJWT 1Q82U 1XTDA 1Q86C 2E6ZA 2IG0A 2JVVA 5HY6A 1VQ7A 1YJ9A 1VQ5T 5IT9E 1VQLA 1VQ7T 3I56A 2G3RA 3CXCA 1VQ9A 3TREA 1KD1C 1QVGA 2CKKA 3I56T 1VQKA 1YITA 1RL2A 3PIOA 3A5ZB 1N8RC 1VQ6T 5DLQE 2QEXA 3CCUA 4ZN3A 3PIPA 1K73C 1YBYA 3G4ST 2QEXT 1YI2T 3CC4A 3CC2T 1M90C 3CC4T 2LVMA 2MWOA 1Q7YU 1EIFA 1YJWA 3DLLA
chains in the Genus database with same CATH superfamily
4N0AC 2KNBB 1X43A 3RKWA 1VQ5A 3HP9A 5GAN6 4BI3A 3JAME 1M2VB 5M9OA 1WHMA 1X6BA 3S3NA 1M1KU 3CPFA 3MEWA 1K4US 4RG8A 1VQ6A 1NPRA 3VKIA 5HCKA 4D6WA 1VQPQ 2KVQG 2KDSA 3D7SB 4N0AA 5GAN8 2GFAA 1RUWA 1SF9A 2LJ0A 5GANh 2YRDA 1I81A 3VU3C 2D6FA 5KYUB 4RCBA 2E10A 4L6V5 4C5EA 1Q82C 3FIFA 3CCVQ 1H3HA 4D8DA 3V8LA 2EW3A 2YUPA 2BIVA 4A54A 1BYMA 2DEQA 2KR3A 1GCQA 1Y57A 3UDCA 4D8KA 1Y7XA 1YHQT 3OQ5A 4RMOA 1HD3A 1VQNA 5GMKl 2D0QB 3I35A 4C0DB 1VQMA 4OMPA 2RQRA 3I56Q 1WPYA 5ECAA 1Z9ZA 4C92G 1M1GA 1XNIA 4FU6A 1B34A 3OY9A 1A0NB 1D1CA 3HL8A 3CCJQ 2EGAA 2JMCA 2DL5A 3M53A 1NZ9A 4TVRA 3NTIA 2CZ1B 3QIIA 1AWWA 1QP3A 1UUEA 4DEYA 1V76A 1WI7A 4P5NA 1VQ7T 3VV0A 1AD5A 2AT1B 3GBQA 4O5VA 1VQ9A 1M27C 5GAOn 4CC3A 1HK9A 1MV3A 2YDLA 2D9TA 5GAOq 1TH7A 3TCJA 3RESA 3CC2T 1PD1A 3EGXA 2HKQB 3R6NA 2LVMA 3BY7A 4PKCC 1YJWA 3H0HA 2V8IA 5IN1A 4Q5WA 2L3PA 3ZL7C 5IXBA 2PZ1A 2F5TX 4N4GA 1KQ2A 2K6DA 1KC8U 1XQHA 4OB1B 2C06A 5CKDA 1UHFA 4J5YA 4PJOG 4IUTA 3EH1A 2Y4YA 2QGGA 3EH2A 4JRQA 3A8MB 1VQPT 5GJWB 2E64A 2ZPEB 1QWEA 2K3YA 2LTOA 1M3BA 4M75F 2IVWA 5I21A 1SHFA 5FU6C 2F69A 2HZYA 2RO0A 3CCLQ 4C8QC 1QLYA 2NUTA 3CCEQ 2H8HA 3CD6A 3P8HA 3EHRA 1YHQA 4JRPA 3VS2A 5L8RE 2MF2A 3QYGB 1N6AA 1IRXA 2JXBA 1TSFA 1OX8A 1B34B 4C8QA 3SB2A 2DPPB 1B07A 5D6YA 2C0OA 4ZNXA 2QTVA 1J3TA 3TQ7P 3GOXA 1U3OA 3CMEA 1AZGB 4B9XA 1BI2A 1D0XA 1RI9A 2ZZDA 5GAMf 2WSCE 2YLCA 3JB9F 2OTJT 3C95A 3Q1JA 4M7AG 4IIMA 1KG1A 1NLOC 3CCJT 4CRIA 4J9IA 4QVCA 1RABB 5GAMe 4J9CA 4RTWA 1NEGA 2CZ6B 4E7SA 3OW2A 3EFOA 1Q95G 2RD1A 1VQ7A 1YCYA 1VQOQ 2MOXA 2LNVA 1M9SA 1KD1C 4LDUA 1YITA 1RL2A 2VYTA 5GAN7 4ZN3A 3G4SQ 1UJYA 2EKHA 4AFUC 4OMOA 1IGQA 3OSVA 3MEUA 2RNAA 4EMHA 1UTIA 3OYCA 1M3AA 1RAHB 1PSEA 4JLGA 1GCPA 4HVVA 3O8VA 2COYA 4CI0C 5FRNA 2QTXA 2QGFB 1TS9A 1NPPA 2AK5A 4HT8A 3MP8A 4OB0B 1Q81U 1KIKA 2DM1A 4IUQA 2MYSA 1FXXA 5FLXE 3V8KA 3HFOA 2HKNA 3CMAQ 2KYBA 3CCRT 2GQVA 1OEBA 5FU6B 2KE9A 2AZSA 4HVWA 3CPWP 4PJLA 1KJWA 3CCLT 3KXTA 4M7DD 4LUEA 1V1CA 2K5LA 5LJ5j 2LRQA 3CCET 1S1NA 2ZPBB 4QQDA 1N27A 2XICA 4XU3A 4ZN1A 2CP6A 3CCMQ 1M3CA 2B8AA 2DE0X 4C0ZA 2FPEA 4X34A 4ESRA 3REBB 2L8DA 3O5ZA 3L2RA 3GNGA 1OQKA 2LQWA 1WIEA 2OTJA 1VQKQ 3E19A 3EFOB 3HRUA 4CC2A 5DLOA 3CCJA 1RADB 2EYWA 3H41A 1TOVA 2WSFE 3IQLA 4A4KA 3LX7A 2JZ2A 4FCYA 2GCXA 3EG9B 2LJ1A 4M78F 1Q86C 3F70A 3PMIA 1FWZA 4BE2A 3OMCA 1OZ3A 5LJ5d 4XU0A 3SHWA 2FHDA 4M75E 1O9SA 1CKBA 1RACB 3QZ5B 2D1XA 2HAXA 3G4ST 3MCAB 2EAYA 2V1RA 1QCFA 4RTVA 3EAEA 2DAQA 1WFWA 1S72Q 2EFIA 2P0QA 2A3LA 5GMKj 3MP6A 2F2VA 2LP5A 3VRZA 3LGFA 3LW5E 2CSIA 4C92C 8AT1B 3JB9J 3SWNA 3CCQQ 4WCIA 1YI2A 2RH2A 3MEAA 4PFPA 1R0BG 3JB9H 2DL3A 2DJZA 5IHNA 2YUNA 3HPWA 5GAN2 2XHCA 4PL6A 3CCRA 2XI9A 2E5KA 2HD0A 2DO3A 2X4YA 2A36A 3JV3A 2L2PA 2QDYB 3CCSA 1ZUKA 4AMCA 3CCEA 4XTWA 2DILA 4Y28E 3OYKA 4Z88A 5KYYA 5CR2A 1YIJA 3OYMA 3QWYA 2VXEA 4WTOB 2RQUA 4WF2A 1PHTA 4OVAA 4L5GA 3CCMT 2BE9B 2PU9B 5HK3A 3OYHA 1RI0A 2ESWA 4N4IA 3M54A 1N8RR 2DL4A 1SPKA 1K73R 2K57A 3V7RA 5AT1B 5I2SA 4PJOC 1VQKT 3JCMQ 1YFNA 3M57A 1WLPB 4EPCA 2JTMA 1B7TA 4PJOA 1JO8A 1I0CA 4KBMB 2DYBA 2DTIA 3GNFB 3CXCA 2GBQA 1ZX6A 1QCNA 4C8QD 2DNUA 2YUQA 3FJ5A 2FYKA 5DLQE 3DKMA 3CCUA 4XTYA 3JCMd 5CVIA 1OI1A 2P84A 4RTXA 1S72T 1AHJB 2F2XA 4QKUA 2DZCA 3OSSC 4XTZA 2FRYA 4XTXA 1U1TA 2D8HA 3S3OA 1VYTA 3M4YA 1KFZA 4C92B 2ZGWA 3L2UA 2QA4Q 1NEBA 3NHNA 2Y90A 4PFOA 5CQYA 1ABQA 4R55A 1ZUYA 4M7AC 2E41A 1D09B 9ATCB 2CYZB 3QHSA 4AFZC 2BZ8A 5LJ3j 1YJNT 4M7DF 4LD9K 2KROA 1G3TA 1WXUA 1GRIA 4OGEA 1K76A 2QI2A 2DD4A 1AWXA 2BZXA 2DLPA 4V2SA 2FEIA 4BB7A 3WVEB 1G3WA 4M7AA 3OYLA 4JJBA 3LWHA 2BZYA 3QXEB 3FRNA 4M78E 3HKSA 3CCMA 2RF0A 4A53A 1M2VA 5GAOr 2RI5A 1QVFP 1LVKA 2DL7A 1UFFA 2XDDA 4DBRA 2FZCB 1JQQA 2YHTA 1TU0B 2PVOB 4MMLA 1SRLA 1KQ1A 5EG2A 4AG1C 5GANj 1WHGA 6AT1B 1TUCA 1PKTA 4LDXA 2GQIA 1VQLQ 1ZHIA 4E7LA 3ME9A 4EDUA 1AEYA 5CAIA 1M90R 2WACA 2CT4A 4PJOB 1JXOA 4XU1A 3M0TA 5KYUA 3SEMA 1JB0E 2ABLA 5LJ3d 4JJNK 4LN2A 2LC4A 1ZA2B 1E6GA 1QVGS 4CC4B 4C0DC 2LDMA 1U8RA 1K1ZA 1YJ9A 2MIOA 4MDXA 2MCNA 2CSQA 1P92A 4M78B 2CKKA 5DY9A 3E1SA 2QQBA 3NFCA 2DIQA 3JCMP 4BY6B 3CC4T 4BDYA 5GANd 1U06A 3QWXX 4M75G 4OB2B 1UEBA 2KRNA 3NPFA 4HXJA 2JS0A 3OS1A 5GMKm 5AYFA 3OYBA 2XMFA 3L2ZA 4JUVA 3OYDA 1Q7YR 4F16A 3CBMA 2YXYA 1ZSZC 3KBGA 4JDSA 2K7AA 2CH4A 4HCCA 1YJNA 1QCOA 4M7AB 2J7IA 1ZBXA 2OAWA 1FMWA 2KT8A 2MMPA 4II1A 2X4WA 2LQKA 3PMTA 5LJ3e 2X9HA 2M02A 1X27A 5I2MA 2LMJA 4OB3B 1BKBA 1VYUA 2OI3A 5A0LA 3JB9G 2O4XA 1RAEB 1WJQA 1NM7A 4AG2C 2P4TA 5GAMg 1G5VA 2VC8A 2J6FA 4LE9A 1VQLT 1W4SA 1WJRA 1YP5A 1G8XA 1H8KA 2EQMA 3LLRA 2BTTA 1W2BP 2E5QA 3MP1A 2KK4A 3V7CA 2KSSA 4ELYC 1M5Q1 5CK9A 4RKUE 1K8AC 5C6SA 1BCOA 2PQWA 3QUIA 2CZ0B 5KCOA 4K11A 1XJWB 1X01A 2FPFA 2VV5A 2CP7A 1AZEA 3I55Q 4KULA 2PUOB 4J6XA 3TREA 2LZ6B 2QYZA 1K9MR 3A98A 4AFSC 1M1FA 3S3MA 1WHLA 1YBYA 3JCMJ 3CC4A 4QW2A 2X4XA 4NOYA 2VWFA 5GAN5 2FG0A 4HA8A 4NL2A 4KRTA 4C5IA 1D0YA 2K5FA 2M0YA 2QQRA 2JM9A 3JCMc 4ELZC 3L2VA 1PD0A 1VQ4Q 1R0CB 4PJOD 2KRSA 3H0FA 3QO3A 4JJCA 1RAFB 1Z9QA 2VXFA 1NJIR 1ZSZB 3QG1A 1MGQA 5GAN3 1ZBJA 3LYIA 4J9FA 4RTZA 3H0IA 1IGUA 1YCSB 3UT1A 1QVFS 2YRCA 3M59A 4F7UF 2O4XB 3M0SA 4PJJA 1N8RU 1H3ZA 1K73U 1M8MA 1GFCA 2SRCA 4PNOA 3QYHB 2EQKA 4E6RA 1R77A 3G71Q 4BE0A 3LWIA 2JN0A 3CEYA 1T0JA 3THKA 1NLPC 1WNLA 2CP5A 2FL7A 3VYHB 4JZ3A 4OMFB 4BE1A 5CCAA 4M78G 3M55A 3QBYA 2E1HA 2XG8D 3BE3A 3MHXA 3CCVT 2GNCA 4M77F 3EG2A 3NMZC 2ROLA 3X28B 1M1KC 2M0OA 1JXMA 1YWOA 3EGUA 2K5IA 2DMOA 5IHKA 2K2VA 4EMGA 1RLPC 2OJ2A 1Y71A 2YSQA 2E65A 1BIBA 2KEAA 2J6OA 2HQHA 3PT9A 5IT9E 3ZBDA 4Y91A 2OX7A 3EGDB 2R57A 3MKDA 3I56T 3PIOA 4MZTA 3GPLA 1OPLA 1UG1A 3M56A 1Q82R 2DETA 3TU4K 2P4RA 1IHWA 1ZSGA 3BDUA 4A4HA 2DIGA 2EQUA 1PKSA 4AT1B 2V8JA 4C5GA 2VUBA 5A0GA 1D1AA 1UE9A 4DBQA 5GAMh 2IIMA 4GBQA 3A1PA 1GXIE 3EG9A 5J39A 1K8AR 4LD6A 2I2LA 3CC7Q 3H6ZA 4ATOA 1HYOA 3CC2A 3EHQA 4BUGA 4X1VA 1GBQA 3FJPA 2V8KA 2CH4W 1KK7A 3META 1UGVA 1JEGA 1K9AA 2M51A 3PTAA 2ZAEA 2HNIA 1VQPA 4ANJA 1M90U 1UJ0A 1Y96B 4Z02A 5I11A 1WGSA 4E47A 1W2BS 3C12A 2E6NA 4R56A 1N5ZA 4FM4B 3PVLA 4M75C 