2JUFA

Nmr solution structure of parc cph domain. nesg target hr3443b/sgc-toronto
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
b'YGEYVQQTLQPGMRVRMLDDYEEISAGDEGEFRQSNNGIPPVQVFWQSTGRTYWVHWHMLEILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords p53-associated parkin-like cytoplasmic protein
publication title NMR Solution Structure of PARC CPH Domain.
rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 13
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2007-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11515 Cul7 Mouse development and cellular proliferation protein Cullin-7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2jufA00
3OW2S 3CC7T 1NJIU 3OW2A 3DLLA 1YJ9T 1VQNA 2JVVA 2JOYA 1XTDA 3I56A 1K73C 1VQ6A 3CCJT 3CCRT 1YJWT 1Q81U 3CCVA 3CCQA 1VQ4T 1NJIC 1VQ7A 1EIFA 3JAME 1SSFA 3G6EA 1VQ8T 3J7AF 3CPWS 1S72T 1Q81C 3CCLT 3LGLA 3LGFA 3CPWA 1YHQT 1Q86C 1VQ9A 3CC2A 1YIJA 3DB4A 4X34A 1YITT 5IT9E 3G71T 2LVMA 1KQSA 1VQMA 3I55A 1KD1C 3CC4T 3A5ZB 1VQKT 1QVGS 3CMET 1YJNT 3CCEA 2LCLA 1QVGA 3CXCS 3CXCA 1NZ9A 4CRIA 3CCST 1YI2A 1N8RC 1VQPA 2OTLT 1VQOA 5DM7R 2QA4T 1Q86U 3P8BB 5IAYA 3CCMT 1NPPA 2QEXA 3CD6T 1YJWA 2E70A 3OYYA 1BKBA 1KD1U 3ER0A 4ZN3A 5A2QE 3J81E 3KBGA 5DLQE 1VQLA 1Q82U 2OTJA 2G3RA 1VQNT 1VQ5A 1XNIA 3G4ST 3CMAA 5J3BA 2MI6A 3HKSA 3I56T 1VQ6T 1N8RU 1KQSS 1K9MC 2JUFA 2KVQG 3CCVT 5HY6A 3CCUA 2IG0A 1JJ2S 1Q82C 3PIOA 1JJ2A 1K8AC 1VQ7T 2MWPA 3CC7A 1W2BS 1X6OA 1YBYA 1W2BA 1YJ9A 1Q7YU 4TVRA 4YTLA 5FLXE 3G6ET 2JNGA 3CMEA 2DO3A 2KDSA 2L3RA 2XHCA 1M1KU 3CPFA 1VQ9T 3CC2T 3CCJA 3PIPA 3CCRA 1YIJT 1K9MU 1QVFS 5LL6S 4QQDA 1QVFA 2EIFA 2MWOA 1VQMT 1VQ4A 3I55T 1UEBA 4ZN1A 1Q7YC 5J26A 1K8AU 1M1KC 3CCET 1VQ8A 1S72A 3G4SA 1YI2T 1M90U 3CCLA 4RG2A 1KHIA 1YHQA 1VQPT 1VQOT 2LQ8A 3DB3A 2QEXT 3CCQT 1RL2A 1YITA 3G71A 3TREA 1KC8U 3CC4A 1VQKA 1VQLT 2OTJT 1M90C 1YJNA 1VQ5T 2E6ZA 3CMAT 3CCSA 1NPRA 2OTLA 2QA4A 1IZ6A 3J80E 3CCMA 1KC8C 3LH0A 1K73U 1M1GA 3CD6A 3CCUT 2CKKA
chains in the Genus database with same CATH superfamily
3EAEA 5A0LA 2DTOA 3DLLA 3H0IA 4OMQA 4C92E 2VYTA 1M27C 1G5VA 2DA9A 2VWFA 1AWOA 3FIFA 2E6NA 1M3BA 2E1HA 3OMCA 5CKFA 1Q81C 1D0XA 3E2UA 3ZL7C 3CMEQ 2DXUA 1TXQA 2VASA 5IH2A 2MAMA 4MDWA 1ZSZA 3X26B 3RR6A 2K3XA 2K2VA 1QVGA 2A3LA 5HCKA 5GANj 2PU9B 4M7AA 1WHKA 2V1RA 3CCLQ 2RM4A 5HKCA 1SHGA 3OQ5A 3M0TA 3JCMh 2ZPHB 2SRCA 4E7HA 4OB1B 3LWHA 1IRXA 2AIRB 4XU2A 2IG0A 3H0FA 3SHWA 3NPFA 3OSSC 1ZBJA 2V8KA 4XU0A 4C8QA 1P92A 5GAN3 1OPKA 2J6FA 3CPFA 5LJ5f 3HRTA 1QVFS 1GBRA 1VQ4A 2JT4A 2PVDB 1K8AU 3EGDA 3MP8A 3DKMA 3M0UA 4O5VA 1HD3A 1D1BA 1YHQA 1YN8A 3RESA 4E7IA 1WQWA 4M77B 1BK2A 2FG0A 3S3OA 2LZ6B 1V29B 4D6WA 4BDZA 3P8HA 1ZLMA 3MEUA 5GMKl 5KYWA 4PJOA 2KAFA 1K8AR 2LTOA 1JXMA 3MEAA 3LH5A 3QZ9B 2NYSA 4A63B 2IIMA 1UGRB 4J9HA 1DJ7B 4MZTA 1UFFA 1Q7YR 3VS5A 2NUZA 1LCKA 2HEQA 1KFZA 2JJ9A 1M1KR 2JW4A 2GFAA 4PK4A 1E7OA 1XOVA 3CPWS 1YJ9Q 1WGSA 1Q86C 1PD1A 4BY6B 4D8DA 3L2WA 2CSQA 4DBQA 1YITT 2DIGA 3OBWA 3OS1A 4J7IA 1D1AA 2VC8A 3VUZA 4M77D 3CXCA 1YI2A 5KYXB 2WSEE 4PJNA 3S3MA 1VQOA 1YWPA 5DM7R 2GFUA 2D8JA 4A4GA 3HSBA 2YWWA 4RTUA 2LCCA 5GAN4 2XKOC 5DLQE 4M7DB 3I35A 5LJ5j 4KH0B 3NTKA 2RI2A 1N8RU 3QKJA 2RJCA 3HP9A 3A8LB 2QQBA 3MP1A 2DFUA 3M53A 1JJ2S 3EG1A 3OSVA 4X9DA 2DL8A 2MWPA 1TUCA 3EG9A 1JQQA 4TVRA 2KDSA 3MP6A 5C6SA 2YDLA 1VYVA 2KSSA 5CKHA 5GMKi 1WLPB 1H3HA 3SWNA 3HPWA 4M77C 2RN8A 1IO6A 1N8RR 1BCOA 2X4XA 4FT2A 2R58A 1W6XA 1M3AA 1WQ7A 2GCXA 2OAWA 3G71A 1YIJQ 5CQYA 1AOJA 3NGPA 4XTWA 1OOTA 2CP5A 4VUBA 2F69A 2K79A 2YLBA 3REAB 1X01A 2KEAA 1RI0A 1JEGA 1FMVA 4M7DD 1M1GA 2EVRA 4M77G 3CC7T 1NJIU 3M54A 4LE9A 2RF0A 1XTDA 2CT4A 4RMOA 1VA7A 3MPUB 2DL5A 1GRIA 2QXFA 4EIKA 4BY6C 3R6NA 1WHHA 1U06A 2RJEA 4EMKB 1JU5C 3G6EA 4PFOA 2V8JA 3LGLA 1GBQA 4BE1A 2QAZA 2ZAEA 3OYGA 2D8HA 2DPPB 1C6VX 1I07A 1KD1C 3CC4T 1WXTA 2DXBA 1VQKT 2KYBA 2HKNA 4J9GA 1ZUYA 3JV3A 4IUTA 3QHSA 2M0YA 2K5LA 3GNFB 3HL8A 3MKDA 2JZ2A 2E64A 2CS7A 2E4HA 3RUXA 4M7DC 3P8BB 3CCMT 4ZTFA 2DK3A 1WDXA 2EQIA 5IN1A 2E70A 2P4TA 4J9BA 1PRMC 3BY7A 3EGXA 2V8IA 3QZ5B 5J3BA 2MYSA 1LPLA 3HKSA 3GPLA 1RAFB 4J5YA 3CCUA 4ELYC 2EGCA 3DLMA 2YUNA 2XDPA 3L1AA 3RMSA 3VKIA 2HAXA 2DO3A 4B9WA 4M7DG 2LQWA 1VQ9T 4DA4A 2HL5C 3T9NA 4Z88A 4IIMA 4OB3B 4XAXB 1YP5A 2KK4A 4EDUA 2LT4A 5KCHA 1FMWA 2SEMA 3LW5E 2DMOA 3G4SA 4RG2A 5CK9A 4E47A 2OAUA 1N9SA 3E9GA 2G6FX 3L2ZA 2CZ1B 1N9RA 3MO8A 2YUPA 5LJ3d 4JRQA 2RI5A 1WXBA 3VV0A 2A0FB 2OJ2A 2BUDA 1G83A 5KYUA 3CD6A 3PTAA 3QDFA 5I22A 1D3BB 1KK7A 4JJCA 4X9CA 5D6WA 1H641 2GBQA 4EMKC 1KQ2A 3E9FA 1OQKA 1BU1A 2RK1A 4DBHA 3GIBA 1TG0A 1VQ8T 3QWXX 5D6XA 3CC2A 4A4FA 1O75A 2WACA 1HXDA 5GANd 1ABOA 4FYYB 4Z8AA 3CMET 1MHNA 3CCEA 4L6V5 4EMHA 2MF2A 1KC8R 3JCMQ 2RQVA 3SDZA 1YITQ 2BTTA 3LWIA 4BUGA 2K57A 1VQ5A 3JCMd 1D0ZA 3VS3A 2H3EB 4M7DE 1WIEA 1B34B 3MEWA 1W2BS 1X2KA 2RQUA 2BIVA 2BE9B 4OF1A 5IHNA 2CYZB 1CKAA 1O9SA 2DBMA 1Y71A 2O4XB 4P5NA 2J7IA 5CKDA 2I0NA 4IIOA 1BYMA 4NS5A 3EFRA 1T0HA 3PT9A 2P0KA 1I5LA 4QW2A 3OYMA 1QMCA 2M02A 2VKNA 3MJXA 1OYXA 3INZA 2LQ8A 1BB9A 1WHGA 1K4US 4Z02A 3SFMA 4RCCA 3TQ7P 1VQLT 1D1CA 2YUQA 2OTJT 2K6DA 2QGFB 1YJNA 2QQAA 2RNAA 2DXCA 4N4GA 1AZEA 1PRLC 1X6GA 1JXOA 2ATCB 2LDMA 4QVCA 2EKOA 4IUUA 4M77A 3E19A 3JCMc 2HKQB 2KRMA 2CUBA 1K73C 4JJNK 2F5TX 4F7UG 2DRMA 2JM9A 2BZXA 1SEMA 4EPCA 1VQ7A 2PVOB 1U3OA 5GMKm 2DXTA 1LVKA 3CC7Q 2J6KA 1S72T 2V1QA 3LGFA 4A4KA 1UGVA 4PLIA 1BI2A 4FSSA 2M16A 2DBKA 3X24B 2K5IA 2QGGA 2XIDA 5CCAA 1ZUKA 2YLCA 4IUVA 1NPPA 1ZA2B 1YJWA 4MZPA 4IKFA 2O31A 2RO0A 2DETA 3CC4Q 1Y07A 2XMFA 1VQKQ 1ARKA 2EBPA 4JRKA 4AFUC 5IHKA 1PHTA 2H8HA 5KYXA 1X75C 2CH4W 2LNHB 3A8GB 3CCMQ 3CC2Q 4AFSC 4A54A 2JTMA 2CSIA 2ZPEB 1T3LA 2X35A 3O5ZA 1M1FA 4J9DA 4M7DA 3S6WA 5GAN2 2K9GA 1WHLA 3QIIA 1TH7A 2KRSA 5DY9A 4JPBW 1QVPA 4L5GA 1WJSA 2HBWA 2X9HA 1M90U 1MNDA 2FHDA 3OB9A 2KROA 2EFIA 3RKYA 3OYJA 1RL2A 2E3IA 1VQ9Q 3M59A 3UATA 4EMGA 3OYFA 4AMCA 2D9TA 3KXTA 1BCMA 2DM1A 4JRIA 3SEMA 4Z89A 3J80E 2QQ9A 2PNIA 3V8JA 4M4ZA 3OYDA 3X28B 