1PSFA 3CCVA 2B86A 4ZTFA 4JJDA 1KC8C 3MPUB 3UPUA 2QDLA 2FRWA 3OYYA 2ZPGB 1Y0MA 1MHNA 2C0TA 2KBTA 2KXDA 1EFNA 7AT1B 3QDRB 3SFMA 2JVVA 1JJ2P 4J83A 3MJXA 4DOVA 3VRYA 1IO6A 3I56A 2FPDA 1ZLMA 2LT1A 3VUBA 2AIRB 4XQ3A 5KYWA 1K0SA 1O75A 1TTHB 1OV3A 2E12A 3EG3A 4FT4A 1FMKA 4DBHA 2ED1A 4IKFA 3V8JA 4F7UE 1QMCA 2D0NA 1Q7YU 4QQ6A 1RAAB 1M1KR 2EQIA 2OTLQ 4XAXB 2MAMA 3X25B 4M7DG 1R8OB 4M4ZA 2ENMA 1VQOT 3UA6A 3LH0A 1IHVA 4PJMA 3INZA 4FYVB 3CC7T 4IIOA 2A08A 2A7YA 3G1JA 4E7HA 2LQ8A 4M77E 4J7IA 3L2WA 2HQEA 4HCZA 2RJFA 5J3BA 2F2WA 2M16A 1G3SA 2A28A 3RMQA 1AVZC 2RMOA 2KRMA 2FVUA 2KAFA 1F1BB 2EGEA 2L3RA 2XDBA 3PVQA 1KD1R 2J06A 1U1SA 4C92A 4JS5A 1TXQA 3ZEHA 5FWCA 3VS0A 1HJDA 3CMAT 3CCLA 2LX9A 4OMNA 1MV0B 3N5BB 4M75B 3OA6A 2DTOA 5LJ5f 2AKKA 1VOMA 5CKFA 2ZPIB 1K9MU 3M0QA 3P8BB 1SSHA 2JOYA 2LX7A 5LJ5e 1LNXA 4ZGEB 2RHUA 5KYWB 1Q81C 4A4GA 1JU5C 1ACMB 1VQ5Q 1MMDA 3RDVA 1MNDA 3GP8A 1WQWA 1QVGA 3RBBB 1LPLA 3TEEA 1VQ6Q 3BW1A 1QKXA 2DKGA 2K4YA 3RUXA 2PVGB 3QZ9B 3UWNA 2VGNA 2DRMA 1H92A 4ME7A 3DLLA 3GLXA 4FYWB 3SD4A 1NJIU 2OTLT 1PCXA 1VQOA 4XTUA 2GTOA 2PTKA 4M78C 3PFSA 2RI2A 3OYNA 3A8GB 1PWTA 3CC7A 2E70A 2HBPA 3G4SA 2CUDA 1ZUUA 4BY6C 2RB6A 4Z89A 1UB4A 1VQNQ 4OMQA 2HSEB 3C94A 4FSXA 4M78A 1QP2A 3NTHA 2DBMA 2CP0A 1VQMQ 2V26A 4FSSA 2CREA 5GMKe 3M0PA 3CCQT 1I5OB 2GTJA 1Q86R 3CPWS 1QKWA 5CO7A 5GMKh 2JTFA 2W10A 2X35A 1D3BB 3H8ZA 1BK2A 4FT2A 3CMAA 1HXDA 1PG5B 2EQJA 3RKXA 1KQSP 2JNGA 1UGQB 1VQ9Q 2PVDB 4RCCA 1M30A 4Z8AA 2RA2A 5KH6A 2EPDA 1JJ2S 3HSBA 4J6WA 2EWNA 3VS1A 8ATCB 5J26A 1GFDA 5KE2A 3JCMf 3J80E 4PJNA 1YJWQ 1Q82U 2X4JA 2RJEA 5HKCA 2YWWA 2BUDA 3JCMe 5I22A 1VQ5T 1ABOA 1AOJA 1N9RA 3DLMA 4BI4A 3A8HB 1T3SA 1VQKA 3A5ZB 4F04B 4DBFA 1VQ6T 1WX6A 3M5AA 2QEXQ 1W6XA 1WHKA 2COWA 5CKHA 1OPKA 1EIFA 2NLUA 1X6GA 3OBYA 2XKOC 5CKBA 3VS3A 3R6OA 1Y07A 2AHJB 2CT3A 3JCMb 4IURA 5A2QE 2DRKA 5GAOp 2X3WD 1PC0A 4JZ4A 2XDPA 3OS0A 4F7UG 3HTRA 2HEQA 3CD6Q 2RHZA 2JUFA 1YHQQ 1BI0A 1PRMC 1FX7A 5D6XA 3M0UA 1VQNT 4NS5A 1S72A 3S6WA 2DXBA 2X51A 2JW4A 3KUFA 1BIAA 3CMEQ 3VS7A 3RIRA 1U5SA 3AT1B 3M4GA 3EG0A 4J9EA 3CCQA 2E3HA 3I9QA 3UA7A 4M77G 2DVJA 1QVFA 2QA4T 5KE3A 2L89A 1K0XA 2K3BA 1I4K1 2RK1A 1SKUB 2QK0A 3P8DA 5LJ3f 3JB9D 5HK0A 1WXTA 4B6MA 4J7FA 1UDLA 1VQ7Q 4M7DC 1BB9A 3NTKA 4C0FA 5CQXA 1ZSZA 1SG5A 2O9SA 1VQ9T 1YITQ 1OYXA 2EYYA 2VGMA 5LJ3h 1UGSB 1QVPA 5IAYA 3J7AF 4BDZA 1CSKA 2ZPHB 3NGPA 3ZFJA 1TUDA 4LUDA 4KGXB 4ZTJA 1M8VA 1YJWT 1UGRB 5GANf 3TSZA 3UF4A 3OYEA 4E7JA 1FMVA 2R5AA 3OYGA 1ZA1B 2GF7A 4A63B 4E2FB 5GANe 2CP3A 1M4ZA 4C92D 2RQTA 2RM4A 5GAOl 2QEXT 2H3EB 3E2UA 3MEVA 4A4FA 1GCQC 4C8QF 3OS2A 1WXBA 4C0GA 4MZPA 2DFUA 2SEMA 1T0HA 2O31A 3BFMA 3GIBA 1B3QA 4GLMA 4IUVA 1WA7A 3LGLA 1WJSA 2EBPA 1CKAA 1VIEA 1WYXA 2C0IA 4MDWA 4M7DE 3CD6T 1X69A 2QAZA 1BBZA 2YT6A 2M9UA 3EGDA 1SHGA 2YLBA 1VUBA 2ZPFB 5IHIA 4KH0B 3C0CA 4QQGA 5FW9A 1KD1U 4KH1B 2FZGB 3CMET 3ER0A 5DM7R 4BD3A 2OTJQ 4JS4A 5GAMj 1LOJA 5GJVB 3DB3A 2QA4A 1MNEA 1VYVA 2E3IA 1KQSS 1IREB 3G6EQ 4J9GA 2BE7D 2EGCA 1SSFA 1QW1A 1VQ8Q 2K9GA 3LH5A 2A37A 3QDFA 3A8OB 2LNHB 3RERA 4M7DB 5LL6S 4KT0E 2DYIA 1W2BA 2FB7A 4M78D 2ZCFB 2F1LA 1YITT 3U23A 3L1AA 2JMAA 4AFQC 3WXMB 1X6OA 1E7OA 4F14A 5IH2A 5CKEA 2I0NA 1C0MA 2H3JA 1UGPB 3OW2P 2WSEE 2ED0A 2JTEA 2RPNA 4OGCA 1X2QA 1VQLA 1XOVA 1Y96A 3OS5A 3RMSA 2LCSA 2DXCA 5GAMd 1G2BA 5FROA 1E6HA 3REAB 1T3LA 1I1JA 2QEXA 3PIPA 2RQWA 1YI2Q 2QQAA 2R5MA 1H641 4RTYA 3OYJA 4OMLA 4DQ2A 1LJOA 2LQNA 2DVEA 4M7AD 3ULRB 4EMKC 3CCRQ 2EYZA 1WHJA 3VS6A 1WQ7A 3URGA 2HMAA 3CCSQ 3I55T 4A4EA 3AHUA 1RAGB 4RUGA 4J9DA 1WHHA 4J8OA 4EMKA 1YIJQ 2R58A 5D6WA 1OULA 2MWPA 4KUIA 4QT7A 2ROTA 2L3SA 1Q86U 3FDRA 2NUZA 2M1HA 2VVKA 4KUDK 2JM8A 4Y92A 2RN8A 1NBEB 3QPHA 3JCMX 1VQ4T 1RAIB 2J6KA 3RNJA 3G6ET 3OMGA 2KT1A 4DA4A 2DEUA 1GL5A 5LJ5g 3EFRA 1VQ8T 3EGXB 2GGRA 2NYSA 3EFSA 1IXDA 2E4HA 4HT9A 3X20B 1OU9A 4C8QE 3CCUQ 3RR6A 1UECA 1PRLC 3OYIA 4YTLA 3G71T 1HSQA 2CDTA 3FB9A 1XTDA 4C92F 2IG0A 5HY6A 2PNIA 4F7UA 2DA9A 4HCBA 2COZA 2LT4A 4JRIA 3HFNA 1NYFA 2ATCB 3QSUA 3GF5A 1N8RC 2DXTA 2CUBA 1K73C 2NWMA 4M77C 1NE8A 1AWJA 4FIBA 1OOTA 2YRVA 2Z0WA 1YI2T 4X9CA 4LDVA 3JCMW 2NUTB 5FWBA 4M75A 2FO0A 2LCCA 2DERA 3PGGA 4EMKB 2O88A 1IZ6A 4PLIA 3I55A 4M77A 2CGHA 2KMTA 3H9NA 4RTUA 4C8QB 2EYQA 3TSWA 3CCST 4LDYA 2L0AA 2CP2A 5D7UA 1W1FA 2RJDA 2KXCA 2KYMA 1YIJT 4KGVB 5FRMA 2CZ7B 4GY5A 1MUZA 1AT1B 1ARKA 2QQ9A 4KGZB 3SDZA 5GMKi 2RI3A 4PJOF 1KHCA 2KQWA 3L42A 2KI7A 1VIFA 2HL5C 4CC7A 2V1QA 4PLLA 1G3YA 1VQ4A 1X75C 4VUBA 4XK8E 3CBPA 4QVZA 3G6EA 3G7ZA 1VA7A 4LXCA 5KYNA 3A8LB 4B9WA 1VQ8A 2VKNA 4RTTA 1YJ9Q 2PUKB 3CPWA 2EJFA 1OZ2A 1EZZB 4IUUA 2XIDA 2HCKA 4E7ZA 4MZMA 3JCMg 1YWPA 1QVGP 3OW2S 2HDAA 3VUZA 2RHIA 4F7UB 3CCUT 2J05A 5KYXA 3G71A 3QJ6A 3SWNC 1SEMA 2MK5A 1QWFA 3HRTA 1JJ2A 2DBKA 3UATA 1MMNA 4E7IA 3M0RA 4BACA 2EYXA 3X24B 2RHXA 1WDXA 3CXCP 4M7AF 1D3BA 4NL3A 3FC3A 2O2OA 4N4HA 1YN8A 1YJNQ 4M77B 1M90C 2QXFA 1MMAA 4DOWA 4FYXB 1BCMA 4F17A 3PE0A 3EG1A 2HL3A 4LNPA 5LJ5h 1UHCA 3V7SA 1I8FA 2QASA 3TVTA 1IB8A 2DXUA 2NUPA 1RLQC 4J9HA 2DF6A 2QQSA 3OYAA 4XTVA 3ASKA 1NG2A 1V29B 3JRZA 2L5QA 4EIKA 1KC8R 1LCKA 2O01E 1I07A 2AKLA 3HRSA 2DK3A 4JPBW 4C5HA 4X9DA 4IUPA 3VJPA 3J81E 5GAN4 1C6VX 4OMMA 1WZOA 2Y4XA 1KHIA 4PK4A 1JRIA 1DJ7B 1KSWA 3M58A 5LJ3g 4ZGJB 2EJGA 3JSCA 4UC4A 4C92E 5FU7C 2G6FX 2K2MA 2KY9A 1PNJA 1N9SA 1OX9A 1EX4A 4OF1A 3WVDB 2LJ3A 4HCKA 4JRKA 2O9VA 3QJYA 3QKJA 1Q7YC 2RHYA 4FW1A 4O6JA 1NYGA 5A0DA 5KYXB 2EIFA 1YJ9T 4LDWA 3RKYA 2DZ9A 4QVDA 1BU1A 2W0ZA 3X26B 2DX1A 5KCHA 3CC4Q 5GANg 3SWNB 2K3XA 2L3QA 1FYNA 1TWBA 2DD5A 2E6ZA 2HSPA 2F5KA 4C8QG 2EJ9A 2JT4A 1AWOA 2RK2A 1GBRA 2EKOA 2DTHA 4BI8B 1BI1A 3FEOA 3OYFA 2YUOA 4XU2A 1ZQ1A 4FYYB 2A0FB 4PJOE 1BI3A 2P0PA 3PNWC 2NUPB 1OU8A 5KYYB 2K79A 4HKEA 2MPXC 2VASA 4L59A 4J6YA 2ECZA 2OAUA 1QQJA 2D8JA 4PFZA 3JCMh 4R0KA 2RJCA 2HQXA 1K8AU 3KFVA 1K9MC 3E9GA 4OP0A 2OTLA 5EC7A 3T9NA 5L23A 3I5SA 3JB9I 1D1BA 2RQVA 4M75D 2HBWA 4MMKA 2DJQA 1Q81R 3HHTB 4FL6A 2FZKB 1M2OA 4GLKA 3M9QA 4DEXA 3VYGA 4M77D 5FU7B 4HVUA 2BKDN 2LCLA 4RG2A 4M7AE 1C1AA 4E7KA 5GAOm 4J9BA 1G83A 2AZVA 1KQSA 2VB6A 3I5RA 2QG9B 3CQTA 3DB4A 2KGTA 2DL8A 1NJIC 1JBMA 2GFUA 4ORZA 1VQMT 2XD0A 5IXFA 2IPOB 2MI6A 3CBOA 2CS7A 4JLIA 1X2KA 5C0MA 1TUGB 2XK0A 3OBWA 3MO8A 3JCMV 1W70A 3CXCS 1PM3A 2X3XD 1D0ZA 3BDLA 2P0KA 4FW2A 3L2QA 2G3RA 3OB9A 1SRMA 2EVRA 2XU8A 4ZGDB 5CIUA 3VS4A 3E9FA 1TG0A 3FLGA 2JJ9A 3CC2Q 3VS5A 3C4SA 1I5LA 4M7DA 2MWOA 1MMGA 1YNZA 2JS2A