2RHYA 3MEVA 3M5AA 4N0AC 4UC4A 5KYUB 2JVVA 1ZHIA 1WHMA 3TSWA 2JOYA 2RK2A 4V2SA 1RADB 3QWYA 3C95A 3I56A 2FB7A 1M4ZA 1Q81U 4PJOE 1PNJA 3QUIA 4M75F 3CCQA 1VQ4T 4HVUA 4QVZA 1SSHA 5LJ3h 2DZ9A 4MMLA 1SSFA 4QQ6A 2A7YA 1YHQT 1WYXA 3OYIA 3M0SA 3PNWC 1A0NB 1VQMA 3I55A 5J39A 3PGGA 4FIBA 4HCCA 4MZMA 1VQ8Q 4EMKA 3HRSA 5IAYA 1BI0A 1AVZC 1GCPA 1EZZB 1OULA 3OYLA 4BE2A 3ULRB 3CEYA 2E5QA 3JCMb 3M0RA 3TEEA 3JCMW 3J81E 3IQLA 1IHVA 4MDXA 4JLIA 2XDDA 4HCBA 2QK0A 5GAMj 1VOMA 1FWZA 5GANh 2KVQG 2L8DA 2L5QA 3LLRA 5FU6B 4JRPA 1Y0MA 1AWJA 4F7UF 4HVWA 1RLQC 5KYNA 1YCSB 3JSCA 2CT3A 3X20B 3OS0A 1GL5A 3OYEA 3VS0A 3A8MB 1HJDA 2COWA 2CZ0B 4R55A 3FB9A 1YI2T 2ED1A 1VQOT 1N27A 2I2LA 1UECA 4NL3A 4L59A 4ME7A 2QQSA 3OA6A 2P84A 4DBRA 1PSFA 3PMTA 4J9IA 3CCSA 2GQVA 4OMMA 2OTLA 2A28A 1FYNA 2FL7A 5I2MA 5GAMg 1R8OB 1PCXA 1QVFP 3M57A 1CSKA 2DF6A 4M78F 3OYBA 1ZA1B 2F1LA 3OW2S 1IHWA 4KUDK 1VQLQ 2KYMA 2OTJQ 3I5RA 5I11A 1IREB 3CCVA 2DL3A 3FJ5A 3CBPA 5I21A 2H3JA 5L23A 2JTFA 1UGQB 1ZQ1A 1D3BA 4BI3A 3O8VA 4CC4B 1HK9A 2E65A 2EAYA 3VS6A 4X34A 1VYTA 1U1TA 2LX9A 4KBMB 3G71T 2LVMA 2HCKA 3OBYA 4B6MA 5FWBA 5CKBA 4J6XA 3JB9G 2HSPA 4XTVA 2EPDA 3HHTB 1Y7XA 4O6JA 1M8VA 1Y57A 1S72Q 5GAOn 2AHJB 1PD0A 3V7RA 4ZN3A 2ZPGB 1RI9A 4AFZC 2ENMA 1WJQA 3JCMg 2RQRA 3CMAA 1UJ0A 3P8DA 1RAAB 3CPWP 4KGXB 1U8RA 5FU6C 7AT1B 4N4HA 4A4EA 1IGQA 3H6ZA 1K8AC 3NFCA 3OMGA 4CC2A 1OV3A 8AT1B 3G6ET 1XJWB 5LJ5h 1QCNA 2C06A 1G3SA 4XK8E 4XU1A 2OX7A 4KGZB 2E5KA 1K76A 2RQWA 3N5BB 2CREA 1Q7YC 4A4HA 3ASKA 1G2BA 1B34A 3RBBB 4ESRA 3TCJA 1M1KC 3EG0A 1KHIA 2GF7A 2M9UA 2EYWA 2O4XA 1JJ2P 4LD6A 5KCOA 4GLKA 1BIBA 3URGA 4HT9A 2DL7A 2QA4A 2AK5A 3CCUT 1QCOA 3THKA 5GJVB 5KYYB 1AWWA 2FRYA 2DYIA 1VQNA 3GBQA 3H0HA 3UPUA 3FJPA 3AHUA 1PSEA 2EGEA 1I0CA 1OU8A 5KE3A 3C4SA 3QJYA 1EIFA 4HXJA 2RQTA 2F5KA 2R5AA 2VGMA 1KHCA 3CQTA 1OX8A 3CBMA 2X4YA 1G3WA 1VQ4Q 4N0AA 1JBMA 1QVGS 3NTIA 1NZ9A 1N8RC 1VQPA 1QLYA 1WXUA 4OGEA 2QEXA 1YHQQ 3CD6T 3VS4A 3KFVA 4J9FA 4GLMA 2DNUA 1Y96B 3GOXA 3EFSA 2LCSA 2CZ6B 2GGRA 3TVTA 2K4YA 3WVEB 1WJRA 2F2VA 1NJIR 1NM7A 5FWCA 2DD5A 2IPOB 2MIOA 1YFNA 1R77A 3OYCA 4FL6A 4CC3A 5FRNA 3CC2T 1GFCA 3PIPA 3CCRA 3PVLA 4M75B 4RTYA 5CR2A 1AT1B 3M0PA 1QWEA 1UE9A 3V7SA 4PKCC 1M8MA 3KUFA 2XICA 2AKKA 3CCET 2ZCFB 2EYXA 3VS1A 4HA8A 2X3WD 2XK0A 5IHIA 3TREA 2PVGB 3JB9F 2EYZA 4E7SA 1CKBA 4RCBA 1VQ5T 4BD3A 2CUDA 4C0FA 1R0CB 2YRCA 4JZ3A 1KJWA 2DIQA 1SF9A 1YI2Q 1BI3A 1UGPB 2LJ1A 2RH2A 4PL6A 1VQOQ 4LUDA 4WCIA 1NE8A 3M58A 1N5ZA 2GTOA 2CP3A 4LDXA 5GAN5 3OYAA 1I8FA 4LXCA 1VQ6A 2CGHA 4Y92A 3WXMB 4M77E 2QI2A 4F7UB 4M75D 2LNVA 2VVKA 4XTYA 1PKTA 2DRKA 1RAGB 3L42A 5DLOA 5D7UA 4CC7A 4FW2A 1W4SA 2DVJA 3UA7A 4AG2C 1RAHB 2FZGB 4JS4A 1YJNT 3CXCS 2DEQA 3VRZA 3OYHA 4ANJA 3BE3A 3G71Q 4DOWA 5GAN7 1U5SA 4PJJA 4E2FB 2RJDA 5I2SA 1KG1A 5AT1B 2EWNA 5FW9A 5GAOl 2MI6A 2J05A 4M78B 3PIOA 4B9XA 1VQ7T 4M75C 1UTIA 4BI4A 4C5EA 1HSQA 2RMOA 2AKLA 1B3QA 1M30A 3H41A 4BI8B 2AZSA 1JRIA 1QKXA 2K7AA 1K9MU 2D6FA 4KUIA 1S1NA 2KRNA 1I5OB 1H3ZA 1GXIE 2C0TA 2COYA 3G6EQ 3JCMJ 4J7FA 2B8AA 1M2OA 1NLPC 1NEGA 1FMKA 4M75G 2IVWA 1W2BP 3CBOA 4DEXA 1K9MR 3QSUA 1OPLA 4OGCA 5GAMe 4FYWB 1KC8C 1K73U 4JUVA 1VIEA 4K11A 5CVIA 3LYIA 2CKKA 2J06A 2DEUA 2DILA 4AT1B 3JCMP 4M78D 2VGNA 1WZOA 1SKUB 1YCYA 2DX1A 2GQIA 3S3NA 3EG3A 3CCUQ 3RNJA 1WNLA 2VV5A 4JDSA 1WA7A 2RI3A 4E7LA 4RG8A 2CP7A 4C92D 1PG5B 3DB4A 5IT9E 2AZVA 2O2OA 4X1VA 3V8LA 4JJDA 1RAEB 2FEIA 2LMJA 1SRMA 4C8QG 2JS0A 2LCLA 1ABQA 4CRIA 4OB2B 2A36A 1FXXA 3G4SQ 1LNXA 3RMQA 5GMKj 3VUBA 5KH6A 4J6YA 1MMNA 3KBGA 4M78C 2YXYA 1MGQA 2HQEA 3I56T 2EGAA 2A37A 2EQMA 4J8OA 5FROA 1MV0B 1NEBA 2PUOB 1Q82C 3CD6Q 1ZX6A 5FLXE 8ATCB 3CMEA 1SRLA 1K9AA 3JB9J 4XU3A 5LJ5d 2OI3A 2EYYA 2F2WA 2FYKA 2Z0WA 5GAOp 1QVFA 2XI9A 1VQMT 3I55T 1UEBA 4M78G 2ESWA 2EQUA 3OS2A 2XDBA 4JS5A 1I1JA 3CCLA 4F17A 2JMCA 2EQKA 3VJPA 3VYGA 1X27A 2DZCA 4C92G 2EJGA 1EX4A 4KH1B 3CCEQ 5GAMf 3QPHA 2EKHA 1N6AA 3BFMA 1X6BA 1MUZA 4FYXB 3BDUA 3G1JA 1OEBA 2QTVA 1IXDA 3UDCA 4J9CA 1VQ5Q 3PFSA 1G8XA 4XQ3A 4II1A 1G3YA 1X2QA 5KYYA 3FEOA 5FRMA 2E3HA 3CPWA 1J3TA 3BW1A 4F7UE 1M2VB 2KR3A 5EC7A 1M90R 3A5ZB 3VS2A 4PFPA 4E7JA 2RA2A 1UJYA 2L3PA 1MMDA 1TS9A 3CCST 2OTLT 1R0BG 4OP0A 4WTOB 1QKWA 5GAOr 2RHZA 4QQGA 4DEYA 2VB6A 4FU6A 5EG2A 1AD5A 2ZGWA 1Q95G 3EH1A 1YJNQ 1KQSS 2O88A 2W10A 2YHTA 3CCVT 2KY9A 1UHFA 3I5SA 2PTKA 3L2QA 4XTUA 1JJ2A 3QYHB 1UDLA 4RTXA 2RJFA 1YJ9A 1Q81R 3PVQA 4Q5WA 2HDAA 4M7AF 1U1SA 2XHCA 3CCJA 5GAMh 1VIFA 1Y96A 2EIFA 1KQ1A 2X3XD 4ZN1A 2KT8A 5LJ3j 4ORZA 2GNCA 1YWOA 2NUTA 1VQ7Q 2DE0X 2K3BA 4RUGA 2XD0A 2ZPIB 3MCAB 1AWXA 2P0PA 4C5IA 3F70A 1WHJA 4C8QF 4M75A 2HMAA 2K2MA 2E6ZA 3JB9D 3CMAT 4HCZA 2QASA 1TU0B 2MCNA 2FPFA 6AT1B 3QG1A 1YJWQ 2FZCB 2LJ3A 4LDWA 2KBTA 1WPYA 4BDYA 5IXFA 1QP2A 2P4RA 4RTTA 1SHFA 2FZKB 2KNBB 3G7ZA 1C0MA 2ECZA 1SPKA 1QWFA 5A0DA 1AZGB 5LJ3g 2J6OA 3QJ6A 2RHXA 4PJOF 4DQ2A 1YIJA 4R0KA 2L0AA 3A98A 3ZEHA 2VXFA 2QG9B 4KGVB 2QDYB 3OYNA 2L3QA 1ZUUA 3OW2P 1X69A 4QVDA 2YRDA 3RKWA 3EHRA 1B7TA 4PNOA 4F7UA 2QA4T 1Q86U 4N4IA 1E6GA 2CP6A 1Z9QA 2JS2A 1G3TA 4C92F 1FX7A 1B07A 1VQNT 1XNIA 4C5GA 1BIAA 2AT1B 4LD9K 2O9VA 1ZBXA 1VYUA 2WSFE 2COZA 2YUOA 4Y28E 5GAN6 1MMGA 5GANg 2DYBA 4OMOA 2EW3A 1X6OA 1YBYA 1Q7YU 1Q86R 2FPDA 2L3RA 3FDRA 1M1KU 1QCFA 3I56Q 1UHCA 5LL6S 2ROLA 2E41A 3CCQQ 4M78A 5GAOm 3PE0A 2QYZA 3JB9H 1JB0E 1OZ3A 1VQPT 4C0DB 2QEXT 1PWTA 2CH4A 1VQMQ 1MMAA 3I55Q 4FYVB 3MHXA 4PJLA 5CKEA 2KXCA 2NUPA 4C92A 2DTIA 3L2RA 3FLGA 2M0OA 3FC3A 1E6HA 2A08A 3UF4A 3SD4A 3CCJQ 3QYGB 2HL3A 5ECAA 2XU8A 3I9QA 3CCRT 1LOJA 4HKEA 4BB7A 2M1HA 1GCQA 4FCYA 3HFOA 1QQJA 2CDTA 3ZBDA 3HTRA 3M4GA 4Y91A 1AHJB 2XG8D 3QXEB 4FW1A 1MV3A 3M55A 4E7KA 1W1FA 4IUQA 5GAN8 3EFOB 3Q1JA 5AYFA 3LX7A 2NWMA 1KSWA 5CO7A 2HBPA 3EG2A 2DVEA 3OS5A 2NLUA 2ZPBB 1JO8A 1KD1U 1W70A 2ZZDA 3G4ST 3OY9A 1VQ6T 3RERA 3CCSQ 2GTJA 2OTLQ 1I4K1 2FO0A 3C12A 2KMTA 2MK5A 4IUPA 1W2BA 4YTLA 1QVGP 3JRZA 2JTEA 3VYHB 3V8KA 4ELZC 5LJ5g 2RD1A 1KD1R 1WI7A 1KIKA 3CCVQ 1NBEB 4DBFA 3C94A 5GAOq 2PZ1A 3HRUA 1D09B 4C0DC 1C1AA 4RTVA 2HSEB 2KQWA 2NUTB 1YITA 3UA6A 4XTZA 1TUGB 5GMKe 3EHQA 3M9QA 1D0YA 1UG1A 3QBYA 2Y4YA 1UB4A 4DOVA 4GY5A 1NYFA 2FPEA 1H92A 3WVDB 4OB0B 2RHIA 4FM4B 2E12A 5A0GA 4BACA 1HYOA 4NL2A 4ZNXA 1AEYA 3CMAQ 3VS7A 1ZSZB 3A8OB 2M51A 2KXDA 1NJIC 3E1SA 4IURA 4J9EA 4OMNA 4M7AB 4AG1C 3NTHA 3OYKA 3RIRA 2JXBA 1RLPC 3H9NA 3SB2A 2ZPFB 4HVVA 2EQJA 3REBB 2W0ZA 4NOYA 4LNPA 1OI1A 5FU7B 4E6RA 5KE2A 4C8QB 1T0JA 4FSXA 3ER0A 3ZFJA 5A2QE 1WFWA 1M2VA 2O9SA 4OMLA 3TU4K 3L2VA 1UGSB 4OMFB 4C5HA 2BKDN 3AT1B 3EGDB 2QA4Q 3NMZC 4R56A 2K5FA 3U23A 3CC7A 3A1PA 1MNEA 1IGUA 3CXCP 1VQNQ 4LN2A 3FRNA 2RB6A 3D7SB 5GAMd 4QQDA 4M7AD 2MWOA 5J26A 4LDVA 2LX7A 3EH2A 2QDLA 2HD0A 5KYWB 2LRQA 4CI0C 4PJOB 2KI7A 2K3YA 3JCMX 4PJMA 2EJFA 1M3CA 3NHNA 1LJOA 1KC8U 3CC4A 1VQKA 4QKUA 1NYGA 3PMIA 4C8QD 3JCMV 3C0CA 1GFDA 2ROTA 3CCMA 3LH0A 1IB8A 1VQPQ 2KE9A 2NUPB 4C92B 2QEXQ 3M56A 4GBQA 2D0NA 3EGUA 1T3SA 1ZSZC 2LQKA 1RUWA 2EYQA 5M9OA 2JN0A 3L2UA 2B86A 1V1CA 2LJ0A 1YJWT 4M7AC 2BZYA 4ZGDB 1NG2A 2L3SA 1QW1A 3UT1A 2DTHA 3JAME 2HNIA 4PFZA 5LJ3e 3J7AF 1M5Q1 2FVUA 2DJZA 3GP8A 3CCLT 4F04B 1VQ9A 5D6YA 3CCRQ 1KQSA 2WSCE 5FU7C 4M77F 4PJOD 3A8HB 5HK0A 2R5MA 4C8QC 2VUBA 2O01E 2R57A 2L2PA 3M0QA 1I81A 4D8KA 4M7AG 3EG9B 4ZGJB 3UWNA 2MOXA 5GJWB 4ZGEB 1Q82U 1K73R 4BE0A 3BDLA 1K9MC 2DERA 5CIUA 3QDRB 3SWNB 5GANe 1QP3A 2LQNA 4PLLA 5GMKh 3GF5A 4KRTA 2DL4A 2VXEA 2C0IA 4J6WA 1ACMB 9ATCB 2HZYA 4LUEA 4RKUE 2YRVA 5HK3A 2LP5A 1X43A 1VQ6Q 4WF2A 4PJOC 3VU3C 1M9SA 1Q82R 4QT7A 4A53A 1ZSGA 2D0QB 2E10A 2V26A 2D1XA 4J83A 2Y4XA 1VUBA 3JCMe 2KGTA 1VQ8A 3H8ZA 2MPXC 2DKGA 1RAIB 3RKXA 3CCQT 3DB3A 3R6OA 2P0QA 2CZ7B 2YSQA 3VRYA 4C92C 4M7DF 4FT4A 3GNGA 3GLXA 1NPRA 2DD4A 1RABB 4PJOG 4OMPA 1IZ6A 1OZ2A 4RTZA 1OX9A 4XTXA 4MMKA 1NLOC 1TSFA 2MMPA 4M75E 3OW2A 1YJ9T 2BE7D 2JM8A 2F2XA 2L89A 4HCKA 2CP0A 3CCJT 1TUDA 1H8KA 1GCQC 4F16A 2LT1A 3X25B 4C0GA 4RTWA 2CP2A 5LJ3f 1Z9ZA 3V7CA 1F1BB 2C0OA 2QTXA 1K1ZA 4KT0E 4ATOA 4M7AE 2LC4A 3EGXB 1YNZA 2BZ8A 1EFNA 4HT8A 2DAQA 4E7ZA 1PM3A 1TTHB 1PKSA 1OU9A 2RHUA 4F14A 3OYYA 1TOVA 1BKBA 2DLPA 2ABLA 1VQLA 2OTJA 2G3RA 3SWNC 4C8QE 4JZ4A 2FRWA 5L8RE 3HFNA 3EFOA 1BBZA 2ED0A 1K0XA 2KT1A 2JUFA 3QO3A 5C0MA 5GANf 5HY6A 1WX6A 3ME9A 2HQHA 2PUKB 4JLGA 3RDVA 3TSZA 2JNGA 4ZTJA 1YIJT 2PQWA 5LJ5e 2HQXA 1BI1A 4OVAA 4LDUA 1XQHA 3JB9I 1PC0A 4C0ZA 3JCMf 2YT6A 3META 1RACB 2X4JA 1S72A 4LDYA 4AFQC 2EJ9A 5CAIA 4JJBA 2QQRA 1UUEA 1KQSP 2X4WA 1V76A 1SG5A 2DJQA 2X51A 4M78E 3M4YA 5CQXA 1M90C 1TWBA 2RPNA 4KULA 1K0SA 2JMAA 2Y90A 5IXBA
chains in the Genus database with same CATH topology
3EAEA 3QYGB 1NE8A 3M58A 4M77A 5A0LA 3E19A 2DTOA 3JCMc 3DLLA 4LDXA 5GAN5 3OYAA 1I8FA 2XU8A 4C92E 1K73C 1VQ6A 2VYTA 3CCRT 1LOJA 2F5TX 4JJNK 2CGHA 4F7UG 3WXMB 4HKEA 1G5VA 4BB7A 2M1HA 4EPCA 1VQ7A 2PVOB 3FIFA 3HFOA 4M77E 2E6NA 5GMKm 3ZBDA 2QI2A 4F7UB 4M75D 2E1HA 5CKFA 3OMCA 2DXTA 2LNVA 4XTYA 1S72T 1Q81C 3L42A 3M4GA 5DLOA 3LGFA 4Y91A 1AHJB 2XG8D 3QXEB 4A4KA 2DXUA 4PLIA 1W4SA 1BI2A 3M55A 2M16A 4E7KA 4IUQA 2MAMA 5GAN8 4MDWA 4JS4A 3X26B 3SD4A 3X24B 2K5IA 2K3XA 2K2VA 2XIDA 1YJNT 5CCAA 3Q1JA 1QVGA 5AYFA 3LX7A 3CXCS 2A3LA 2DEQA 2YLCA 5GANj 3OYHA 2PU9B 4M7AA 5CO7A 2HBPA 4IUVA 1NPPA 2DVEA 2RM4A 3OS5A 2NLUA 1YJWA 4MZPA 4IKFA 2ZPBB 5HKCA 1KD1U 2RO0A 4DOWA 5GAN7 3OQ5A 2ZZDA 3JCMh 1Y07A 2RJDA 5I2SA 2ZPHB 1KG1A 3G4ST 2EWNA 5GAOl 2MI6A 3OY9A 4JRKA 4E7HA 1VQ6T 3RERA 4OB1B 3LWHA 4M78B 1I4K1 3C12A 2IG0A 4XU2A 1X75C 3A8GB 3PIOA 4B9XA 1VQ7T 3OSSC 2KMTA 4A54A 4M75C 2V8KA 2JTMA 2ZPEB 4XU0A 4IUPA 4BI4A 4C8QA 1P92A 1W2BA 5GAN3 2X35A 4YTLA 4C5EA 1M1FA 3JRZA 3VYHB 4M7DA 3CPFA 3S6WA 3V8KA 4BI8B 4ELZC 5LJ5g 5LJ5f 5GAN2 1JRIA 2RD1A 1K9MU 3HRTA 1QVFS 2D6FA 3QIIA 1TH7A 4KUIA 1VQ4A 5DY9A 2PVDB 3C94A 1QVPA 4L5GA 1WJSA 1K8AU 5GAOq 3HRUA 4C0DC 3MP8A 3DKMA 4O5VA 1H3ZA 1GXIE 1M90U 1YHQA 3JCMJ 2FHDA 3OB9A 4J7FA 3RESA 4E7IA 1WQWA 2B8AA 2EFIA 2KQWA 4M77B 1RL2A 3RKYA 4XTZA 3OYJA 1YITA 3M59A 3S3OA 4EMGA 1V29B 4M75G 5GMKe 4D6WA 3OYFA 2D9TA 2IVWA 3M9QA 3KXTA 4BDZA 3P8HA 3MEUA 3QBYA 2Y4YA 3CBOA 3QSUA 1UB4A 5GMKl 4DOVA 4JRIA 4OGCA 4GY5A 5GAMe 3J80E 2KAFA 1KC8C 1K73U 4JUVA 2QQ9A 3V8JA 1VIEA 4PJOA 2LTOA 5CVIA 3MEAA 3LYIA 3OYDA 2CKKA 3WVDB 3X28B 4OB0B 2RHYA 2RHIA 3QZ9B 4FM4B 3MEVA 3M5AA 4N0AC 2E12A 4UC4A 5A0GA 2JVVA 1ZHIA 4BACA 4M78D 3JCMP 2JOYA 2RK2A 1UGRB 4V2SA 3C95A 2VGNA 4NL2A 3I56A 2FB7A 1M4ZA 1DJ7B 4MZTA 1YCYA 1Q81U 4PJOE 3S3NA 3QUIA 4M75F 3A8OB 3CCQA 1VQ4T 1NJIC 3E1SA 4IURA 4QVZA 5LJ3h 2DZ9A 4MMLA 2GFAA 1SSFA 4M7AB 1WNLA 2VV5A 3NTHA 1XOVA 4JDSA 3OYKA 2RI3A 5GAN4 4QQ6A 2A7YA 3CPWS 4E7LA 1YHQT 1WGSA 1Q86C 4BY6B 4RG8A 3RIRA 4C92D 3DB4A 3OYIA 3L2WA 1YITT 5IT9E 3PNWC 2DIGA 3OBWA 3I55A 3SB2A 1VQMA 3OS1A 2ZPFB 3V8LA 5J39A 3PGGA 4J7IA 2EQJA 2VC8A 3VUZA 4FIBA 4C8QG 4NOYA 2LCLA 1OI1A 4M77D 4HCCA 4MZMA 3CXCA 5FU7B 1YI2A 4CRIA 4OB2B 2WSEE 5KE2A 3S3MA 4EMKA 5DM7R 1VQOA 1FXXA 3HRSA 5IAYA 2GFUA 1LNXA 1BI0A 4C8QB 3RMQA 3OYLA 4BE2A 5GMKj 4A4GA 3VUBA 3CEYA 3HSBA 2E5QA 3JCMb 2LCCA 5KH6A 4FSXA 2XKOC 3ER0A 4J6YA 3TEEA 3KBGA 5DLQE 3ZFJA 5A2QE 3J81E 4M78C 3JCMW 4M7DB 3TU4K 1MGQA 2HQEA 5LJ5j 3L2VA 4MDXA 4JLIA 2XDDA 4HCBA 1UGSB 5GAMj 3I56T 1FWZA 3NTKA 4OMFB 4C5HA 2RI2A 1N8RU 3QKJA 2EQMA 2RJCA 3HP9A 2BKDN 2KVQG 2L8DA 2QQBA 3A8LB 2L5QA 5GANh 4J8OA 3MP1A 5FROA 2PUOB 3M53A 1JJ2S 1Q82C 3OSVA 4R56A 4X9DA 2MWPA 3LLRA 2K5FA 3CC7A 4TVRA 5FU6B 4JRPA 5FLXE 3CMEA 4F7UF 2KDSA 3MP6A 3JB9J 5C6SA 4XU3A 5LJ5d 3FRNA 2FYKA 2RB6A 3JSCA 2KSSA 5GAMd 5CKHA 5GMKi 5GAOp 1QVFA 4QQDA 4M7AD 2MWOA 2XI9A 1VQMT 3I55T 3X20B 3OS0A 1UEBA 4M78G 5J26A 3OYEA 4LDVA 3A8MB 3SWNA 3HPWA 4M77C 4PJOB 2HD0A 2EQUA 2LRQA 3OS2A 4CI0C 2CZ0B 2X4XA 4JS5A 4R55A 2K3YA 2XDBA 4FT2A 2R58A 3FB9A 1YI2T 3JCMX 3CCLA 2EJFA 1WQ7A 1N27A 2GCXA 2I2LA 1VQOT 4NL3A 4L59A 4ME7A 2QQSA 3G71A 5CQYA 3OA6A 1LJOA 1KC8U 2EQKA 3CC4A 3VJPA 4XTWA 3VYGA 1VQKA 4VUBA 2F69A 1PSFA 3PMIA 2DZCA 3PMTA 4C92G 2EJGA 3JCMV 4C8QD 2YLBA 1X01A 3CCSA 2GQVA 2OTLA 1RI0A 5GAMg 2FL7A 3QPHA 5I2MA 5GAMf 3CCMA 1R8OB 1N6AA 3LH0A 