chains in the Genus database with same CATH topology
1S72T 4N0AC 1AHJB 2MAMA 4XAXB 3RKWA 3HP9A 3X25B 4BI3A 5GAN6 2DZCA 3OSSC 4XTZA 3JAME 1WQ7A 4M7DG 1R8OB 5M9OA 3URGA 4XTXA 3S3NA 1U1TA 1M1KU 3S3OA 1VQOT 3CPFA 3M4YA 3MEWA 3LH0A 4A4EA 3I55T 4RG8A 3AHUA 1VQ6A 1NPRA 3VKIA 2ZGWA 4C92B 3L2UA 3INZA 4D6WA 4J8OA 4EMKA 2Y90A 2R58A 5CQYA 2KVQG 2KDSA 2MWPA 4KUIA 5D6WA 4R55A 3CC7T 4M7AC 4N0AA 2E41A 5GAN8 2GFAA 2A7YA 2CYZB 3QHSA 5GANh 1YJNT 5LJ3j 4M7DF 1I81A 1Q86U 4E7HA 2LQ8A 4M77E 3FDRA 3VU3C 4LD9K 1G3TA 4J7IA 3L2WA 2D6FA 2HQEA 4HCZA 4RCBA 2E10A 4L6V5 2RJFA 4C5EA 5J3BA 4OGEA 2M16A 2M1HA 2QI2A 1Q82C 3FIFA 1G3SA 3RMQA 4KUDK 2DD4A 4V2SA 4BB7A 3WVEB 3V8LA 1G3WA 4M7AA 3OYLA 2FVUA 3LWHA 3QPHA 3JCMX 2BIVA 4A54A 1K73C 2KAFA 1BYMA 3QXEB 2DEQA 3FRNA 4M78E 1VQ4T 3HKSA 3CCMA 4A53A 3UDCA 2L3RA 5GAOr 1Y7XA 2RI5A 1YHQT 3OQ5A 4RMOA 2XDDA 3G6ET 3OMGA 1VQNA 2YHTA 2XDBA 5GMKl 2PVOB 4MMLA 4DA4A 1KQ1A 2D0QB 1U1SA 5EG2A 4C92A 4JS5A 5GANj 4C0DB 3ZEHA 5LJ5g 4LDXA 1VQMA 3CMAT 3CCLA 3EFRA 1VQ8T 1ZHIA 2LX9A 3ME9A 4E7LA 4EDUA 3N5BB 1WPYA 3EFSA 4M75B 4C92G 3OA6A 5CAIA 1M1GA 2DTOA 1XNIA 4FU6A 1B34A 3OY9A 5LJ5f 2WACA 5CKFA 4HT9A 3X20B 4PJOB 4XU1A 3HL8A 4C8QE 1JB0E 2ZPIB 1K9MU 3P8BB 3M53A 2JOYA 1NZ9A 4TVRA 5LJ3d 4JJNK 3OYIA 4YTLA 5LJ5e 3G71T 1LNXA 3NTIA 2RHUA 4ZGEB 2LC4A 1Q81C 4A4GA 2CZ1B 1QVGS 3QIIA 4C0DC 3FB9A 1QP3A 1XTDA 4C92F 2IG0A 2LDMA 5HY6A 1U8RA 3GP8A 4F7UA 1YJ9A 4MDXA 4HCBA 4P5NA 1VQ7T 2LT4A 4JRIA 3HFNA 3VV0A 1WQWA 4O5VA 1P92A 4M78B 1VQ9A 1QVGA 2CKKA 3TEEA 5DY9A 5GAOn 3QSUA 3GF5A 3BW1A 1HK9A 3E1SA 1N8RC 2D9TA 2DKGA 2DXTA 2QQBA 5GAOq 4M77C 1NE8A 1TH7A 2K4YA 3NFCA 4FIBA 2DIQA 3TCJA 2YRVA 3RUXA 3JCMP 1YI2T 4X9CA 2PVGB 3QZ9B 3RESA 3UWNA 3CC2T 4LDVA 4BY6B 3JCMW 2VGNA 3CC4T 2LVMA 4BDYA 3BY7A 4M75A 2LCCA 4ME7A 4PKCC 1YJWA 5GANd 3DLLA 2V8IA 3GLXA 5IN1A 4Q5WA 3SD4A 1NJIU 3PGGA 4EMKB 2OTLT 4M75G 2F5TX 4OB2B 4XTUA 4N4GA 1VQOA 1UEBA 1KC8U 1XQHA 1KQ2A 1IZ6A 4PLIA 3I55A 4M77A 4OB1B 2C06A 4M78C 2CGHA 2KMTA 4C8QB 5CKDA 3PFSA 3OS1A 4J5YA 4PJOG 2EYQA 4IUTA 5GMKm 5AYFA 4LDYA 3CCST 2RI2A 2Y4YA 3OYNA 3A8GB 3OYBA 3CC7A 2E70A 3L2ZA 2HBPA 4JUVA 3G4SA 2RJDA 3OYDA 3CBMA 4JRQA 5FRMA 1YIJT 3A8MB 3KBGA 1VQPT 4JDSA 4HCCA 2E64A 4BY6C 1YJNA 2CZ7B 4GY5A 2ZPEB 2RB6A 2K3YA 2LTOA 1UB4A 4M7AB 1ZBXA 3C94A 4FSXA 4M75F 2IVWA 5I21A 4M78A 2QQ9A 1QP2A 3NTHA 5FU6C 2F69A 2MMPA 4II1A 2X4WA 3SDZA 5GMKi 2RI3A 2LQKA 4PJOF 1KHCA 2RO0A 3PMTA 5LJ3e 4C8QC 2KQWA 5I2MA 3L42A 1VIFA 4OB3B 1G3YA 4PLLA 5GMKe 1VQ4A 1BKBA 3CD6A 3P8HA 1X75C 4VUBA 4XK8E 3CBPA 4QVZA 3CCQT 1YHQA 3G6EA 5A0LA 4JRPA 5L8RE 3JB9G 2MF2A 3QYGB 1N6AA 3CPWS 2O4XA 3G7ZA 5CO7A 5GMKh 2JTFA 1B34B 1D3BB 2X35A 3H8ZA 3SB2A 1WJQA 2DPPB 5D6YA 4C8QA 4FT2A 2P4TA 3CMAA 3A8LB 4B9WA 1HXDA 1VQ8A 5GAMg 1G5VA 2EQJA 2PUKB 2VC8A 3RKXA 2EJFA 3GOXA 3CPWA 3CMEA 1OZ2A 2JNGA 1VQLT 4B9XA 1W4SA 1WJRA 4IUUA 2XIDA 1UGQB 2PVDB 4MZMA 4RCCA 3JCMg 1BI2A 2ZZDA 5GAMf 2EQMA 2WSCE 2YLCA 3LLRA 3JB9F 2RA2A 5KH6A 3OW2S 1JJ2S 2OTJT 3C95A 4J6WA 2E5QA 3Q1JA 3VUZA 2RHIA 2EWNA 3MP1A 3HSBA 4F7UB 2KK4A 3V7CA 3CCUT 5J26A 4M7AG 1KG1A 3G71A 2KSSA 3QJ6A 5KE2A 3JCMf 4CRIA 3CCJT 4ELYC 1M5Q1 4QVCA 3SWNC 3J80E 5GAMe 5CK9A 4RKUE 2CZ6B 1K8AC 3HRTA 5C6SA 3OW2A 1JJ2A 1Q82U 2PQWA 2RD1A 2X4JA 2RJEA 3QUIA 5HKCA 4E7IA 1VQ7A 3JCMe 1YCYA 2BUDA 2CZ0B 5KCOA 1VQ5T 1X01A 2VV5A 4KULA 2PUOB 4J6XA 2LNVA 1N9RA 4BACA 3TREA 1M9SA 3DLMA 3X24B 4BI4A 1KD1C 2RHXA 3A8HB 4LDUA 1YITA 1RL2A 1D3BA 2VYTA 3A5ZB 4NL3A 1VQKA 3FC3A 4M7AF 1VQ6T 1M1FA 5GAN7 4ZN3A 3M5AA 3S3MA 1YBYA 4N4HA 3JCMJ 3CC4A 4M77B 3OSVA 4QW2A 3MEUA 5CKHA 2X4XA 4NOYA 4EMHA 1M90C 1EIFA 2NLUA 5GAN5 2QXFA 2XKOC 3OBYA 3OYCA 5CKBA 4DOWA 3R6OA 1PSEA 1Y07A 4HA8A 4JLGA 2AHJB 4NL2A 4C5IA 3O8VA 3JCMb 5LJ5h 4IURA 5A2QE 3V7SA 2K5FA 2QQRA 4CI0C 5GAOp 1I8FA 5FRNA 3JCMc 2XDPA 2DXUA 2QTXA 4F7UG 3OS0A 1NPPA 4ELZC 3L2VA 4HT8A 4PJOD 3QO3A 2RHZA 3MP8A 2JUFA 4OB0B 2QQSA 1Q81U 1BI0A 2VXFA 4XTVA 3OYAA 1FX7A 3ASKA 1V29B 3JRZA 4IUQA 2L5QA 1MGQA 3QG1A 5D6XA 1VQNT 1FXXA 2O01E 5GAN3 4NS5A 5FLXE 3V8KA 1S72A 3HFOA 3LYIA 3S6WA 3CCRT 2GQVA 3HRSA 2DK3A 2DXBA 4X9DA 5FU6B 4IUPA 3UT1A 4C5HA 3VJPA 1QVFS 3KUFA 1BIAA 3M59A 4F7UF 5GAN4 2O4XB 3J81E 3KXTA 3CCLT 2Y4XA 1N8RU 4M7DD 1H3ZA 1KHIA 3RIRA 2K5LA 3M4GA 5LJ5j 1K73U 1JRIA 4PNOA 3CCQA 1DJ7B 2LRQA 3CCET 3QYHB 2EQKA 2ZPBB 3M58A 5LJ3g 4QQDA 4M77G 1N27A 2EJGA 4ZGJB 2XICA 4XU3A 3JSCA 4UC4A 4C92E 5FU7C 4ZN1A 5KE3A 2QA4T 1QVFA 2KY9A 4BE0A 1I4K1 2B8AA 3LWIA 2JN0A 1N9SA 3CEYA 2RK1A 3P8DA 5LJ3f 4C0ZA 3JB9D 4OF1A 5HK0A 3WVDB 4X34A 4JRKA 1WNLA 3QJYA 3QKJA 4J7FA 1Q7YC 2FL7A 3VYHB 2L8DA 2RHYA 4OMFB 4O6JA 4M7DC 5A0DA 4BE1A 5CCAA 2EIFA 1YJ9T 3L2RA 4M78G 3M55A 3GNGA 3QBYA 3NTKA 4LDWA 2E1HA 2XG8D 3MHXA 5CQXA 3RKYA 4C0FA 4M77F 3CCVT 3X28B 2DZ9A 4QVDA 1M1KC 2OTJA 1VQ9T 1OYXA 3E19A 2M0OA 3HRUA 5DLOA 3X26B 3CCJA 2VGMA 2K5IA 5KCHA 5LJ3h 1UGSB 2WSFE 1QVPA 5GANg 5IAYA 2K2VA 3J7AF 4EMGA 4A4KA 3LX7A 4BDZA 2JZ2A 2ZPHB 2GCXA 1Y71A 3ZFJA 2E65A 3SWNB 1BIBA 2K3XA 4ZTJA 1M8VA 1YJWT 1UGRB 4M78F 5GANf 2DD5A 2E6ZA 1Q86C 2F5KA 3PT9A 3OYEA 4E7JA 5IT9E 3F70A 4C8QG 2EJ9A 3ZBDA 2R5AA 2RK2A 4Y91A 1FWZA 3PMIA 2EKOA 2DTHA 4BE2A 3OMCA 1OZ3A 2R57A 4BI8B 1BI1A 2GF7A 5LJ5d 3OYGA 3I56T 4XU0A 5GANe 3PIOA 3FEOA 2FHDA 1M4ZA 1O9SA 4M75E 4MZTA 4C92D 3OYFA 4XU2A 3GPLA 1ZQ1A 2RM4A 3QZ5B 5GAOl 2HAXA 3G4ST 2QEXT 3M56A 3MCAB 2EAYA 4PJOE 3TU4K 1BI3A 2P0PA 3BDUA 4A4HA 2DIGA 2EQUA 3EAEA 2DAQA 2V8JA 3MEVA 3PNWC 4A4FA 3OS2A 4C8QF 4C5GA 2P0QA 2VUBA 2EFIA 5A0GA 4C0GA 2A3LA 4MZPA 5GMKj 3MP6A 3BFMA 4HKEA 3GIBA 4L59A 4IUVA 5GAMh 3LGLA 3LGFA 3LW5E 1VQ5A 4J6YA 1WJSA 2OAUA 4C92C 1GXIE 1VIEA 5J39A 3JB9J 3SWNA 4M7DE 4MDWA 4LD6A 3JCMh 2RJCA 2I2LA 3CD6T 2HQXA 1YI2A 2RH2A 3H6ZA 4ATOA 3MEAA 3CC2A 3JB9H 4BUGA 1K8AU 2DJZA 1K9MC 3FJPA 2M9UA 3HPWA 5GAN2 2XHCA 4PL6A 2V8KA 2YLBA 3CCRA 2XI9A 3E9GA 2HD0A 1VUBA 4OP0A 2OTLA 2DO3A 2X4YA 3META 2ZPFB 3T9NA 4QQGA 3JB9I 1KD1U 2QDYB 3CCSA 3CMET 3ER0A 3PTAA 5DM7R 4M75D 3CCEA 4BD3A 4JS4A 4MMKA 4XTWA 1LOJA 5GAMj 4Y28E 3DB3A 3HHTB 3OYKA 2QA4A 2HNIA 4FL6A 4GLKA 5CR2A 1VQPA 3OYMA 1YIJA 2VXEA 3M9QA 1M90U 1Y96B 1KQSS 1IREB 4WF2A 3VYGA 4M77D 4OVAA 4L5GA 5FU7B 4Z02A 3CCMT 2BKDN 2PU9B 1WGSA 5HK3A 3OYHA 4E47A 2LCLA 4RG2A 1RI0A 1W2BS 1SSFA 3C12A 2E6NA 4N4IA 4M7AE 4E7KA 3M54A 4R56A 1QW1A 5GAOm 1KQSA 4FM4B 3DB4A 4M75C 1PSFA 1NJIC 1JBMA 3A8OB 2K57A 3CCVA 3RERA 2GFUA 4M7DB 5LL6S 