1M1GA 3BFMA 4M7DD 3M57A 3BDUA 4C92B 4M78F 3OYBA 4M77G 3M56A 3OW2S 3CC7T 1NJIU 3M54A 4KUDK 2LQKA 3UDCA 2EYQA 5M9OA 2JN0A 1XTDA 3L2UA 4RMOA 1IREB 3PFSA 1YJWT 4M7AC 4XQ3A 3CCVA 5I21A 4ZGDB 3CBPA 2QXFA 1QW1A 2H3JA 3UT1A 4II1A 4BY6C 1G3YA 2DTHA 2HNIA 3JAME 2JTFA 1UGQB 1ZQ1A 5LJ3e 2RJEA 1D3BA 4BI3A 4EMKB 3O8VA 3G6EA 3FEOA 3J7AF 1M5Q1 5FRMA 2FVUA 2DJZA 3GP8A 1HK9A 2V8JA 3LGLA 3CPWA 3CCLT 4BE1A 2E65A 1VQ9A 2EAYA 3BW1A 5D6YA 4X34A 1U1TA 3OYGA 2LX9A 4KBMB 4F7UE 2LVMA 3G71T 1KQSA 2WSCE 2DPPB 4M77F 5FU7C 3OBYA 3A8HB 3CC4T 1KD1C 4PJOD 5HK0A 2DXBA 3A5ZB 1VQKT 2R5MA 5CKBA 4J6XA 4C8QC 3JB9G 4IUTA 2RA2A 3QHSA 4E7JA 2VUBA 2K5LA 2O01E 2R57A 3GNFB 3HL8A 4XTVA 2JZ2A 3CCST 1I81A 2E64A 2CS7A 3HHTB 1Y7XA 4O6JA 3RUXA 2OTLT 4M7AG 4M7DC 1M8VA 3P8BB 4OP0A 3CCMT 4ZTFA 2DK3A 5IN1A 2E70A 4ZGJB 5GAOn 2P4TA 3UWNA 2AHJB 5GAOr 2RHZA 3BY7A 4QQGA 3V7RA 4ZGEB 4ZN3A 2ZPGB 1Q82U 4FU6A 2V8IA 5EG2A 1WJQA 4BE0A 3JCMg 2ZGWA 3QZ5B 5J3BA 3CMAA 3BDLA 3P8DA 3HKSA 1KQSS 1U8RA 1K9MC 5FU6C 3GPLA 5CIUA 2YHTA 3CCVT 2KY9A 3QDRB 3SWNB 4J5YA 5GANe 4N4HA 3CCUA 4ELYC 4A4EA 4XTUA 1QP3A 3H6ZA 3L2QA 3DLMA 3QYHB 2XDPA 3NFCA 4PLLA 3OMGA 5GMKh 3GF5A 3L1AA 1K8AC 3RMSA 2RJFA 1YJ9A 2VXEA 3VKIA 4J6WA 4Q5WA 3G6ET 2HAXA 2DO3A 4RKUE 4B9WA 4M7AF 1U1SA 4M7DG 2XHCA 2YRVA 5LJ5h 1VQ9T 5HK3A 3CCJA 1JJ2A 2C06A 1G3SA 5GAMh 4DA4A 4XK8E 1VIFA 4WF2A 1Y96A 4XU1A 4PJOC 3VU3C 1M9SA 2EIFA 1KQ1A 3T9NA 3N5BB 4A53A 4ZN1A 4A4HA 2D0QB 2E10A 5LJ3j 1Q7YC 4J83A 3ASKA 4OB3B 4XAXB 2Y4XA 1VUBA 2KK4A 2LT4A 1B34A 4EDUA 5KCHA 3TCJA 3JCMe 1M1KC 1VQ8A 2XD0A 2ZPIB 3LW5E 3MCAB 2P0PA 3H8ZA 4RG2A 1KHIA 2DKGA 4C5IA 4E47A 5CK9A 2OAUA 3RKXA 3F70A 2GF7A 3CCQT 3DB3A 3R6OA 2M9UA 2P0QA 1N9SA 2O4XA 3E9GA 2CZ7B 3L2ZA 4C8QF 2CZ1B 4M75A 1N9RA 4LD6A 5KCOA 3MO8A 4GLKA 2E6ZA 1BIBA 5LJ3d 4JRQA 4C92C 3JB9D 3CMAT 4M7DF 4FT4A 3URGA 3GNGA 4HT9A 2RI5A 3GLXA 1NPRA 4HCZA 2DD4A 3VV0A 2QA4A 4PJOG 1IZ6A 1OZ2A 4XTXA 2BUDA 3CD6A 4MMKA 3CCUT 3PTAA 1D3BB 3QG1A 2MMPA 4M75E 4X9CA 3OW2A 4LDWA 1YJ9T 1VQNA 3UPUA 3FJPA 1WPYA 3AHUA 2L89A 4BDYA 1PSEA 5D6WA 1H641 3CCJT 1QP2A 4EMKC 1KQ2A 3E9FA 5KE3A 3G7ZA 2LT1A 3X25B 4C0GA 3C4SA 2RK1A 3QJYA 5A0DA 1EIFA 3GIBA 5LJ3g 5LJ3f 3V7CA 1VQ8T 3QJ6A 2RHXA 5D6XA 2QTXA 4KT0E 2F5KA 4PJOF 3CC2A 4DQ2A 2R5AA 1YIJA 4ATOA 4A4FA 2VGMA 1KHCA 1O75A 4M7AE 3ZEHA 2LC4A 2WACA 3CBMA 2VXFA 1HXDA 5GANd 2X4YA 2QDYB 3OYNA 1G3WA 4N0AA 4HT8A 2DAQA 1JBMA 1QVGS 3CMET 4QVDA 1MHNA 3CCEA 4L6V5 4EMHA 3NTIA 3RKWA 1NZ9A 2MF2A 3JCMQ 1N8RC 1VQPA 4F7UA 4PNOA 4OGEA 2QA4T 1Q86U 4N4IA 2QEXA 3CD6T 2RHUA 3OYYA 3SDZA 1G3TA 1BKBA 4C92F 1VQLA 2OTJA 1FX7A 3LWIA 2G3RA 3SWNC 4BUGA 2K57A 1VQ5A 1XNIA 4C8QE 3JCMd 1VQNT 5L8RE 4C5GA 1Y96B 3HFNA 1BIAA 3EFSA 3G4SA 3GOXA 4LD9K 1ZBXA 2CZ6B 2K4YA 2JUFA 1WJRA 3WVEB 4M7DE 2WSFE 4Y28E 2DD5A 3QO3A 5GAN6 5C0MA 5GANg 5HY6A 5GANf 1B34B 3ME9A 3MEWA 2PUKB 4JLGA 1W2BS 1X6OA 1YBYA 1Q7YU 3OYCA 2BIVA 4FL6A 2JNGA 4OF1A 2CYZB 1O9SA 2L3RA 3FDRA 1M1KU 5FRNA 4ZTJA 3CC2T 1Y71A 2O4XB 4P5NA 3PIPA 5CKDA 2PQWA 5LJ5e 2HQXA 4M75B 3CCRA 1YIJT 5CR2A 5LL6S 1BI1A 1BYMA 4NS5A 4OVAA 4LDUA 1XQHA 3EFRA 2E41A 3PT9A 3V7SA 4M78A 2P0KA 4PKCC 3JB9I 4C0ZA 3JCMf 5GAOm 3KUFA 1I5LA 2XICA 3META 3CCET 2ZCFB 2X4JA 4QW2A 3OYMA 3JB9H 1JB0E 4LDYA 1OZ3A 1S72A 2EJ9A 4HA8A 5CAIA 1VQPT 1OYXA 2QQRA 3INZA 2LQ8A 2XK0A 4C0DB 2QEXT 2X4WA 3TREA 2PVGB 4Z02A 3JB9F 3SFMA 4RCCA 4M78E 3M4YA 5CQXA 1VQLT 2OTJT 3MHXA 5CKEA 1M90C 4RCBA 1YJNA 1VQ5T 4BD3A 4C0FA 2QQAA 4C92A 2DXCA 2DTIA 4N4GA 3FLGA 3L2RA 2DIQA 2M0OA 4KULA 3FC3A 1BI3A 1UGPB 2RH2A 2LDMA 2Y90A 4PL6A 4QVCA 2EKOA 4IUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 S;  3CC7 T;  1NJI U;  3OW2 A;  3DLL A;  1YJ9 T;  1VQN A;  2JVV A;  2JOY A;  1XTD A;  3I56 A;  1K73 C;  1VQ6 A;  3CCJ T;  3CCR T;  1YJW T;  1Q81 U;  3CCV A;  3CCQ A;  1VQ4 T;  1NJI C;  1VQ7 A;  1EIF A;  3JAM E;  1SSF A;  3G6E A;  1VQ8 T;  3J7A F;  3CPW S;  1S72 T;  1Q81 C;  3CCL T;  3LGL A;  3LGF A;  3CPW A;  1YHQ T;  1Q86 C;  1VQ9 A;  3CC2 A;  1YIJ A;  3DB4 A;  4X34 A;  1YIT T;  5IT9 E;  3G71 T;  2LVM A;  1KQS A;  1VQM A;  3I55 A;  1KD1 C;  3CC4 T;  3A5Z B;  1VQK T;  1QVG S;  3CME T;  1YJN T;  3CCE A;  2LCL A;  1QVG A;  3CXC S;  3CXC A;  1NZ9 A;  4CRI A;  3CCS T;  1YI2 A;  1N8R C;  1VQP A;  2OTL T;  1VQO A;  5DM7 R;  2QA4 T;  1Q86 U;  3P8B B;  5IAY A;  3CCM T;  1NPP A;  2QEX A;  3CD6 T;  1YJW A;  2E70 A;  3OYY A;  1BKB A;  1KD1 U;  3ER0 A;  4ZN3 A;  5A2Q E;  3J81 E;  3KBG A;  5DLQ E;  1VQL A;  1Q82 U;  2OTJ A;  2G3R A;  1VQN T;  1VQ5 A;  1XNI A;  3G4S T;  3CMA A;  5J3B A;  2MI6 A;  3HKS A;  3I56 T;  1VQ6 T;  1N8R U;  1KQS S;  1K9M C;  2JUF A;  2KVQ G;  3CCV T;  5HY6 A;  3CCU A;  2IG0 A;  1JJ2 S;  1Q82 C;  3PIO A;  1JJ2 A;  1K8A C;  1VQ7 T;  2MWP A;  3CC7 A;  1W2B S;  1X6O A;  1YBY A;  1W2B A;  1YJ9 A;  1Q7Y U;  4TVR A;  4YTL A;  5FLX E;  3G6E T;  2JNG A;  3CME A;  2DO3 A;  2KDS A;  2L3R A;  2XHC A;  1M1K U;  3CPF A;  1VQ9 T;  3CC2 T;  3CCJ A;  3PIP A;  3CCR A;  1YIJ T;  1K9M U;  1QVF S;  5LL6 S;  4QQD A;  1QVF A;  2EIF A;  2MWO A;  1VQM T;  1VQ4 A;  3I55 T;  1UEB A;  4ZN1 A;  1Q7Y C;  5J26 A;  1K8A U;  1M1K C;  3CCE T;  1VQ8 A;  1S72 A;  3G4S A;  1YI2 T;  1M90 U;  3CCL A;  4RG2 A;  1KHI A;  1YHQ A;  1VQP T;  1VQO T;  2LQ8 A;  3DB3 A;  2QEX T;  3CCQ T;  1RL2 A;  1YIT A;  3G71 A;  3TRE A;  1KC8 U;  3CC4 A;  1VQK A;  1VQL T;  2OTJ T;  1M90 C;  1YJN A;  1VQ5 T;  2E6Z A;  3CMA T;  3CCS A;  1NPR A;  2OTL A;  2QA4 A;  1IZ6 A;  3J80 E;  3CCM A;  1KC8 C;  3LH0 A;  1K73 U;  1M1G A;  3CD6 A;  3CCU T;  2CKK A; 
#chains in the Genus database with same CATH topology