3V7RA 4ZTFA 1VQMT 2XD0A 4KT0E 1KC8C 5I2SA 3UPUA 3OYYA 1W2BA 2FB7A 2MI6A 4M78D 2ZCFB 4PJOC 2ZPGB 3CBOA 2CS7A 4JLIA 1YITT 1VQKT 5C0MA 1MHNA 3JCMQ 2XK0A 3M57A 3L1AA 3OBWA 4EPCA 3WXMB 1X6OA 3MO8A 3JCMV 2JTMA 5CKEA 3CXCS 2H3JA 3BDLA 1UGPB 2P0KA 4PJOA 2WSEE 3QDRB 2JVVA 3SFMA 4OGCA 1VQLA 4J83A 4KBMB 1XOVA 1Y96A 3OS5A 3RMSA 4DOVA 3I56A 2DXCA 3L2QA 2DTIA 2G3RA 3GNFB 3OB9A 5GAMd 3CXCA 2LT1A 3VUBA 2XU8A 4C8QD 4ZGDB 4XQ3A 5CIUA 5FROA 1O75A 2FYKA 3E9FA 5DLQE 2QEXA 3DKMA 3CCUA 3PIPA 2E12A 3FLGA 4FT4A 4XTYA 3JCMd 2QQAA 2R5MA 1H641 4IKFA 3C4SA 3V8JA 3OYJA 4DQ2A 1LJOA 5CVIA 1I5LA 1OI1A 2DVEA 4F7UE 4M7DA 2MWOA 1Q7YU 4QQ6A 4M7AD 4EMKC 2L89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI U;  1S72 T;  1VQ5 A;  2OTL T;  3JAM E;  1VQO A;  1UEB A;  1KC8 U;  1IZ6 A;  3I55 A;  5A2Q E;  1M1K U;  3LGL A;  1VQO T;  3LGF A;  3CPF A;  3I55 T;  3LH0 A;  3CCS T;  1VQ6 A;  1NPR A;  1NPP A;  3CC7 A;  2E70 A;  3G4S A;  3CD6 T;  1YI2 A;  2KVQ G;  2KDS A;  2MWP A;  2JUF A;  1YIJ T;  1VQP T;  3KBG A;  3CC2 A;  3CC7 T;  1Q81 U;  1YJN A;  1K8A U;  1K9M C;  1YJN T;  2XHC A;  1Q86 U;  3CCR A;  2LQ8 A;  1VQN T;  5FLX E;  1S72 A;  2OTL A;  2DO3 A;  3CCR T;  5J3B A;  1Q82 C;  1QVF S;  1KD1 U;  3J81 E;  3CCL T;  3CCS A;  1N8R U;  3CME T;  3ER0 A;  1KHI A;  5DM7 R;  3CCE A;  1K73 U;  3CCQ A;  1VQ4 A;  1BKB A;  3DB3 A;  3CCE T;  3CD6 A;  2QA4 A;  4QQD A;  1VQP A;  1YIJ A;  3CCQ T;  1VQ4 T;  1YHQ A;  4ZN1 A;  3HKS A;  3G6E A;  3CCM A;  2QA4 T;  1M90 U;  1KQS S;  1QVF A;  2L3R A;  3CPW S;  1YHQ T;  3G6E T;  3CCM T;  1VQN A;  2LCL A;  4RG2 A;  1W2B S;  1SSF A;  4X34 A;  3CMA A;  1Q7Y C;  1VQ8 A;  1KQS A;  1VQM A;  3DB4 A;  3CPW A;  3CCL A;  1VQ8 T;  1NJI C;  3CMA T;  2EIF A;  3CCV A;  1YJ9 T;  3CME A;  1VQL T;  2JNG A;  5LL6 S;  1VQM T;  1M1G A;  3CCV T;  1KC8 C;  1XNI A;  1W2B A;  3OYY A;  2OTJ A;  2MI6 A;  1M1K C;  1VQ9 T;  1VQK T;  3OW2 S;  1YIT T;  2OTJ T;  1JJ2 S;  3CCJ A;  3CCU T;  1K9M U;  5J26 A;  3P8B B;  3G71 A;  3CCJ T;  2JOY A;  4CRI A;  5IAY A;  1NZ9 A;  4TVR A;  3J7A F;  3J80 E;  4YTL A;  3G71 T;  1X6O A;  3CXC S;  1Q81 C;  1K8A C;  3OW2 A;  1QVG S;  1JJ2 A;  1YJW T;  1Q82 U;  1XTD A;  1Q86 C;  2E6Z A;  2IG0 A;  2JVV A;  5HY6 A;  1VQ7 A;  1YJ9 A;  1VQ5 T;  5IT9 E;  1VQL A;  1VQ7 T;  3I56 A;  2G3R A;  3CXC A;  1VQ9 A;  3TRE A;  1KD1 C;  1QVG A;  2CKK A;  3I56 T;  1VQK A;  1YIT A;  1RL2 A;  3PIO A;  3A5Z B;  1N8R C;  1VQ6 T;  5DLQ E;  2QEX A;  3CCU A;  4ZN3 A;  3PIP A;  1K73 C;  1YBY A;  3G4S T;  2QEX T;  1YI2 T;  3CC4 A;  3CC2 T;  1M90 C;  3CC4 T;  2LVM A;  2MWO A;  1Q7Y U;  1EIF A;  1YJW A;  3DLL A; 
#chains in the Genus database with same CATH topology
 4N0A C;  2KNB B;  1X43 A;  3RKW A;  1VQ5 A;  3HP9 A;  5GAN 6;  4BI3 A;  3JAM E;  1M2V B;  5M9O A;  1WHM A;  1X6B A;  3S3N A;  1M1K U;  3CPF A;  3MEW A;  1K4U S;  4RG8 A;  1VQ6 A;  1NPR A;  3VKI A;  5HCK A;  4D6W A;  1VQP Q;  2KVQ G;  2KDS A;  3D7S B;  4N0A A;  5GAN 8;  2GFA A;  1RUW A;  1SF9 A;  2LJ0 A;  5GAN h;  2YRD A;  1I81 A;  3VU3 C;  2D6F A;  5KYU B;  4RCB A;  2E10 A;  4L6V 5;  4C5E A;  1Q82 C;  3FIF A;  3CCV Q;  1H3H A;  4D8D A;  3V8L A;  2EW3 A;  2YUP A;  2BIV A;  4A54 A;  1BYM A;  2DEQ A;  2KR3 A;  1GCQ A;  1Y57 A;  3UDC A;  4D8K A;  1Y7X A;  1YHQ T;  3OQ5 A;  4RMO A;  1HD3 A;  1VQN A;  5GMK l;  2D0Q B;  3I35 A;  4C0D B;  1VQM A;  4OMP A;  2RQR A;  3I56 Q;  1WPY A;  5ECA A;  1Z9Z A;  4C92 G;  1M1G A;  1XNI A;  4FU6 A;  1B34 A;  3OY9 A;  1A0N B;  1D1C A;  3HL8 A;  3CCJ Q;  2EGA A;  2JMC A;  2DL5 A;  3M53 A;  1NZ9 A;  4TVR A;  3NTI A;  2CZ1 B;  3QII A;  1AWW A;  1QP3 A;  1UUE A;  4DEY A;  1V76 A;  1WI7 A;  4P5N A;  1VQ7 T;  3VV0 A;  1AD5 A;  2AT1 B;  3GBQ A;  4O5V A;  1VQ9 A;  1M27 C;  5GAO n;  4CC3 A;  1HK9 A;  1MV3 A;  2YDL A;  2D9T A;  5GAO q;  1TH7 A;  3TCJ A;  3RES A;  3CC2 T;  1PD1 A;  3EGX A;  2HKQ B;  3R6N A;  2LVM A;  3BY7 A;  4PKC C;  1YJW A;  3H0H A;  2V8I A;  5IN1 A;  4Q5W A;  2L3P A;  3ZL7 C;  5IXB A;  2PZ1 A;  2F5T X;  4N4G A;  1KQ2 A;  2K6D A;  1KC8 U;  1XQH A;  4OB1 B;  2C06 A;  5CKD A;  1UHF A;  4J5Y A;  4PJO G;  4IUT A;  3EH1 A;  2Y4Y A;  2QGG A;  3EH2 A;  4JRQ A;  3A8M B;  1VQP T;  5GJW B;  2E64 A;  2ZPE B;  1QWE A;  2K3Y A;  2LTO A;  1M3B A;  4M75 F;  2IVW A;  5I21 A;  1SHF A;  5FU6 C;  2F69 A;  2HZY A;  2RO0 A;  3CCL Q;  4C8Q C;  1QLY A;  2NUT A;  3CCE Q;  2H8H A;  3CD6 A;  3P8H A;  3EHR A;  1YHQ A;  4JRP A;  3VS2 A;  5L8R E;  2MF2 A;  3QYG B;  1N6A A;  1IRX A;  2JXB A;  1TSF A;  1OX8 A;  1B34 B;  4C8Q A;  3SB2 A;  2DPP B;  1B07 A;  5D6Y A;  2C0O A;  4ZNX A;  2QTV A;  1J3T A;  3TQ7 P;  3GOX A;  1U3O A;  3CME A;  1AZG B;  4B9X A;  1BI2 A;  1D0X A;  1RI9 A;  2ZZD A;  5GAM f;  2WSC E;  2YLC A;  3JB9 F;  2OTJ T;  3C95 A;  3Q1J A;  4M7A G;  4IIM A;  1KG1 A;  1NLO C;  3CCJ T;  4CRI A;  4J9I A;  4QVC A;  1RAB B;  5GAM e;  4J9C A;  4RTW A;  1NEG A;  2CZ6 B;  4E7S A;  3OW2 A;  3EFO A;  1Q95 G;  2RD1 A;  1VQ7 A;  1YCY A;  1VQO Q;  2MOX A;  2LNV A;  1M9S A;  1KD1 C;  4LDU A;  1YIT A;  1RL2 A;  2VYT A;  5GAN 7;  4ZN3 A;  3G4S Q;  1UJY A;  2EKH A;  4AFU C;  4OMO A;  1IGQ A;  3OSV A;  3MEU A;  2RNA A;  4EMH A;  1UTI A;  3OYC A;  1M3A A;  1RAH B;  1PSE A;  4JLG A;  1GCP A;  4HVV A;  3O8V A;  2COY A;  4CI0 C;  5FRN A;  2QTX A;  2QGF B;  1TS9 A;  1NPP A;  2AK5 A;  4HT8 A;  3MP8 A;  4OB0 B;  1Q81 U;  1KIK A;  2DM1 A;  4IUQ A;  2MYS A;  1FXX A;  5FLX E;  3V8K A;  3HFO A;  2HKN A;  3CMA Q;  2KYB A;  3CCR T;  2GQV A;  1OEB A;  5FU6 B;  2KE9 A;  2AZS A;  4HVW A;  3CPW P;  4PJL A;  1KJW A;  3CCL T;  3KXT A;  4M7D D;  4LUE A;  1V1C A;  2K5L A;  5LJ5 j;  2LRQ A;  3CCE T;  1S1N A;  2ZPB B;  4QQD A;  1N27 A;  2XIC A;  4XU3 A;  4ZN1 A;  2CP6 A;  3CCM Q;  1M3C A;  2B8A A;  2DE0 X;  4C0Z A;  2FPE A;  4X34 A;  4ESR A;  3REB B;  2L8D A;  3O5Z A;  3L2R A;  3GNG A;  1OQK A;  2LQW A;  1WIE A;  2OTJ A;  1VQK Q;  3E19 A;  3EFO B;  3HRU A;  4CC2 A;  5DLO A;  3CCJ A;  1RAD B;  2EYW A;  3H41 A;  1TOV A;  2WSF E;  3IQL A;  4A4K A;  3LX7 A;  2JZ2 A;  4FCY A;  2GCX A;  3EG9 B;  2LJ1 A;  4M78 F;  1Q86 C;  3F70 A;  3PMI A;  1FWZ A;  4BE2 A;  3OMC A;  1OZ3 A;  5LJ5 d;  4XU0 A;  3SHW A;  2FHD A;  4M75 E;  1O9S A;  1CKB A;  1RAC B;  3QZ5 B;  2D1X A;  2HAX A;  3G4S T;  3MCA B;  2EAY A;  2V1R A;  1QCF A;  4RTV