 3EAE A;  5A0L A;  2DTO A;  3DLL A;  3H0I A;  4OMQ A;  4C92 E;  2VYT A;  1M27 C;  1G5V A;  2DA9 A;  2VWF A;  1AWO A;  3FIF A;  2E6N A;  1M3B A;  2E1H A;  3OMC A;  5CKF A;  1Q81 C;  1D0X A;  3E2U A;  3ZL7 C;  3CME Q;  2DXU A;  1TXQ A;  2VAS A;  5IH2 A;  2MAM A;  4MDW A;  1ZSZ A;  3X26 B;  3RR6 A;  2K3X A;  2K2V A;  1QVG A;  2A3L A;  5HCK A;  5GAN j;  2PU9 B;  4M7A A;  1WHK A;  2V1R A;  3CCL Q;  2RM4 A;  5HKC A;  1SHG A;  3OQ5 A;  3M0T A;  3JCM h;  2ZPH B;  2SRC A;  4E7H A;  4OB1 B;  3LWH A;  1IRX A;  2AIR B;  4XU2 A;  2IG0 A;  3H0F A;  3SHW A;  3NPF A;  3OSS C;  1ZBJ A;  2V8K A;  4XU0 A;  4C8Q A;  1P92 A;  5GAN 3;  1OPK A;  2J6F A;  3CPF A;  5LJ5 f;  3HRT A;  1QVF S;  1GBR A;  1VQ4 A;  2JT4 A;  2PVD B;  1K8A U;  3EGD A;  3MP8 A;  3DKM A;  3M0U A;  4O5V A;  1HD3 A;  1D1B A;  1YHQ A;  1YN8 A;  3RES A;  4E7I A;  1WQW A;  4M77 B;  1BK2 A;  2FG0 A;  3S3O A;  2LZ6 B;  1V29 B;  4D6W A;  4BDZ A;  3P8H A;  1ZLM A;  3MEU A;  5GMK l;  5KYW A;  4PJO A;  2KAF A;  1K8A R;  2LTO A;  1JXM A;  3MEA A;  3LH5 A;  3QZ9 B;  2NYS A;  4A63 B;  2IIM A;  1UGR B;  4J9H A;  1DJ7 B;  4MZT A;  1UFF A;  1Q7Y R;  3VS5 A;  2NUZ A;  1LCK A;  2HEQ A;  1KFZ A;  2JJ9 A;  1M1K R;  2JW4 A;  2GFA A;  4PK4 A;  1E7O A;  1XOV A;  3CPW S;  1YJ9 Q;  1WGS A;  1Q86 C;  1PD1 A;  4BY6 B;  4D8D A;  3L2W A;  2CSQ A;  4DBQ A;  1YIT T;  2DIG A;  3OBW A;  3OS1 A;  4J7I A;  1D1A A;  2VC8 A;  3VUZ A;  4M77 D;  3CXC A;  1YI2 A;  5KYX B;  2WSE E;  4PJN A;  3S3M A;  1VQO A;  1YWP A;  5DM7 R;  2GFU A;  2D8J A;  4A4G A;  3HSB A;  2YWW A;  4RTU A;  2LCC A;  5GAN 4;  2XKO C;  5DLQ E;  4M7D B;  3I35 A;  5LJ5 j;  4KH0 B;  3NTK A;  2RI2 A;  1N8R U;  3QKJ A;  2RJC A;  3HP9 A;  3A8L B;  2QQB A;  3MP1 A;  2DFU A;  3M53 A;  1JJ2 S;  3EG1 A;  3OSV A;  4X9D A;  2DL8 A;  2MWP A;  1TUC A;  3EG9 A;  1JQQ A;  4TVR A;  2KDS A;  3MP6 A;  5C6S A;  2YDL A;  1VYV A;  2KSS A;  5CKH A;  5GMK i;  1WLP B;  1H3H A;  3SWN A;  3HPW A;  4M77 C;  2RN8 A;  1IO6 A;  1N8R R;  1BCO A;  2X4X A;  4FT2 A;  2R58 A;  1W6X A;  1M3A A;  1WQ7 A;  2GCX A;  2OAW A;  3G71 A;  1YIJ Q;  5CQY A;  1AOJ A;  3NGP A;  4XTW A;  1OOT A;  2CP5 A;  4VUB A;  2F69 A;  2K79 A;  2YLB A;  3REA B;  1X01 A;  2KEA A;  1RI0 A;  1JEG A;  1FMV A;  4M7D D;  1M1G A;  2EVR A;  4M77 G;  3CC7 T;  1NJI U;  3M54 A;  4LE9 A;  2RF0 A;  1XTD A;  2CT4 A;  4RMO A;  1VA7 A;  3MPU B;  2DL5 A;  1GRI A;  2QXF A;  4EIK A;  4BY6 C;  3R6N A;  1WHH A;  1U06 A;  2RJE A;  4EMK B;  1JU5 C;  3G6E A;  4PFO A;  2V8J A;  3LGL A;  1GBQ A;  4BE1 A;  2QAZ A;  2ZAE A;  3OYG A;  2D8H A;  2DPP B;  1C6V X;  1I07 A;  1KD1 C;  3CC4 T;  1WXT A;  2DXB A;  1VQK T;  2KYB A;  2HKN A;  4J9G A;  1ZUY A;  3JV3 A;  4IUT A;  3QHS A;  2M0Y A;  2K5L A;  3GNF B;  3HL8 A;  3MKD A;  2JZ2 A;  2E64 A;  2CS7 A;  2E4H A;  3RUX A;  4M7D C;  3P8B B;  3CCM T;  4ZTF A;  2DK3 A;  1WDX A;  2EQI A;  5IN1 A;  2E70 A;  2P4T A;  4J9B A;  1PRM C;  3BY7 A;  3EGX A;  2V8I A;  3QZ5 B;  5J3B A;  2MYS A;  1LPL A;  3HKS A;  3GPL A;  1RAF B;  4J5Y A;  3CCU A;  4ELY C;  2EGC A;  3DLM A;  2YUN A;  2XDP A;  3L1A A;  3RMS A;  3VKI A;  2HAX A;  2DO3 A;  4B9W A;  4M7D G;  2LQW A;  1VQ9 T;  4DA4 A;  2HL5 C;  3T9N A;  4Z88 A;  4IIM A;  4OB3 B;  4XAX B;  1YP5 A;  2KK4 A;  4EDU A;  2LT4 A;  5KCH A;  1FMW A;  2SEM A;  3LW5 E;  2DMO A;  3G4S A;  4RG2 A;  5CK9 A;  4E47 A;  2OAU A;  1N9S A;  3E9G A;  2G6F X;  3L2Z A;  2CZ1 B;  1N9R A;  3MO8 A;  2YUP A;  5LJ3 d;  4JRQ A;  2RI5 A;  1WXB A;  3VV0 A;  2A0F B;  2OJ2 A;  2BUD A;  1G83 A;  5KYU A;  3CD6 A;  3PTA A;  3QDF A;  5I22 A;  1D3B B;  1KK7 A;  4JJC A;  4X9C A;  5D6W A;  1H64 1;  2GBQ A;  4EMK C;  1KQ2 A;  3E9F A;  1OQK A;  1BU1 A;  2RK1 A;  4DBH A;  3GIB A;  1TG0 A;  1VQ8 T;  3QWX X;  5D6X A;  3CC2 A;  4A4F A;  1O75 A;  2WAC A;  1HXD A;  5GAN d;  1ABO A;  4FYY B;  4Z8A A;  3CME T;  1MHN A;  3CCE A;  4L6V 5;  4EMH A;  2MF2 A;  1KC8 R;  3JCM Q;  2RQV A;  3SDZ A;  1YIT Q;  2BTT A;  3LWI A;  4BUG A;  2K57 A;  1VQ5 A;  3JCM d;  1D0Z A;  3VS3 A;  2H3E B;  4M7D E;  1WIE A;  1B34 B;  3MEW A;  1W2B S;  1X2K A;  2RQU A;  2BIV A;  2BE9 B;  4OF1 A;  5IHN A;  2CYZ B;  1CKA A;  1O9S A;  2DBM A;  1Y71 A;  2O4X B;  4P5N A;  2J7I A;  5CKD A;  2I0N A;  4IIO A;  1BYM A;  4NS5 A;  3EFR A;  1T0H A;  3PT9 A;  2P0K A;  1I5L A;  4QW2 A;  3OYM A;  1QMC A;  2M02 A;  2VKN A;  3MJX A;  1OYX A;  3INZ A;  2LQ8 A;  1BB9 A;  1WHG A;  1K4U S;  4Z02 A;  3SFM A;  4RCC A;  3TQ7 P;  1VQL T;  1D1C A;  2YUQ A;  2OTJ T;  2K6D A;  2QGF B;  1YJN A;  2QQA A;  2RNA A;  2DXC A;  4N4G A;  1AZE A;  1PRL C;  1X6G A;  1JXO A;  2ATC B;  2LDM A;  4QVC A;  2EKO A;  4IUU A;  4M77 A;  3E19 A;  3JCM c;  2HKQ B;  2KRM A;  2CUB A;  1K73 C;  4JJN K;  2F5T X;  4F7U G;  2DRM A;  2JM9 A;  2BZX A;  1SEM A;  4EPC A;  1VQ7 A;  2PVO B;  1U3O A;  5GMK m;  2DXT A;  1LVK A;  3CC7 Q;  2J6K A;  1S72 T;  2V1Q A;  3LGF A;  4A4K A;  1UGV A;  4PLI A;  1BI2 A;  4FSS A;  2M16 A;  2DBK A;  3X24 B;  2K5I A;  2QGG A;  2XID A;  5CCA A;  1ZUK A;  2YLC A;  4IUV A;  1NPP A;  1ZA2 B;  1YJW A;  4MZP A;  4IKF A;  2O31 A;  2RO0 A;  2DET A;  3CC4 Q;  1Y07 A;  2XMF A;  1VQK Q;  1ARK A;  2EBP A;  4JRK A;  4AFU C;  5IHK A;  1PHT A;  2H8H A;  5KYX A;  1X75 C;  2CH4 W;  2LNH B;  3A8G B;  3CCM Q;  3CC2 Q;  4AFS C;  4A54 A;  2JTM A;  2CSI A;  2ZPE B;  1T3L A;  2X35 A;  3O5Z A;  1M1F A;  4J9D A;  4M7D A;  3S6W A;  5GAN 2;  2K9G A;  1WHL A;  3QII A;  1TH7 A;  2KRS A;  5DY9 A;  4JPB W;  1QVP A;  4L5G A;  1WJS A;  2HBW A;  2X9H A;  1M90 U;  1MND A;  2FHD A;  3OB9 A;  2KRO A;  2EFI A;  3RKY A;  3OYJ A;  1RL2 A;  2E3I A;  1VQ9 Q;  3M59 A;  3UAT A;  4EMG A;  3OYF A;  4AMC A;  2D9T A;  3KXT A;  1BCM A;  2DM1 A;  4JRI A;  3SEM A;  4Z89 A;  3J80 E;  2QQ9 A;  2PNI A;  3V8J A;  4M4Z A;  3OYD A;  3X28 B;  2RHY A;  3MEV A;  3M5A A;  4N0A C;  4UC4 A;  5KYU B;  2JVV A;  1ZHI A;  1WHM A;  3TSW A;  2JOY A;  2RK2 A;  4V2S A;  1RAD B;  3QWY A;  3C95 A;  3I56 A;  2FB7 A;  1M4Z A;  1Q81 U;  4PJO E;  1PNJ A;  3QUI A;  4M75 F;  3CCQ A;  1VQ4 T;  4HVU A;  4QVZ A;  1SSH A;  5LJ3 h;  2DZ9 A;  4MML A;  1SSF A;  4QQ6 A;  2A7Y A;  1YHQ T;  1WYX A;  3OYI A;  3M0S A;  3PNW C;  1A0N B;  1VQM A;  3I55 A;  5J39 A;  3PGG A;  4FIB A;  4HCC A;  4MZM A;  1VQ8 Q;  4EMK A;  3HRS A;  5IAY A;  1BI0 A;  1AVZ C;  1GCP A;  1EZZ B;  1OUL A;  3OYL A;  4BE2 A;  3ULR B;  3CEY A;  2E5Q A;  3JCM b;  3M0R A;  3TEE A;  3JCM W;  3J81 E;  3IQL A;  1IHV A;  4MDX A;  4JLI A;  2XDD A;  4HCB A;  2QK0 A;  5GAM j;  1VOM A;  1FWZ A;  5GAN h;  2KVQ G;  2L8D A;  2L5Q A;  3LLR A;  5FU6 B;  4JRP A;  1Y0M A;  1AWJ A;  4F7U F;  4HVW A;  1RLQ C;  5KYN A;  1YCS B;  3JSC A;  2CT3 A;  3X20 B;  3OS0 A;  1GL5 A;  3OYE A;  3VS0 A;  3A8M B;  1HJD A;  2COW A;  2CZ0 B;  4R55 A;  3FB9 A;  1YI2 T;  2ED1 A;  1VQO T;  1N27 A;  2I2L A;  1UEC A;  4NL3 A;  4L59 A;  4ME7 A;  2QQS A;  3OA6 A;  2P84 A;  4DBR A;  1PSF A;  3PMT A;  4J9I A;  3CCS A;  2GQV A;  4OMM A;  2OTL A;  2A28 A;  1FYN A;  2FL7 A;  5I2M A;  5GAM g;  1R8O B;  1PCX A;  1QVF P;  3M57 A;  1CSK A;  2DF6 A;  4M78 F;  3OYB A;  1ZA1 B;  2F1L A;  3OW2 S;  1IHW A;  4KUD K;  1VQL Q;  2KYM A;  2OTJ Q;  3I5R A;  5I11 A;  1IRE B;  3CCV A;  2DL3 A;  3FJ5 A;  3CBP A;  5I21 A;  2H3J A;  5L23 A;  2JTF A;  1UGQ B;  1ZQ1 A;  1D3B A;  4BI3 A;  3O8V A;  4CC4 B;  1HK9 A;  2E65 A;  2EAY A;  3VS6 A;  4X34 A;  1VYT A;  1U1T A;  2LX9 A;  4KBM B;  3G71 T;  2LVM A;  2HCK A;  3OBY A;  4B6M A;  5FWB A;  5CKB A;  4J6X A;  3JB9 G;  2HSP A;  4XTV A;  2EPD A;  3HHT B;  1Y7X A;  4O6J A;  1M8V A;  1Y57 A;  1S72 Q;  5GAO n;  2AHJ B;  1PD0 A;  3V7R A;  4ZN3 A;  2ZPG B;  1RI9 A;  4AFZ C;  2ENM A;  1WJQ A;  3JCM g;  2RQR A;  3CMA A;  1UJ0 A;  3P8D A;  1RAA B;  3CPW P;  4KGX B;  1U8R A;  5FU6 C;  7AT1 B;  4N4H A;  4A4E A;  1IGQ A;  3H6Z A;  1K8A C;  3NFC A;  3OMG A;  4CC2 A;  1OV3 A;  8AT1 B;  3G6E T;  1XJW B;  5LJ5 h;  1QCN A;  2C06 A;  1G3S A;  4XK8 E;  4XU1 A;  2OX7 A;  4KGZ B;  2E5K A;  1K76 A;  2RQW A;  3N5B B;  2CRE A;  1Q7Y C;  4A4H A;  3ASK A;  1G2B A;  1B34 A;  3RBB B;  4ESR A;  3TCJ A;  1M1K C;  3EG0 A;  1KHI A;  2GF7 A;  2M9U A;  2EYW A;  2O4X A;  1JJ2 P;  4LD6 A;  5KCO A;  4GLK A;  1BIB A;  3URG A;  4HT9 A;  2DL7 A;  2QA4 A;  2AK5 A;  3CCU T;  1QCO A;  3THK A;  5GJV B;  5KYY B;  1AWW A;  2FRY A;  2DYI A;  1VQN A;  3GBQ A;  3H0H A;  3UPU A;  3FJP A;  3AHU A;  1PSE A;  2EGE A;  1I0C A;  1OU8 A;  5KE3 A;  3C4S A;  3QJY A;  1EIF A;  4HXJ A;  2RQT A;  2F5K A;  2R5A A;  2VGM A;  1KHC A;  3CQT A;  1OX8 A;  3CBM A;  2X4Y A;  1G3W A;  1VQ4 Q;  4N0A A;  1JBM A;  1QVG S;  3NTI A;  1NZ9 A;  1N8R C;  1VQP A;  1QLY A;  1WXU A;  4OGE A;  2QEX A;  1YHQ Q;  3CD6 T;  3VS4 A;  3KFV A;  4J9F A;  4GLM A;  2DNU A;  1Y96 B;  3GOX A;  3EFS A;  2LCS A;  2CZ6 B;  2GGR A;  3TVT A;  2K4Y A;  3WVE B;  1WJR A;  2F2V A;  1NJI R;  1NM7 A;  5FWC A;  2DD5 A;  2IPO B;  2MIO A;  1YFN A;  1R77 A;  3OYC A;  4FL6 A;  4CC3 A;  5FRN A;  3CC2 T;  1GFC A;  3PIP A;  3CCR A;  3PVL A;  4M75 B;  4RTY A;  5CR2 A;  1AT1 B;  3M0P A;  1QWE A;  1UE9 A;  3V7S A;  4PKC C;  1M8M A;  3KUF A;  2XIC A;  2AKK A;  3CCE T;  2ZCF B;  2EYX A;  3VS1 A;  4HA8 A;  2X3W D;  2XK0 A;  5IHI A;  3TRE A;  2PVG B;  3JB9 F;  2EYZ A;  4E7S A;  1CKB A;  4RCB A;  1VQ5 T;  4BD3 A;  2CUD A;  4C0F A;  1R0C B;  2YRC A;  4JZ3 A;  1KJW A;  2DIQ A;  1SF9 A;  1YI2 Q;  1BI3 A;  1UGP B;  2LJ1 A;  2RH2 A;  4PL6 A;  1VQO Q;  4LUD A;  4WCI A;  1NE8 A;  3M58 A;  1N5Z A;  2GTO A;  2CP3 A;  4LDX A;  5GAN 5;  3OYA A;  1I8F A;  4LXC A;  1VQ6 A;  2CGH A;  4Y92 A;  3WXM B;  4M77 E;  2QI2 A;  4F7U B;  4M75 D;  2LNV A;  2VVK A;  4XTY A;  1PKT A;  2DRK A;  1RAG B;  3L42 A;  5DLO A;  5D7U A;  4CC7 A;  4FW2 A;  1W4S A;  2DVJ A;  3UA7 A;  4AG2 C;  1RAH B;  2FZG B;  4JS4 A;  1YJN T;  3CXC S;  2DEQ A;  3VRZ A;  3OYH A;  4ANJ A;  3BE3 A;  3G71 Q;  4DOW A;  5GAN 7;  1U5S A;  4PJJ A;  4E2F B;  2RJD A;  5I2S A;  1KG1 A;  5AT1 B;  2EWN A;  5FW9 A;  5GAO l;  2MI6 A;  2J05 A;  4M78 B;  3PIO A;  4B9X A;  1VQ7 T;  4M75 C;  1UTI A;  4BI4 A;  4C5E A;  1HSQ A;  2RMO A;  2AKL A;  1B3Q A;  1M30 A;  3H41 A;  4BI8 B;  2AZS A;  1JRI A;  1QKX A;  2K7A A;  1K9M U;  2D6F A;  4KUI A;  1S1N A;  2KRN A;  1I5O B;  1H3Z A;  1GXI E;  2C0T A;  2COY A;  3G6E Q;  3JCM J;  4J7F A;  2B8A A;  1M2O A;  1NLP C;  1NEG A;  1FMK A;  4M75 G;  2IVW A;  1W2B P;  3CBO A;  4DEX A;  1K9M R;  3QSU A;  1OPL A;  4OGC A;  5GAM e;  4FYW B;  1KC8 C;  1K73 U;  4JUV A;  1VIE A;  4K11 A;  5CVI A;  3LYI A;  2CKK A;  2J06 A;  2DEU A;  2DIL A;  4AT1 B;  3JCM P;  4M78 D;  2VGN A;  1WZO A;  1SKU B;  1YCY A;  2DX1 A;  2GQI A;  3S3N A;  3EG3 A;  3CCU Q;  3RNJ A;  1WNL A;  2VV5 A;  4JDS A;  1WA7 A;  2RI3 A;  4E7L A;  4RG8 A;  2CP7 A;  4C92 D;  1PG5 B;  3DB4 A;  5IT9 E;  2AZV A;  2O2O A;  4X1V A;  3V8L A;  4JJD A;  1RAE B;  2FEI A;  2LMJ A;  1SRM A;  4C8Q G;  2JS0 A;  2LCL A;  1ABQ A;  4CRI A;  4OB2 B;  2A36 A;  1FXX A;  3G4S Q;  1LNX A;  3RMQ A;  5GMK j;  3VUB A;  5KH6 A;  4J6Y A;  1MMN A;  3KBG A;  4M78 C;  2YXY A;  1MGQ A;  2HQE A;  3I56 T;  2EGA A;  2A37 A;  2EQM A;  4J8O A;  5FRO A;  1MV0 B;  1NEB A;  2PUO B;  1Q82 C;  3CD6 Q;  1ZX6 A;  5FLX E;  8ATC B;  3CME A;  1SRL A;  1K9A A;  3JB9 J;  4XU3 A;  5LJ5 d;  2OI3 A;  2EYY A;  2F2W A;  2FYK A;  2Z0W A;  5GAO p;  1QVF A;  2XI9 A;  1VQM T;  3I55 T;  1UEB A;  4M78 G;  2ESW A;  2EQU A;  3OS2 A;  2XDB A;  4JS5 A;  1I1J A;  3CCL A;  4F17 A;  2JMC A;  2EQK A;  3VJP A;  3VYG A;  1X27 A;  2DZC A;  4C92 G;  2EJG A;  1EX4 A;  4KH1 B;  3CCE Q;  5GAM f;  3QPH A;  2EKH A;  1N6A A;  3BFM A;  1X6B A;  1MUZ A;  4FYX B;  3BDU A;  3G1J A;  1OEB A;  2QTV A;  1IXD A;  3UDC A;  4J9C A;  1VQ5 Q;  3PFS A;  1G8X A;  4XQ3 A;  4II1 A;  1G3Y A;  1X2Q A;  5KYY A;  3FEO A;  5FRM A;  2E3H A;  3CPW A;  1J3T A;  3BW1 A;  4F7U E;  1M2V B;  2KR3 A;  5EC7 A;  1M90 R;  3A5Z B;  3VS2 A;  4PFP A;  4E7J A;  2RA2 A;  1UJY A;  2L3P A;  1MMD A;  1TS9 A;  3CCS T;  2OTL T;  1R0B G;  4OP0 A;  4WTO B;  1QKW A;  5GAO r;  2RHZ A;  4QQG A;  4DEY A;  2VB6 A;  4FU6 A;  5EG2 A;  1AD5 A;  2ZGW A;  1Q95 G;  3EH1 A;  1YJN Q;  1KQS S;  2O88 A;  2W10 A;  2YHT A;  3CCV