A;  3EAE A;  2DAQ A;  1WFW A;  1S72 Q;  2EFI A;  2P0Q A;  2A3L A;  5GMK j;  3MP6 A;  2F2V A;  2LP5 A;  3VRZ A;  3LGF A;  3LW5 E;  2CSI A;  4C92 C;  8AT1 B;  3JB9 J;  3SWN A;  3CCQ Q;  4WCI A;  1YI2 A;  2RH2 A;  3MEA A;  4PFP A;  1R0B G;  3JB9 H;  2DL3 A;  2DJZ A;  5IHN A;  2YUN A;  3HPW A;  5GAN 2;  2XHC A;  4PL6 A;  3CCR A;  2XI9 A;  2E5K A;  2HD0 A;  2DO3 A;  2X4Y A;  2A36 A;  3JV3 A;  2L2P A;  2QDY B;  3CCS A;  1ZUK A;  4AMC A;  3CCE A;  4XTW A;  2DIL A;  4Y28 E;  3OYK A;  4Z88 A;  5KYY A;  5CR2 A;  1YIJ A;  3OYM A;  3QWY A;  2VXE A;  4WTO B;  2RQU A;  4WF2 A;  1PHT A;  4OVA A;  4L5G A;  3CCM T;  2BE9 B;  2PU9 B;  5HK3 A;  3OYH A;  1RI0 A;  2ESW A;  4N4I A;  3M54 A;  1N8R R;  2DL4 A;  1SPK A;  1K73 R;  2K57 A;  3V7R A;  5AT1 B;  5I2S A;  4PJO C;  1VQK T;  3JCM Q;  1YFN A;  3M57 A;  1WLP B;  4EPC A;  2JTM A;  1B7T A;  4PJO A;  1JO8 A;  1I0C A;  4KBM B;  2DYB A;  2DTI A;  3GNF B;  3CXC A;  2GBQ A;  1ZX6 A;  1QCN A;  4C8Q D;  2DNU A;  2YUQ A;  3FJ5 A;  2FYK A;  5DLQ E;  3DKM A;  3CCU A;  4XTY A;  3JCM d;  5CVI A;  1OI1 A;  2P84 A;  4RTX A;  1S72 T;  1AHJ B;  2F2X A;  4QKU A;  2DZC A;  3OSS C;  4XTZ A;  2FRY A;  4XTX A;  1U1T A;  2D8H A;  3S3O A;  1VYT A;  3M4Y A;  1KFZ A;  4C92 B;  2ZGW A;  3L2U A;  2QA4 Q;  1NEB A;  3NHN A;  2Y90 A;  4PFO A;  5CQY A;  1ABQ A;  4R55 A;  1ZUY A;  4M7A C;  2E41 A;  1D09 B;  9ATC B;  2CYZ B;  3QHS A;  4AFZ C;  2BZ8 A;  5LJ3 j;  1YJN T;  4M7D F;  4LD9 K;  2KRO A;  1G3T A;  1WXU A;  1GRI A;  4OGE A;  1K76 A;  2QI2 A;  2DD4 A;  1AWX A;  2BZX A;  2DLP A;  4V2S A;  2FEI A;  4BB7 A;  3WVE B;  1G3W A;  4M7A A;  3OYL A;  4JJB A;  3LWH A;  2BZY A;  3QXE B;  3FRN A;  4M78 E;  3HKS A;  3CCM A;  2RF0 A;  4A53 A;  1M2V A;  5GAO r;  2RI5 A;  1QVF P;  1LVK A;  2DL7 A;  1UFF A;  2XDD A;  4DBR A;  2FZC B;  1JQQ A;  2YHT A;  1TU0 B;  2PVO B;  4MML A;  1SRL A;  1KQ1 A;  5EG2 A;  4AG1 C;  5GAN j;  1WHG A;  6AT1 B;  1TUC A;  1PKT A;  4LDX A;  2GQI A;  1VQL Q;  1ZHI A;  4E7L A;  3ME9 A;  4EDU A;  1AEY A;  5CAI A;  1M90 R;  2WAC A;  2CT4 A;  4PJO B;  1JXO A;  4XU1 A;  3M0T A;  5KYU A;  3SEM A;  1JB0 E;  2ABL A;  5LJ3 d;  4JJN K;  4LN2 A;  2LC4 A;  1ZA2 B;  1E6G A;  1QVG S;  4CC4 B;  4C0D C;  2LDM A;  1U8R A;  1K1Z A;  1YJ9 A;  2MIO A;  4MDX A;  2MCN A;  2CSQ A;  1P92 A;  4M78 B;  2CKK A;  5DY9 A;  3E1S A;  2QQB A;  3NFC A;  2DIQ A;  3JCM P;  4BY6 B;  3CC4 T;  4BDY A;  5GAN d;  1U06 A;  3QWX X;  4M75 G;  4OB2 B;  1UEB A;  2KRN A;  3NPF A;  4HXJ A;  2JS0 A;  3OS1 A;  5GMK m;  5AYF A;  3OYB A;  2XMF A;  3L2Z A;  4JUV A;  3OYD A;  1Q7Y R;  4F16 A;  3CBM A;  2YXY A;  1ZSZ C;  3KBG A;  4JDS A;  2K7A A;  2CH4 A;  4HCC A;  1YJN A;  1QCO A;  4M7A B;  2J7I A;  1ZBX A;  2OAW A;  1FMW A;  2KT8 A;  2MMP A;  4II1 A;  2X4W A;  2LQK A;  3PMT A;  5LJ3 e;  2X9H A;  2M02 A;  1X27 A;  5I2M A;  2LMJ A;  4OB3 B;  1BKB A;  1VYU A;  2OI3 A;  5A0L A;  3JB9 G;  2O4X A;  1RAE B;  1WJQ A;  1NM7 A;  4AG2 C;  2P4T A;  5GAM g;  1G5V A;  2VC8 A;  2J6F A;  4LE9 A;  1VQL T;  1W4S A;  1WJR A;  1YP5 A;  1G8X A;  1H8K A;  2EQM A;  3LLR A;  2BTT A;  1W2B P;  2E5Q A;  3MP1 A;  2KK4 A;  3V7C A;  2KSS A;  4ELY C;  1M5Q 1;  5CK9 A;  4RKU E;  1K8A C;  5C6S A;  1BCO A;  2PQW A;  3QUI A;  2CZ0 B;  5KCO A;  4K11 A;  1XJW B;  1X01 A;  2FPF A;  2VV5 A;  2CP7 A;  1AZE A;  3I55 Q;  4KUL A;  2PUO B;  4J6X A;  3TRE A;  2LZ6 B;  2QYZ A;  1K9M R;  3A98 A;  4AFS C;  1M1F A;  3S3M A;  1WHL A;  1YBY A;  3JCM J;  3CC4 A;  4QW2 A;  2X4X A;  4NOY A;  2VWF A;  5GAN 5;  2FG0 A;  4HA8 A;  4NL2 A;  4KRT A;  4C5I A;  1D0Y A;  2K5F A;  2M0Y A;  2QQR A;  2JM9 A;  3JCM c;  4ELZ C;  3L2V A;  1PD0 A;  1VQ4 Q;  1R0C B;  4PJO D;  2KRS A;  3H0F A;  3QO3 A;  4JJC A;  1RAF B;  1Z9Q A;  2VXF A;  1NJI R;  1ZSZ B;  3QG1 A;  1MGQ A;  5GAN 3;  1ZBJ A;  3LYI A;  4J9F A;  4RTZ A;  3H0I A;  1IGU A;  1YCS B;  3UT1 A;  1QVF S;  2YRC A;  3M59 A;  4F7U F;  2O4X B;  3M0S A;  4PJJ A;  1N8R U;  1H3Z A;  1K73 U;  1M8M A;  1GFC A;  2SRC A;  4PNO A;  3QYH B;  2EQK A;  4E6R A;  1R77 A;  3G71 Q;  4BE0 A;  3LWI A;  2JN0 A;  3CEY A;  1T0J A;  3THK A;  1NLP C;  1WNL A;  2CP5 A;  2FL7 A;  3VYH B;  4JZ3 A;  4OMF B;  4BE1 A;  5CCA A;  4M78 G;  3M55 A;  3QBY A;  2E1H A;  2XG8 D;  3BE3 A;  3MHX A;  3CCV T;  2GNC A;  4M77 F;  3EG2 A;  3NMZ C;  2ROL A;  3X28 B;  1M1K C;  2M0O A;  1JXM A;  1YWO A;  3EGU A;  2K5I A;  2DMO A;  5IHK A;  2K2V A;  4EMG A;  1RLP C;  2OJ2 A;  1Y71 A;  2YSQ A;  2E65 A;  1BIB A;  2KEA A;  2J6O A;  2HQH A;  3PT9 A;  5IT9 E;  3ZBD A;  4Y91 A;  2OX7 A;  3EGD B;  2R57 A;  3MKD A;  3I56 T;  3PIO A;  4MZT A;  3GPL A;  1OPL A;  1UG1 A;  3M56 A;  1Q82 R;  2DET A;  3TU4 K;  2P4R A;  1IHW A;  1ZSG A;  3BDU A;  4A4H A;  2DIG A;  2EQU A;  1PKS A;  4AT1 B;  2V8J A;  4C5G A;  2VUB A;  5A0G A;  1D1A A;  1UE9 A;  4DBQ A;  5GAM h;  2IIM A;  4GBQ A;  3A1P A;  1GXI E;  3EG9 A;  5J39 A;  1K8A R;  4LD6 A;  2I2L A;  3CC7 Q;  3H6Z A;  4ATO A;  1HYO A;  3CC2 A;  3EHQ A;  4BUG A;  4X1V A;  1GBQ A;  3FJP A;  2V8K A;  2CH4 W;  1KK7 A;  3MET A;  1UGV A;  1JEG A;  1K9A A;  2M51 A;  3PTA A;  2ZAE A;  2HNI A;  1VQP A;  4ANJ A;  1M90 U;  1UJ0 A;  1Y96 B;  4Z02 A;  5I11 A;  1WGS A;  4E47 A;  1W2B S;  3C12 A;  2E6N A;  4R56 A;  1N5Z A;  4FM4 B;  3PVL A;  4M75 C;  1PSF A;  3CCV A;  2B86 A;  4ZTF A;  4JJD A;  1KC8 C;  3MPU B;  3UPU A;  2QDL A;  2FRW A;  3OYY A;  2ZPG B;  1Y0M A;  1MHN A;  2C0T A;  2KBT A;  2KXD A;  1EFN A;  7AT1 B;  3QDR B;  3SFM A;  2JVV A;  1JJ2 P;  4J83 A;  3MJX A;  4DOV A;  3VRY A;  1IO6 A;  3I56 A;  2FPD A;  1ZLM A;  2LT1 A;  3VUB A;  2AIR B;  4XQ3 A;  5KYW A;  1K0S A;  1O75 A;  1TTH B;  1OV3 A;  2E12 A;  3EG3 A;  4FT4 A;  1FMK A;  4DBH A;  2ED1 A;  4IKF A;  3V8J A;  4F7U E;  1QMC A;  2D0N A;  1Q7Y U;  4QQ6 A;  1RAA B;  1M1K R;  2EQI A;  2OTL Q;  4XAX B;  2MAM A;  3X25 B;  4M7D G;  1R8O B;  4M4Z A;  2ENM A;  1VQO T;  3UA6 A;  3LH0 A;  1IHV A;  4PJM A;  3INZ A;  4FYV B;  3CC7 T;  4IIO A;  2A08 A;  2A7Y A;  3G1J A;  4E7H A;  2LQ8 A;  4M77 E;  4J7I A;  3L2W A;  2HQE A;  4HCZ A;  2RJF A;  5J3B A;  2F2W A;  2M16 A;  1G3S A;  2A28 A;  3RMQ A;  1AVZ C;  2RMO A;  2KRM A;  2FVU A;  2KAF A;  1F1B B;  2EGE A;  2L3R A;  2XDB A;  3PVQ A;  1KD1 R;  2J06 A;  1U1S A;  4C92 A;  4JS5 A;  1TXQ A;  3ZEH A;  5FWC A;  