T;  2KY9 A;  1UHF A;  3I5S A;  2PTK A;  3L2Q A;  4XTU A;  1JJ2 A;  3QYH B;  1UDL A;  4RTX A;  2RJF A;  1YJ9 A;  1Q81 R;  3PVQ A;  4Q5W A;  2HDA A;  4M7A F;  1U1S A;  2XHC A;  3CCJ A;  5GAM h;  1VIF A;  1Y96 A;  2EIF A;  1KQ1 A;  2X3X D;  4ZN1 A;  2KT8 A;  5LJ3 j;  4ORZ A;  2GNC A;  1YWO A;  2NUT A;  1VQ7 Q;  2DE0 X;  2K3B A;  4RUG A;  2XD0 A;  2ZPI B;  3MCA B;  1AWX A;  2P0P A;  4C5I A;  3F70 A;  1WHJ A;  4C8Q F;  4M75 A;  2HMA A;  2K2M A;  2E6Z A;  3JB9 D;  3CMA T;  4HCZ A;  2QAS A;  1TU0 B;  2MCN A;  2FPF A;  6AT1 B;  3QG1 A;  1YJW Q;  2FZC B;  2LJ3 A;  4LDW A;  2KBT A;  1WPY A;  4BDY A;  5IXF A;  1QP2 A;  2P4R A;  4RTT A;  1SHF A;  2FZK B;  2KNB B;  3G7Z A;  1C0M A;  2ECZ A;  1SPK A;  1QWF A;  5A0D A;  1AZG B;  5LJ3 g;  2J6O A;  3QJ6 A;  2RHX A;  4PJO F;  4DQ2 A;  1YIJ A;  4R0K A;  2L0A A;  3A98 A;  3ZEH A;  2VXF A;  2QG9 B;  4KGV B;  2QDY B;  3OYN A;  2L3Q A;  1ZUU A;  3OW2 P;  1X69 A;  4QVD A;  2YRD A;  3RKW A;  3EHR A;  1B7T A;  4PNO A;  4F7U A;  2QA4 T;  1Q86 U;  4N4I A;  1E6G A;  2CP6 A;  1Z9Q A;  2JS2 A;  1G3T A;  4C92 F;  1FX7 A;  1B07 A;  1VQN T;  1XNI A;  4C5G A;  1BIA A;  2AT1 B;  4LD9 K;  2O9V A;  1ZBX A;  1VYU A;  2WSF E;  2COZ A;  2YUO A;  4Y28 E;  5GAN 6;  1MMG A;  5GAN g;  2DYB A;  4OMO A;  2EW3 A;  1X6O A;  1YBY A;  1Q7Y U;  1Q86 R;  2FPD A;  2L3R A;  3FDR A;  1M1K U;  1QCF A;  3I56 Q;  1UHC A;  5LL6 S;  2ROL A;  2E41 A;  3CCQ Q;  4M78 A;  5GAO m;  3PE0 A;  2QYZ A;  3JB9 H;  1JB0 E;  1OZ3 A;  1VQP T;  4C0D B;  2QEX T;  1PWT A;  2CH4 A;  1VQM Q;  1MMA A;  3I55 Q;  4FYV B;  3MHX A;  4PJL A;  5CKE A;  2KXC A;  2NUP A;  4C92 A;  2DTI A;  3L2R A;  3FLG A;  2M0O A;  3FC3 A;  1E6H A;  2A08 A;  3UF4 A;  3SD4 A;  3CCJ Q;  3QYG B;  2HL3 A;  5ECA A;  2XU8 A;  3I9Q A;  3CCR T;  1LOJ A;  4HKE A;  4BB7 A;  2M1H A;  1GCQ A;  4FCY A;  3HFO A;  1QQJ A;  2CDT A;  3ZBD A;  3HTR A;  3M4G A;  4Y91 A;  1AHJ B;  2XG8 D;  3QXE B;  4FW1 A;  1MV3 A;  3M55 A;  4E7K A;  1W1F A;  4IUQ A;  5GAN 8;  3EFO B;  3Q1J A;  5AYF A;  3LX7 A;  2NWM A;  1KSW A;  5CO7 A;  2HBP A;  3EG2 A;  2DVE A;  3OS5 A;  2NLU A;  2ZPB B;  1JO8 A;  1KD1 U;  1W70 A;  2ZZD A;  3G4S T;  3OY9 A;  1VQ6 T;  3RER A;  3CCS Q;  2GTJ A;  2OTL Q;  1I4K 1;  2FO0 A;  3C12 A;  2KMT A;  2MK5 A;  4IUP A;  1W2B A;  4YTL A;  1QVG P;  3JRZ A;  2JTE A;  3VYH B;  3V8K A;  4ELZ C;  5LJ5 g;  2RD1 A;  1KD1 R;  1WI7 A;  1KIK A;  3CCV Q;  1NBE B;  4DBF A;  3C94 A;  5GAO q;  2PZ1 A;  3HRU A;  1D09 B;  4C0D C;  1C1A A;  4RTV A;  2HSE B;  2KQW A;  2NUT B;  1YIT A;  3UA6 A;  4XTZ A;  1TUG B;  5GMK e;  3EHQ A;  3M9Q A;  1D0Y A;  1UG1 A;  3QBY A;  2Y4Y A;  1UB4 A;  4DOV A;  4GY5 A;  1NYF A;  2FPE A;  1H92 A;  3WVD B;  4OB0 B;  2RHI A;  4FM4 B;  2E12 A;  5A0G A;  4BAC A;  1HYO A;  4NL2 A;  4ZNX A;  1AEY A;  3CMA Q;  3VS7 A;  1ZSZ B;  3A8O B;  2M51 A;  2KXD A;  1NJI C;  3E1S A;  4IUR A;  4J9E A;  4OMN A;  4M7A B;  4AG1 C;  3NTH A;  3OYK A;  3RIR A;  2JXB A;  1RLP C;  3H9N A;  3SB2 A;  2ZPF B;  4HVV A;  2EQJ A;  3REB B;  2W0Z A;  4NOY A;  4LNP A;  1OI1 A;  5FU7 B;  4E6R A;  5KE2 A;  4C8Q B;  1T0J A;  4FSX A;  3ER0 A;  3ZFJ A;  5A2Q E;  1WFW A;  1M2V A;  2O9S A;  4OML A;  3TU4 K;  3L2V A;  1UGS B;  4OMF B;  4C5H A;  2BKD N;  3AT1 B;  3EGD B;  2QA4 Q;  3NMZ C;  4R56 A;  2K5F A;  3U23 A;  3CC7 A;  3A1P A;  1MNE A;  1IGU A;  3CXC P;  1VQN Q;  4LN2 A;  3FRN A;  2RB6 A;  3D7S B;  5GAM d;  4QQD A;  4M7A D;  2MWO A;  5J26 A;  4LDV A;  2LX7 A;  3EH2 A;  2QDL A;  2HD0 A;  5KYW B;  2LRQ A;  4CI0 C;  4PJO B;  2KI7 A;  2K3Y A;  3JCM X;  4PJM A;  2EJF A;  1M3C A;  3NHN A;  1LJO A;  1KC8 U;  3CC4 A;  1VQK A;  4QKU A;  1NYG A;  3PMI A;  4C8Q D;  3JCM V;  3C0C A;  1GFD A;  2ROT A;  3CCM A;  3LH0 A;  1IB8 A;  1VQP Q;  2KE9 A;  2NUP B;  4C92 B;  2QEX Q;  3M56 A;  4GBQ A;  2D0N A;  3EGU A;  1T3S A;  1ZSZ C;  2LQK A;  1RUW A;  2EYQ A;  5M9O A;  2JN0 A;  3L2U A;  2B86 A;  1V1C A;  2LJ0 A;  1YJW T;  4M7A C;  2BZY A;  4ZGD B;  1NG2 A;  2L3S A;  1QW1 A;  3UT1 A;  2DTH A;  3JAM E;  2HNI A;  4PFZ A;  5LJ3 e;  3J7A F;  1M5Q 1;  2FVU A;  2DJZ A;  3GP8 A;  3CCL T;  4F04 B;  1VQ9 A;  5D6Y A;  3CCR Q;  1KQS A;  2WSC E;  5FU7 C;  4M77 F;  4PJO D;  3A8H B;  5HK0 A;  2R5M A;  4C8Q C;  2VUB A;  2O01 E;  2R57 A;  2L2P A;  3M0Q A;  1I81 A;  4D8K A;  4M7A G;  3EG9 B;  4ZGJ B;  3UWN A;  2MOX A;  5GJW B;  4ZGE B;  1Q82 U;  1K73 R;  4BE0 A;  3BDL A;  1K9M C;  2DER A;  5CIU A;  3QDR B;  3SWN B;  5GAN e;  1QP3 A;  2LQN A;  4PLL A;  5GMK h;  3GF5 A;  4KRT A;  2DL4 A;  2VXE A;  2C0I A;  4J6W A;  1ACM B;  9ATC B;  2HZY A;  4LUE A;  4RKU E;  2YRV A;  5HK3 A;  2LP5 A;  1X43 A;  1VQ6 Q;  4WF2 A;  4PJO C;  3VU3 C;  1M9S A;  1Q82 R;  4QT7 A;  4A53 A;  1ZSG A;  2D0Q B;  2E10 A;  2V26 A;  2D1X A;  4J83 A;  2Y4X A;  1VUB A;  3JCM e;  2KGT A;  1VQ8 A;  3H8Z A;  2MPX C;  2DKG A;  1RAI B;  3RKX A;  3CCQ T;  3DB3 A;  3R6O A;  2P0Q A;  2CZ7 B;  2YSQ A;  3VRY A;  4C92 C;  4M7D F;  4FT4 A;  3GNG A;  3GLX A;  1NPR A;  2DD4 A;  1RAB B;  4PJO G;  4OMP A;  1IZ6 A;  1OZ2 A;  4RTZ A;  1OX9 A;  4XTX A;  4MMK A;  1NLO C;  1TSF A;  2MMP A;  4M75 E;  3OW2 A;  1YJ9 T;  2BE7 D;  2JM8 A;  2F2X A;  2L89 A;  4HCK A;  2CP0 A;  3CCJ T;  1TUD A;  1H8K A;  1GCQ C;  4F16 A;  2LT1 A;  3X25 B;  4C0G A;  4RTW A;  2CP2 A;  5LJ3 f;  1Z9Z A;  3V7C A;  1F1B B;  2C0O A;  2QTX A;  1K1Z A;  4KT0 E;  4ATO A;  4M7A E;  2LC4 A;  3EGX B;  1YNZ A;  2BZ8 A;  1EFN A;  4HT8 A;  2DAQ A;  4E7Z A;  1PM3 A;  1TTH B;  1PKS A;  1OU9 A;  2RHU A;  4F14 A;  3OYY A;  1TOV A;  1BKB A;  2DLP A;  2ABL A;  1VQL A;  2OTJ A;  2G3R A;  3SWN C;  4C8Q E;  4JZ4 A;  2FRW A;  5L8R E;  3HFN A;  3EFO A;  1BBZ A;  2ED0 A;  1K0X A;  2KT1 A;  2JUF A;  3QO3 A;  5C0M A;  5GAN f;  5HY6 A;  1WX6 A;  3ME9 A;  2HQH A;  2PUK B;  4JLG A;  3RDV A;  3TSZ A;  2JNG A;  4ZTJ A;  1YIJ T;  2PQW A;  5LJ5 e;  2HQX A;  1BI1 A;  4OVA A;  4LDU A;  1XQH A;  3JB9 I;  1PC0 A;  4C0Z A;  3JCM f;  2YT6 A;  3MET A;  1RAC B;  2X4J A;  1S72 A;  4LDY A;  4AFQ C;  2EJ9 A;  5CAI A;  4JJB A;  2QQR A;  1UUE A;  1KQS P;  2X4W A;  1V76 A;  1SG5 A;  2DJQ A;  2X51 A;  4M78 E;  3M4Y A;  5CQX A;  1M90 C;  1TWB A;  2RPN A;  4KUL A;  1K0S A;  2JMA A;  2Y90 A;  5IXB A; 