3VS0 A;  1HJD A;  3CMA T;  3CCL A;  2LX9 A;  4OMN A;  1MV0 B;  3N5B B;  4M75 B;  3OA6 A;  2DTO A;  5LJ5 f;  2AKK A;  1VOM A;  5CKF A;  2ZPI B;  1K9M U;  3M0Q A;  3P8B B;  1SSH A;  2JOY A;  2LX7 A;  5LJ5 e;  1LNX A;  4ZGE B;  2RHU A;  5KYW B;  1Q81 C;  4A4G A;  1JU5 C;  1ACM B;  1VQ5 Q;  1MMD A;  3RDV A;  1MND A;  3GP8 A;  1WQW A;  1QVG A;  3RBB B;  1LPL A;  3TEE A;  1VQ6 Q;  3BW1 A;  1QKX A;  2DKG A;  2K4Y A;  3RUX A;  2PVG B;  3QZ9 B;  3UWN A;  2VGN A;  2DRM A;  1H92 A;  4ME7 A;  3DLL A;  3GLX A;  4FYW B;  3SD4 A;  1NJI U;  2OTL T;  1PCX A;  1VQO A;  4XTU A;  2GTO A;  2PTK A;  4M78 C;  3PFS A;  2RI2 A;  3OYN A;  3A8G B;  1PWT A;  3CC7 A;  2E70 A;  2HBP A;  3G4S A;  2CUD A;  1ZUU A;  4BY6 C;  2RB6 A;  4Z89 A;  1UB4 A;  1VQN Q;  4OMQ A;  2HSE B;  3C94 A;  4FSX A;  4M78 A;  1QP2 A;  3NTH A;  2DBM A;  2CP0 A;  1VQM Q;  2V26 A;  4FSS A;  2CRE A;  5GMK e;  3M0P A;  3CCQ T;  1I5O B;  2GTJ A;  1Q86 R;  3CPW S;  1QKW A;  5CO7 A;  5GMK h;  2JTF A;  2W10 A;  2X35 A;  1D3B B;  3H8Z A;  1BK2 A;  4FT2 A;  3CMA A;  1HXD A;  1PG5 B;  2EQJ A;  3RKX A;  1KQS P;  2JNG A;  1UGQ B;  1VQ9 Q;  2PVD B;  4RCC A;  1M30 A;  4Z8A A;  2RA2 A;  5KH6 A;  2EPD A;  1JJ2 S;  3HSB A;  4J6W A;  2EWN A;  3VS1 A;  8ATC B;  5J26 A;  1GFD A;  5KE2 A;  3JCM f;  3J80 E;  4PJN A;  1YJW Q;  1Q82 U;  2X4J A;  2RJE A;  5HKC A;  2YWW A;  2BUD A;  3JCM e;  5I22 A;  1VQ5 T;  1ABO A;  1AOJ A;  1N9R A;  3DLM A;  4BI4 A;  3A8H B;  1T3S A;  1VQK A;  3A5Z B;  4F04 B;  4DBF A;  1VQ6 T;  1WX6 A;  3M5A A;  2QEX Q;  1W6X A;  1WHK A;  2COW A;  5CKH A;  1OPK A;  1EIF A;  2NLU A;  1X6G A;  3OBY A;  2XKO C;  5CKB A;  3VS3 A;  3R6O A;  1Y07 A;  2AHJ B;  2CT3 A;  3JCM b;  4IUR A;  5A2Q E;  2DRK A;  5GAO p;  2X3W D;  1PC0 A;  4JZ4 A;  2XDP A;  3OS0 A;  4F7U G;  3HTR A;  2HEQ A;  3CD6 Q;  2RHZ A;  2JUF A;  1YHQ Q;  1BI0 A;  1PRM C;  1FX7 A;  5D6X A;  3M0U A;  1VQN T;  4NS5 A;  1S72 A;  3S6W A;  2DXB A;  2X51 A;  2JW4 A;  3KUF A;  1BIA A;  3CME Q;  3VS7 A;  3RIR A;  1U5S A;  3AT1 B;  3M4G A;  3EG0 A;  4J9E A;  3CCQ A;  2E3H A;  3I9Q A;  3UA7 A;  4M77 G;  2DVJ A;  1QVF A;  2QA4 T;  5KE3 A;  2L89 A;  1K0X A;  2K3B A;  1I4K 1;  2RK1 A;  1SKU B;  2QK0 A;  3P8D A;  5LJ3 f;  3JB9 D;  5HK0 A;  1WXT A;  4B6M A;  4J7F A;  1UDL A;  1VQ7 Q;  4M7D C;  1BB9 A;  3NTK A;  4C0F A;  5CQX A;  1ZSZ A;  1SG5 A;  2O9S A;  1VQ9 T;  1YIT Q;  1OYX A;  2EYY A;  2VGM A;  5LJ3 h;  1UGS B;  1QVP A;  5IAY A;  3J7A F;  4BDZ A;  1CSK A;  2ZPH B;  3NGP A;  3ZFJ A;  1TUD A;  4LUD A;  4KGX B;  4ZTJ A;  1M8V A;  1YJW T;  1UGR B;  5GAN f;  3TSZ A;  3UF4 A;  3OYE A;  4E7J A;  1FMV A;  2R5A A;  3OYG A;  1ZA1 B;  2GF7 A;  4A63 B;  4E2F B;  5GAN e;  2CP3 A;  1M4Z A;  4C92 D;  2RQT A;  2RM4 A;  5GAO l;  2QEX T;  2H3E B;  3E2U A;  3MEV A;  4A4F A;  1GCQ C;  4C8Q F;  3OS2 A;  1WXB A;  4C0G A;  4MZP A;  2DFU A;  2SEM A;  1T0H A;  2O31 A;  3BFM A;  3GIB A;  1B3Q A;  4GLM A;  4IUV A;  1WA7 A;  3LGL A;  1WJS A;  2EBP A;  1CKA A;  1VIE A;  1WYX A;  2C0I A;  4MDW A;  4M7D E;  3CD6 T;  1X69 A;  2QAZ A;  1BBZ A;  2YT6 A;  2M9U A;  3EGD A;  1SHG A;  2YLB A;  1VUB A;  2ZPF B;  5IHI A;  4KH0 B;  3C0C A;  4QQG A;  5FW9 A;  1KD1 U;  4KH1 B;  2FZG B;  3CME T;  3ER0 A;  5DM7 R;  4BD3 A;  2OTJ Q;  4JS4 A;  5GAM j;  1LOJ A;  5GJV B;  3DB3 A;  2QA4 A;  1MNE A;  1VYV A;  2E3I A;  1KQS S;  1IRE B;  3G6E Q;  4J9G A;  2BE7 D;  2EGC A;  1SSF A;  1QW1 A;  1VQ8 Q;  2K9G A;  3LH5 A;  2A37 A;  3QDF A;  3A8O B;  2LNH B;  3RER A;  4M7D B;  5LL6 S;  4KT0 E;  2DYI A;  1W2B A;  2FB7 A;  4M78 D;  2ZCF B;  2F1L A;  1YIT T;  3U23 A;  3L1A A;  2JMA A;  4AFQ C;  3WXM B;  1X6O A;  1E7O A;  4F14 A;  5IH2 A;  5CKE A;  2I0N A;  1C0M A;  2H3J A;  1UGP B;  3OW2 P;  2WSE E;  2ED0 A;  2JTE A;  2RPN A;  4OGC A;  1X2Q A;  1VQL A;  1XOV A;  1Y96 A;  3OS5 A;  3RMS A;  2LCS A;  2DXC A;  5GAM d;  1G2B A;  5FRO A;  1E6H A;  3REA B;  1T3L A;  1I1J A;  2QEX A;  3PIP A;  2RQW A;  1YI2 Q;  2QQA A;  2R5M A;  1H64 1;  4RTY A;  3OYJ A;  4OML A;  4DQ2 A;  1LJO A;  2LQN A;  2DVE A;  4M7A D;  3ULR B;  4EMK C;  3CCR Q;  2EYZ A;  1WHJ A;  3VS6 A;  1WQ7 A;  3URG A;  2HMA A;  3CCS Q;  3I55 T;  4A4E A;  3AHU A;  1RAG B;  4RUG A;  4J9D A;  1WHH A;  4J8O A;  4EMK A;  1YIJ Q;  2R58 A;  5D6W A;  1OUL A;  2MWP A;  4KUI A;  4QT7 A;  2ROT A;  2L3S A;  1Q86 U;  3FDR A;  2NUZ A;  2M1H A;  2VVK A;  4KUD K;  2JM8 A;  4Y92 A;  2RN8 A;  1NBE B;  3QPH A;  3JCM X;  1VQ4 T;  1RAI B;  2J6K A;  3RNJ A;  3G6E T;  3OMG A;  2KT1 A;  4DA4 A;  2DEU A;  1GL5 A;  5LJ5 g;  3EFR A;  1VQ8 T;  3EGX B;  2GGR A;  2NYS A;  3EFS A;  1IXD A;  2E4H A;  4HT9 A;  3X20 B;  1OU9 A;  4C8Q E;  3CCU Q;  3RR6 A;  1UEC A;  1PRL C;  3OYI A;  4YTL A;  3G71 T;  1HSQ A;  2CDT A;  3FB9 A;  1XTD A;  4C92 F;  2IG0 A;  5HY6 A;  2PNI A;  4F7U A;  2DA9 A;  4HCB A;  2COZ A;  2LT4 A;  4JRI A;  3HFN A;  1NYF A;  2ATC B;  3QSU A;  3GF5 A;  1N8R C;  2DXT A;  2CUB A;  1K73 C;  2NWM A;  4M77 C;  1NE8 A;  1AWJ A;  4FIB A;  1OOT A;  2YRV A;  2Z0W A;  1YI2 T;  4X9C A;  4LDV A;  3JCM W;  2NUT B;  5FWB A;  4M75 A;  2FO0 A;  2LCC A;  2DER A;  3PGG A;  4EMK B;  2O88 A;  1IZ6 A;  4PLI A;  3I55 A;  4M77 A;  2CGH A;  2KMT A;  3H9N A;  4RTU A;  4C8Q B;  2EYQ A;  3TSW A;  3CCS T;  4LDY A;  2L0A A;  2CP2 A;  5D7U A;  1W1F A;  2RJD A;  2KXC A;  2KYM A;  1YIJ T;  4KGV B;  5FRM A;  2CZ7 B;  4GY5 A;  1MUZ A;  1AT1 B;  1ARK A;  2QQ9 A;  4KGZ B;  3SDZ A;  5GMK i;  2RI3 A;  4PJO F;  1KHC A;  2KQW A;  3L42 A;  2KI7 A;  1VIF A;  2HL5 C;  4CC7 A;  2V1Q A;  4PLL A;  1G3Y A;  1VQ4 A;  1X75 C;  4VUB A;  4XK8 E;  3CBP A;  4QVZ A;  3G6E A;  3G7Z A;  1VA7 A;  4LXC A;  5KYN A;  3A8L B;  4B9W A;  1VQ8 A;  2VKN A;  4RTT A;  1YJ9 Q;  2PUK B;  3CPW A;  2EJF A;  1OZ2 A;  1EZZ B;  4IUU A;  2XID A;  2HCK A;  4E7Z A;  4MZM A;  3JCM g;  1YWP A;  1QVG P;  3OW2 S;  2HDA A;  3VUZ A;  2RHI A;  4F7U B;  3CCU T;  2J05 A;  5KYX A;  3G71 A;  3QJ6 A;  3SWN C;  1SEM A;  2MK5 A;  1QWF A;  3HRT A;  1JJ2 A;  2DBK A;  3UAT A;  1MMN A;  4E7I A;  3M0R A;  4BAC A;  2EYX A;  3X24 B;  2RHX A;  1WDX A;  3CXC P;  4M7A F;  1D3B A;  4NL3 A;  3FC3 A;  2O2O A;  4N4H A;  1YN8 A;  1YJN Q;  4M77 B;  1M90 C;  2QXF A;  1MMA A;  4DOW A;  4FYX B;  1BCM A;  4F17 A;  3PE0 A;  3EG1 A;  2HL3 A;  4LNP A;  5LJ5 h;  1UHC A;  3V7S A;  1I8F A;  2QAS A;  3TVT A;  1IB8 A;  2DXU A;  2NUP A;  1RLQ C;  4J9H A;  2DF6 A;  2QQS A;  3OYA A;  4XTV A;  3ASK A;  1NG2 A;  1V29 B;  3JRZ A;  2L5Q A;  4EIK A;  1KC8 R;  1LCK A;  2O01 E;  1I07 A;  2AKL A;  3HRS A;  2DK3 A;  4JPB W;  4C5H A;  4X9D A;  4IUP A;  3VJP A;  3J81 E;  5GAN 4;  1C6V X;  4OMM A;  1WZO A;  2Y4X A;  1KHI A;  4PK4 A;  1JRI A;  1DJ7 B;  1KSW A;  3M58 A;  5LJ3 g;  4ZGJ B;  2EJG A;  3JSC A;  4UC4 A;  4C92 E;  5FU7 C;  2G6F X;  2K2M A;  2KY9 A;  1PNJ A;  1N9S A;  1OX9 A;  1EX4 A;  4OF1 A;  3WVD B;  2LJ3 A;  4HCK A;  4JRK A;  2O9V A;  3QJY A;  3QKJ A;  1Q7Y C;  2RHY A;  4FW1 A;  4O6J A;  1NYG A;  5A0D A;  5KYX B;  2EIF A;  1YJ9 T;  4LDW A;  3RKY A;  2DZ9 A;  4QVD A;  1BU1 A;  2W0Z A;  3X26 B;  2DX1 A;  5KCH A;  3CC4 Q;  5GAN g;  3SWN B;  2K3X A;  2L3Q A;  1FYN A;  1TWB A;  2DD5 A;  2E6Z A;  2HSP A;  2F5K A;  4C8Q G;  2EJ9 A;  2JT4 A;  1AWO A;  2RK2 A;  1GBR A;  2EKO A;  2DTH A;  4BI8 B;  1BI1 A;  3FEO A;  3OYF A;  2YUO A;  4XU2 A;  1ZQ1 A;  4FYY B;  2A0F B;  4PJO E;  1BI3 A;  2P0P A;  3PNW C;  2NUP B;  1OU8 A;  5KYY B;  2K79 A;  4HKE A;  2MPX C;  2VAS A;  4L59 A;  4J6Y A;  2ECZ A;  2OAU A;  1QQJ A;  2D8J A;  4PFZ A;  3JCM h;  4R0K A;  2RJC A;  2HQX A;  1K8A U;  3KFV A;  1K9M C;  3E9G A;  4OP0 A;  2OTL A;  5EC7 A;  3T9N A;  5L23 A;  3I5S A;  3JB9 I;  1D1B A;  2RQV A;  4M75 D;  2HBW A;  4MMK A;  2DJQ A;  1Q81 R;  3HHT B;  4FL6 A;  2FZK B;  1M2O A;  4GLK A;  3M9Q A;  4DEX A;  3VYG A;  4M77 D;  5FU7 B;  4HVU A;  2BKD N;  2LCL A;  4RG2 A;  4M7A E;  1C1A A;  4E7K A;  5GAO m;  4J9B A;  1G83 A;  2AZV A;  1KQS A;  2VB6 A;  3I5R A;  2QG9 B;  3CQT A;  3DB4 A;  2KGT A;  2DL8 A;  1NJI C;  1JBM A;  2GFU A;  4ORZ A;  1VQM T;  2XD0 A;  5IXF A;  2IPO B;  2MI6 A;  3CBO A;  2CS7 A;  4JLI A;  1X2K A;  5C0M A;  1TUG B;  2XK0 A;  3OBW A;  3MO8 A;  3JCM V;  1W70 A;  3CXC S;  1PM3 A;  2X3X D;  1D0Z A;  3BDL A;  2P0K A;  4FW2 A;  3L2Q A;  2G3R A;  3OB9 A;  1SRM A;  2EVR A;  2XU8 A;  4ZGD B;  5CIU A;  3VS4 A;  3E9F A;  1TG0 A;  3FLG A;  2JJ9 A;  3CC2 Q;  3VS5 A;  3C4S A;  1I5L A;  4M7D A;  2MWO A;  1MMG A;  1YNZ A;  2JS2 A; 
#chains in the Genus database with same CATH homology
 1S72 T;  4N0A C;  1AHJ B;  2MAM A;  4XAX B;  3RKW A;  3HP9 A;  3X25 B;  4BI3 A;  5GAN 6;  2DZC A;  3OSS C;  4XTZ A;  3JAM E;  1WQ7 A;  4M7D G;  1R8O B;  5M9O A;  3URG A;  4XTX A;  3S3N A;  1U1T A;  1M1K U;  3S3O A;  1VQO T;  3CPF A;  3M4Y A;  3MEW A;  3LH0 A;  4A4E A;  3I55 T;  4RG8 A;  3AHU A;  1VQ6 A;  1NPR A;  3VKI A;  2ZGW A;  4C92 B;  3L2U A;  3INZ A;  4D6W A;  4J8O A;  4EMK A;  2Y90 A;  2R58 A;  5CQY A;  2KVQ G;  2KDS A;  2MWP A;  4KUI A;  5D6W A;  4R55 A;  3CC7 T;  4M7A C;  4N0A A;  2E41 A;  5GAN 8;  2GFA A;  2A7Y A;  2CYZ B;  3QHS A;  5GAN h;  1YJN T;  5LJ3 j;  4M7D F;  1I81 A;  1Q86 U;  4E7H A;  2LQ8 A;  4M77 E;  3FDR A;  3VU3 C;  4LD9 K;  1G3T A;  4J7I A;  3L2W A;  2D6F A;  2HQE A;  4HCZ A;  4RCB A;  2E10 A;  4L6V 5;  2RJF A;  4C5E A;  5J3B A;  4OGE A;  2M16 A;  2M1H A;  2QI2 A;  1Q82 C;  3FIF A;  1G3S A;  3RMQ A;  4KUD K;  2DD4 A;  4V2S A;  4BB7 A;  3WVE B;  3V8L A;  1G3W A;  4M7A A;  3OYL A;  2FVU A;  3LWH A;  3QPH A;  3JCM X;  2BIV A;  4A54 A;  1K73 C;  2KAF A;  1BYM A;  3QXE B;  2DEQ A;  3FRN A;  4M78 E;  1VQ4 T;  3HKS A;  3CCM A;  4A53 A;  3UDC A;  2L3R A;  5GAO r;  1Y7X A;  2RI5 A;  1YHQ T;  3OQ5 A;  4RMO A;  2XDD A;  3G6E T;  3OMG A;  1VQN A;  2YHT A;  2XDB A;  5GMK l;  2PVO B;  4MML A;  4DA4 A;  1KQ1 A;  2D0Q B;  1U1S A;  5EG2 A;  4C92 A;  4JS5 A;  5GAN j;  4C0D B;  3ZEH A;  5LJ5 g;  4LDX A;  1VQM A;  3CMA T;  3CCL A;  3EFR A;  1VQ8 T;  1ZHI A;  2LX9 A;  3ME9 A;  4E7L A;  4EDU A;  3N5B B;  1WPY A;  3EFS A;  4M75 B;  4C92 G;  3OA6 A;  5CAI A;  1M1G A;  2DTO A;  1XNI A;  4FU6 A;  1B34 A;  3OY9 A;  5LJ5 f;  2WAC A;  5CKF A;  4HT9 A;  3X20 B;  4PJO B;  4XU1 A;  3HL8 A;  4C8Q E;  1JB0 E;  2ZPI B;  1K9M U;  3P8B B;  3M53 A;  2JOY A;  1NZ9 A;  4TVR A;  5LJ3 d;  4JJN K;  3OYI A;  4YTL A;  5LJ5 e;  3G71 T;  1LNX A;  3NTI A;  2RHU A;  4ZGE B;  2LC4 A;  1Q81 C;  4A4G A;  2CZ1 B;  1QVG S;  3QII A;  4C0D C;  3FB9 A;  1QP3 A;  1XTD A;  4C92 F;  2IG0 A;  2LDM A;  5HY6 A;  1U8R A;  3GP8 A;  4F7U A;  1YJ9 A;  4MDX A;  4HCB A;  4P5N A;  1VQ7 T;  2LT4 A;  4JRI A;  3HFN A;  3VV0 A;  1WQW A;  4O5V A;  1P92 A;  4M78 B;  1VQ9 A;  1QVG A;  2CKK A;  3TEE A;  5DY9 A;  5GAO n;  3QSU A;  3GF5 A;  3BW1 A;  1HK9 A;  3E1S A;  1N8R C;  2D9T A;  2DKG A;  2DXT A;  2QQB A;  5GAO q;  4M77 C;  1NE8 A;  1TH7 A;  2K4Y A;  3NFC A;  4FIB A;  2DIQ A;  3TCJ A;  2YRV A;  3RUX A;  3JCM P;  1YI2 T;  4X9C A;  2PVG B;  3QZ9 B;  3RES A;  3UWN A;  3CC2 T;  4LDV A;  4BY6 B;  3JCM W;  2VGN A;  3CC4 T;  2LVM A;  4BDY A;  3BY7 A;  4M75 A;  2LCC A;  4ME7 A;  4PKC C;  1YJW A;  5GAN d;  3DLL A;  2V8I A;  3GLX A;  5IN1 A;  4Q5W A;  3SD4 A;  1NJI U;  3PGG A;  4EMK B;  2OTL T;  4M75 G;  2F5T X;  4OB2 B;  4XTU A;  4N4G A;  1VQO A;  1UEB A;  1KC8 U;  1XQH A;  1KQ2 A;  1IZ6 A;  4PLI A;  3I55 A;  4M77 A;  4OB1 B;  2C06 A;  4M78 C;  2CGH A;  2KMT A;  4C8Q B;  5CKD A;  3PFS A;  3OS1 A;  4J5Y A;  4PJO G;  2EYQ A;  4IUT A;  5GMK m;  5AYF A;  4LDY A;  3CCS T;  2RI2 A;  2Y4Y A;  3OYN A;  3A8G B;  3OYB A;  3CC7 A;  2E70 A;  3L2Z A;  2HBP A;  4JUV A;  3G4S A;  2RJD A;  3OYD A;  3CBM A;  4JRQ A;  5FRM A;  1YIJ T;  3A8M B;  3KBG A;  1VQP T;  4JDS A;  4HCC A;  2E64 A;  4BY6 C;  1YJN A;  2CZ7 B;  4GY5 A;  2ZPE B;  2RB6 A;  2K3Y A;  2LTO A;  1UB4 A;  4M7A B;  1ZBX A;  3C94 A;  4FSX A;  4M75 F;  2IVW A;  5I21 A;  4M78 A;  2QQ9 A;  1QP2 A;  3NTH A;  5FU6 C;  2F69 A;  2MMP A;  4II1 A;  2X4W A;  3SDZ A;  5GMK i;  2RI3 A;  2LQK A;  4PJO F;  1KHC A;  2RO0 A;  3PMT A;  5LJ3 e;  4C8Q C;  2KQW A;  5I2M A;  3L42 A;  1VIF A;  4OB3 B;  1G3Y A;  4PLL A;  5GMK e;  1VQ4 A;  1BKB A;  3CD6 A;  3P8H A;  1X75 C;  4VUB A;  4XK8 E;  3CBP A;  4QVZ A;  3CCQ T;  1YHQ A;  3G6E A;  5A0L A;  4JRP A;  5L8R E;  3JB9 G;  2MF2 A;  3QYG B;  1N6A A;  3CPW S;  2O4X A;  3G7Z A;  5CO7 A;  5GMK h;  2JTF A;  1B34 B;  1D3B B;  2X35 A;  3H8Z A;  3SB2 A;  1WJQ A;  2DPP B;  5D6Y A;  4C8Q A;  4FT2 A;  2P4T A;  3CMA A;  3A8L B;  4B9W A;  1HXD A;  1VQ8 A;  5GAM g;  1G5V A;  2EQJ A;  2PUK B;  2VC8 A;  3RKX A;  2EJF A;  3GOX A;  3CPW A;  3CME A;  1OZ2 A;  2JNG A;  1VQL T;  4B9X A;  1W4S A;  1WJR A;  4IUU A;  2XID A;  1UGQ B;  2PVD B;  4MZM A;  4RCC A;  3JCM g;  1BI2 A;  2ZZD A;  5GAM f;  2EQM A;  2WSC E;  2YLC A;  3LLR A;  3JB9 F;  2RA2 A;  5KH6 A;  3OW2 S;  1JJ2 S;  2OTJ T;  3C95 A;  4J6W A;  2E5Q A;  3Q1J A;  3VUZ A;  2RHI A;  2EWN A;  3MP1 A;  3HSB A;  4F7U B;  2KK4 A;  3V7C A;  3CCU T;  5J26 A;  4M7A G;  1KG1 A;  3G71 A;  2KSS A;  3QJ6 A;  5KE2 A;  3JCM f;  4CRI A;  3CCJ T;  4ELY C;  1M5Q 1;  4QVC A;  3SWN C;  3J80 E;  5GAM e;  5CK9 A;  4RKU E;  2CZ6 B;  1K8A C;  3HRT A;  5C6S A;  3OW2 A;  1JJ2 A;  1Q82 U;  2PQW A;  2RD1 A;  2X4J A;  2RJE A;  3QUI A;  5HKC A;  4E7I A;  1VQ7 A;  3JCM e;  1YCY A;  2BUD A;  2CZ0 B;  5KCO A;  1VQ5 T;  1X01 A;  2VV5 A;  4KUL A;  2PUO B;  4J6X A;  2LNV A;  1N9R A;  4BAC A;  3TRE A;  1M9S A;  3DLM A;  3X24 B;  4BI4 A;  1KD1 C;  2RHX A;  3A8H B;  4LDU A;  1YIT A;  1RL2 A;  1D3B A;  2VYT A;  3A5Z B;  4NL3 A;  1VQK A;  3FC3 A;  4M7A F;  1VQ6 T;  1M1F A;  5GAN 7;  4ZN3 A;  3M5A A;  3S3M A;  1YBY A;  4N4H A;  3JCM J;  3CC4 A;  4M77 B;  3OSV A;  4QW2 A;  3MEU A;  5CKH A;  2X4X A;  4NOY A;  4EMH A;  1M90 C;  1EIF A;  2NLU A;  5GAN 5;  2QXF A;  2XKO C;  3OBY A;  3OYC A;  5CKB A;  4DOW A;  3R6O A;  1PSE A;  1Y07 A;  4HA8 A;  4JLG A;  2AHJ B;  4NL2 A;  4C5I A;  3O8V A;  3JCM b;  5LJ5 h;  4IUR A;  5A2Q E;  3V7S A;  2K5F A;  2QQR A;  4CI0 C;  5GAO p;  1I8F A;  5FRN A;  3JCM c;  2XDP A;  2DXU A;  2QTX A;  4F7U G;  3OS0 A;  1NPP A;  4ELZ C;  3L2V A;  4HT8 A;  4PJO D;  3QO3 A;  2RHZ A;  3MP8 A;  2JUF A;  4OB0 B;  2QQS A;  1Q81 U;  1BI0 A;  2VXF A;  4XTV A;  3OYA A;  1FX7 A;  3ASK A;  1V29 B;  3JRZ A;  4IUQ A;  2L5Q A;  1MGQ A;  3QG1 A;  5D6X A;  1VQN T;  1FXX A;  2O01 E;  5GAN 3;  4NS5 A;  5FLX E;  3V8K A;  1S72 A;  3HFO A;  3LYI A;  3S6W A;  3CCR T;  2GQV A;  3HRS A;  2DK3 A;  2DXB A;  4X9D A;  5FU6 B;  4IUP A;  3UT1 A;  4C5H A;  3VJP A;  1QVF S;  3KUF A;  1BIA A;  3M59 A;  4F7U F;  5GAN 4;  2O4X B;  3J81 E;  3KXT A;  3CCL T;  2Y4X A;  1N8R U;  4M7D D;  1H3Z A;  1KHI A;  3RIR A;  2K5L A;  3M4G A;  5LJ5 j;  1K73 U;  1JRI A;  4PNO A;  3CCQ A;  1DJ7 B;  2LRQ A;  3CCE T;  3QYH B;  2EQK A;  2ZPB B;  3M58 A;  5LJ3 g;  4QQD A;  4M77 G;  1N27 A;  2EJG A;  4ZGJ B;  2XIC A;  4XU3 A;  3JSC A;  4UC4 A;  4C92 E;  5FU7 C;  4ZN1 A;  5KE3 A;  2QA4 T;  1QVF A;  2KY9 A;  4BE0 A;  1I4K 1;  2B8A A;  3LWI A;  2JN0 A;  1N9S A;  3CEY A;  2RK1 A;  3P8D A;  5LJ3 f;  4C0Z A;  3JB9 D;  4OF1 A;  5HK0 A;  3WVD B;  4X34 A;  4JRK A;  1WNL A;  3QJY A;  3QKJ A;  4J7F A;  1Q7Y C;  2FL7 A;  3VYH B;  2L8D A;  2RHY A;  4OMF B;  4O6J A;  4M7D C;  5A0D A;  4BE1 A;  5CCA A;  2EIF A;  1YJ9 T;  3L2R A;  4M78 G;  3M55 A;  3GNG A;  3QBY A;  3NTK A;  4LDW A;  2E1H A;  2XG8 D;  3MHX A;  5CQX A;  3RKY A;  4C0F A;  4M77 F;  3CCV T;  3X28 B;  2DZ9 A;  4QVD A;  1M1K C;  2OTJ A;  1VQ9 T;  1OYX A;  3E19 A;  2M0O A;  3HRU A;  5DLO A;  3X26 B;  3CCJ A;  2VGM A;  2K5I A;  5KCH A;  5LJ3 h;  1UGS B;  2WSF E;  1QVP A;  5GAN g;  5IAY A;  2K2V A;  3J7A F;  4EMG A;  4A4K A;  3LX7 A;  4BDZ A;  2JZ2 A;  2ZPH B;  2GCX A;  1Y71 A;  3ZFJ A;  2E65 A;  3SWN B;  1BIB A;  2K3X A;  4ZTJ A;  1M8V A;  1YJW T;  1UGR B;  4M78 F;  5GAN f;  2DD5 A;  2E6Z A;  1Q86 C;  2F5K A;  3PT9 A;  3OYE A;  4E7J A;  5IT9 E;  3F70 A;  4C8Q G;  2EJ9 A;  3ZBD A;  2R5A A;  2RK2 A;  4Y91 A;  1FWZ A;  3PMI A;  2EKO A;  2DTH A;  4BE2 A;  3OMC A;  1OZ3 A;  2R57 A;  4BI8 B;  1BI1 A;  2GF7 A;  5LJ5 d;  3OYG A;  3I56 T;  4XU0 A;  5GAN e;  3PIO A;  3FEO A;  2FHD A;  1M4Z A;  1O9S A;  4M75 E;  4MZT A;  4C92 D;  3OYF A;  4XU2 A;  3GPL A;  1ZQ1 A;  2RM4 A;  3QZ5 B;  5GAO l;  2HAX A;  3G4S T;  2QEX T;  3M56 A;  3MCA B;  2EAY A;  4PJO E;  3TU4 K;  1BI3 A;  2P0P A;  3BDU A;  4A4H A;  2DIG A;  2EQU A;  3EAE A;  2DAQ A;  2V8J A;  3MEV A;  3PNW C;  4A4F A;  3OS2 A;  4C8Q F;  4C5G A;  2P0Q A;  2VUB A;  2EFI A;  5A0G A;  4C0G A;  2A3L A;  4MZP A;  5GMK j;  3MP6 A;  3BFM A;  4HKE A;  3GIB A;  4L59 A;  4IUV A;  5GAM h;  3LGL A;  3LGF A;  3LW5 E;  1VQ5 A;  4J6Y A;  1WJS A;  2OAU A;  4C92 C;  1GXI E;  1VIE A;  5J39 A;  3JB9 J;  3SWN A;  4M7D E;  4MDW A;  4LD6 A;  3JCM h;  2RJC A;  2I2L A;  3CD6 T;  2HQX A;  1YI2 A;  2RH2 A;  3H6Z A;  4ATO A;  3MEA A;  3CC2 A;  3JB9 H;  4BUG A;  1K8A U;  2DJZ A;  1K9M C;  3FJP A;  2M9U A;  3HPW A;  5GAN 2;  2XHC A;  4PL6 A;  2V8K A;  2YLB A;  3CCR A;  2XI9 A;  3E9G A;  2HD0 A;  1VUB A;  4OP0 A;  2OTL A;  2DO3 A;  2X4Y A;  3MET A;  2ZPF B;  3T9N A;  4QQG A;  3JB9 I;  1KD1 U;  2QDY B;  3CCS A;  3CME T;  3ER0 A;  3PTA A;  5DM7 R;  4M75 D;  3CCE A;  4BD3 A;  4JS4 A;  4MMK A;  4XTW A;  1LOJ A;  5GAM j;  4Y28 E;  3DB3 A;  3HHT B;  3OYK A;  2QA4 A;  2HNI A;  4FL6 A;  4GLK A;  5CR2 A;  1VQP A;  3OYM A;  1YIJ A;  2VXE A;  3M9Q A;  1M90 U;  1Y96 B;  1KQS S;  1IRE B;  4WF2 A;  3VYG A;  4M77 D;  4OVA A;  4L5G A;  5FU7 B;  4Z02 A;  3CCM T;  2BKD N;  2PU9 B;  1WGS A;  5HK3 A;  3OYH A;  4E47 A;  2LCL A;  4RG2 A;  1RI0 A;  1W2B S;  1SSF A;  3C12 A;  2E6N A;  4N4I A;  4M7A E;  4E7K A;  3M54 A;  4R56 A;  1QW1 A;  5GAO m;  1KQS A;  4FM4 B;  3DB4 A;  4M75 C;  1PSF A;  1NJI C;  1JBM A;  3A8O B;  2K57 A;  3CCV A;  3RER A;  2GFU A;  4M7D B;  5LL6 S;  3V7R A;  4ZTF A;  1VQM T;  2XD0 A;  4KT0 E;  1KC8 C;  5I2S A;  3UPU A;  3OYY A;  1W2B A;  2FB7 A;  2MI6 A;  4M78 D;  2ZCF B;  4PJO C;  2ZPG B;  3CBO A;  2CS7 A;  4JLI A;  1YIT T;  1VQK T;  5C0M A;  1MHN A;  3JCM Q;  2XK0 A;  3M57 A;  3L1A A;  3OBW A;  4EPC A;  3WXM B;  1X6O A;  3MO8 A;  3JCM V;  2JTM A;  5CKE A;  3CXC S;  2H3J A;  3BDL A;  1UGP B;  2P0K A;  4PJO A;  2WSE E;  3QDR B;  2JVV A;  3SFM A;  4OGC A;  1VQL A;  4J83 A;  4KBM B;  1XOV A;  1Y96 A;  3OS5 A;  3RMS A;  4DOV A;  3I56 A;  2DXC A;  3L2Q A;  2DTI A;  2G3R A;  3GNF B;  3OB9 A;  5GAM d;  3CXC A;  2LT1 A;  3VUB A;  2XU8 A;  4C8Q D;  4ZGD B;  4XQ3 A;  5CIU A;  5FRO A;  1O75 A;  2FYK A;  3E9F A;  5DLQ E;  2QEX A;  3DKM A;  3CCU A;  3PIP A;  2E12 A;  3FLG A;  4FT4 A;  4XTY A;  3JCM d;  2QQA A;  2R5M A;  1H64 1;  4IKF A;  3C4S A;  3V8J A;  3OYJ A;  4DQ2 A;  1LJO A;  5CVI A;  1I5L A;  1OI1 A;  2DVE A;  4F7U E;  4M7D A;  2MWO A;  1Q7Y U;  4QQ6 A;  4M7A D;  4EMK C;  2L89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...