#chains in the Genus database with same CATH homology
 3EAE A;  3QYG B;  1NE8 A;  3M58 A;  4M77 A;  5A0L A;  3E19 A;  2DTO A;  3JCM c;  3DLL A;  4LDX A;  5GAN 5;  3OYA A;  1I8F A;  2XU8 A;  4C92 E;  1K73 C;  1VQ6 A;  2VYT A;  3CCR T;  1LOJ A;  2F5T X;  4JJN K;  2CGH A;  4F7U G;  3WXM B;  4HKE A;  1G5V A;  4BB7 A;  2M1H A;  4EPC A;  1VQ7 A;  2PVO B;  3FIF A;  3HFO A;  4M77 E;  2E6N A;  5GMK m;  3ZBD A;  2QI2 A;  4F7U B;  4M75 D;  2E1H A;  5CKF A;  3OMC A;  2DXT A;  2LNV A;  4XTY A;  1S72 T;  1Q81 C;  3L42 A;  3M4G A;  5DLO A;  3LGF A;  4Y91 A;  1AHJ B;  2XG8 D;  3QXE B;  4A4K A;  2DXU A;  4PLI A;  1W4S A;  1BI2 A;  3M55 A;  2M16 A;  4E7K A;  4IUQ A;  2MAM A;  5GAN 8;  4MDW A;  4JS4 A;  3X26 B;  3SD4 A;  3X24 B;  2K5I A;  2K3X A;  2K2V A;  2XID A;  1YJN T;  5CCA A;  3Q1J A;  1QVG A;  5AYF A;  3LX7 A;  3CXC S;  2A3L A;  2DEQ A;  2YLC A;  5GAN j;  3OYH A;  2PU9 B;  4M7A A;  5CO7 A;  2HBP A;  4IUV A;  1NPP A;  2DVE A;  2RM4 A;  3OS5 A;  2NLU A;  1YJW A;  4MZP A;  4IKF A;  2ZPB B;  5HKC A;  1KD1 U;  2RO0 A;  4DOW A;  5GAN 7;  3OQ5 A;  2ZZD A;  3JCM h;  1Y07 A;  2RJD A;  5I2S A;  2ZPH B;  1KG1 A;  3G4S T;  2EWN A;  5GAO l;  2MI6 A;  3OY9 A;  4JRK A;  4E7H A;  1VQ6 T;  3RER A;  4OB1 B;  3LWH A;  4M78 B;  1I4K 1;  3C12 A;  2IG0 A;  4XU2 A;  1X75 C;  3A8G B;  3PIO A;  4B9X A;  1VQ7 T;  3OSS C;  2KMT A;  4A54 A;  4M75 C;  2V8K A;  2JTM A;  2ZPE B;  4XU0 A;  4IUP A;  4BI4 A;  4C8Q A;  1P92 A;  1W2B A;  5GAN 3;  2X35 A;  4YTL A;  4C5E A;  1M1F A;  3JRZ A;  3VYH B;  4M7D A;  3CPF A;  3S6W A;  3V8K A;  4BI8 B;  4ELZ C;  5LJ5 g;  5LJ5 f;  5GAN 2;  1JRI A;  2RD1 A;  1K9M U;  3HRT A;  1QVF S;  2D6F A;  3QII A;  1TH7 A;  4KUI A;  1VQ4 A;  5DY9 A;  2PVD B;  3C94 A;  1QVP A;  4L5G A;  1WJS A;  1K8A U;  5GAO q;  3HRU A;  4C0D C;  3MP8 A;  3DKM A;  4O5V A;  1H3Z A;  1GXI E;  1M90 U;  1YHQ A;  3JCM J;  2FHD A;  3OB9 A;  4J7F A;  3RES A;  4E7I A;  1WQW A;  2B8A A;  2EFI A;  2KQW A;  4M77 B;  1RL2 A;  3RKY A;  4XTZ A;  3OYJ A;  1YIT A;  3M59 A;  3S3O A;  4EMG A;  1V29 B;  4M75 G;  5GMK e;  4D6W A;  3OYF A;  2D9T A;  2IVW A;  3M9Q A;  3KXT A;  4BDZ A;  3P8H A;  3MEU A;  3QBY A;  2Y4Y A;  3CBO A;  3QSU A;  1UB4 A;  5GMK l;  4DOV A;  4JRI A;  4OGC A;  4GY5 A;  5GAM e;  3J80 E;  2KAF A;  1KC8 C;  1K73 U;  4JUV A;  2QQ9 A;  3V8J A;  1VIE A;  4PJO A;  2LTO A;  5CVI A;  3MEA A;  3LYI A;  3OYD A;  2CKK A;  3WVD B;  3X28 B;  4OB0 B;  2RHY A;  2RHI A;  3QZ9 B;  4FM4 B;  3MEV A;  3M5A A;  4N0A C;  2E12 A;  4UC4 A;  5A0G A;  2JVV A;  1ZHI A;  4BAC A;  4M78 D;  3JCM P;  2JOY A;  2RK2 A;  1UGR B;  4V2S A;  3C95 A;  2VGN A;  4NL2 A;  3I56 A;  2FB7 A;  1M4Z A;  1DJ7 B;  4MZT A;  1YCY A;  1Q81 U;  4PJO E;  3S3N A;  3QUI A;  4M75 F;  3A8O B;  3CCQ A;  1VQ4 T;  1NJI C;  3E1S A;  4IUR A;  4QVZ A;  5LJ3 h;  2DZ9 A;  4MML A;  2GFA A;  1SSF A;  4M7A B;  1WNL A;  2VV5 A;  3NTH A;  1XOV A;  4JDS A;  3OYK A;  2RI3 A;  5GAN 4;  4QQ6 A;  2A7Y A;  3CPW S;  4E7L A;  1YHQ T;  1WGS A;  1Q86 C;  4BY6 B;  4RG8 A;  3RIR A;  4C92 D;  3DB4 A;  3OYI A;  3L2W A;  1YIT T;  5IT9 E;  3PNW C;  2DIG A;  3OBW A;  3I55 A;  3SB2 A;  1VQM A;  3OS1 A;  2ZPF B;  3V8L A;  5J39 A;  3PGG A;  4J7I A;  2EQJ A;  2VC8 A;  3VUZ A;  4FIB A;  4C8Q G;  4NOY A;  2LCL A;  1OI1 A;  4M77 D;  4HCC A;  4MZM A;  3CXC A;  5FU7 B;  1YI2 A;  4CRI A;  4OB2 B;  2WSE E;  5KE2 A;  3S3M A;  4EMK A;  5DM7 R;  1VQO A;  1FXX A;  3HRS A;  5IAY A;  2GFU A;  1LNX A;  1BI0 A;  4C8Q B;  3RMQ A;  3OYL A;  4BE2 A;  5GMK j;  4A4G A;  3VUB A;  3CEY A;  3HSB A;  2E5Q A;  3JCM b;  2LCC A;  5KH6 A;  4FSX A;  2XKO C;  3ER0 A;  4J6Y A;  3TEE A;  3KBG A;  5DLQ E;  3ZFJ A;  5A2Q E;  3J81 E;  4M78 C;  3JCM W;  4M7D B;  3TU4 K;  1MGQ A;  2HQE A;  5LJ5 j;  3L2V A;  4MDX A;  4JLI A;  2XDD A;  4HCB A;  1UGS B;  5GAM j;  3I56 T;  1FWZ A;  3NTK A;  4OMF B;  4C5H A;  2RI2 A;  1N8R U;  3QKJ A;  2EQM A;  2RJC A;  3HP9 A;  2BKD N;  2KVQ G;  2L8D A;  2QQB A;  3A8L B;  2L5Q A;  5GAN h;  4J8O A;  3MP1 A;  5FRO A;  2PUO B;  3M53 A;  1JJ2 S;  1Q82 C;  3OSV A;  4R56 A;  4X9D A;  2MWP A;  3LLR A;  2K5F A;  3CC7 A;  4TVR A;  5FU6 B;  4JRP A;  5FLX E;  3CME A;  4F7U F;  2KDS A;  3MP6 A;  3JB9 J;  5C6S A;  4XU3 A;  5LJ5 d;  3FRN A;  2FYK A;  2RB6 A;  3JSC A;  2KSS A;  5GAM d;  5CKH A;  5GMK i;  5GAO p;  1QVF A;  4QQD A;  4M7A D;  2MWO A;  2XI9 A;  1VQM T;  3I55 T;  3X20 B;  3OS0 A;  1UEB A;  4M78 G;  5J26 A;  3OYE A;  4LDV A;  3A8M B;  3SWN A;  3HPW A;  4M77 C;  4PJO B;  2HD0 A;  2EQU A;  2LRQ A;  3OS2 A;  4CI0 C;  2CZ0 B;  2X4X A;  4JS5 A;  4R55 A;  2K3Y A;  2XDB A;  4FT2 A;  2R58 A;  3FB9 A;  1YI2 T;  3JCM X;  3CCL A;  2EJF A;  1WQ7 A;  1N27 A;  2GCX A;  2I2L A;  1VQO T;  4NL3 A;  4L59 A;  4ME7 A;  2QQS A;  3G71 A;  5CQY A;  3OA6 A;  1LJO A;  1KC8 U;  2EQK A;  3CC4 A;  3VJP A;  4XTW A;  3VYG A;  1VQK A;  4VUB A;  2F69 A;  1PSF A;  3PMI A;  2DZC A;  3PMT A;  4C92 G;  2EJG A;  3JCM V;  4C8Q D;  2YLB A;  1X01 A;  3CCS A;  2GQV A;  2OTL A;  1RI0 A;  5GAM g;  2FL7 A;  3QPH A;  5I2M A;  5GAM f;  3CCM A;  1R8O B;  1N6A A;  3LH0 A;  1M1G A;  3BFM A;  4M7D D;  3M57 A;  3BDU A;  4C92 B;  4M78 F;  3OYB A;  4M77 G;  3M56 A;  3OW2 S;  3CC7 T;  1NJI U;  3M54 A;  4KUD K;  2LQK A;  3UDC A;  2EYQ A;  5M9O A;  2JN0 A;  1XTD A;  3L2U A;  4RMO A;  1IRE B;  3PFS A;  1YJW T;  4M7A C;  4XQ3 A;  3CCV A;  5I21 A;  4ZGD B;  3CBP A;  2QXF A;  1QW1 A;  2H3J A;  3UT1 A;  4II1 A;  4BY6 C;  1G3Y A;  2DTH A;  2HNI A;  3JAM E;  2JTF A;  1UGQ B;  1ZQ1 A;  5LJ3 e;  2RJE A;  1D3B A;  4BI3 A;  4EMK B;  3O8V A;  3G6E A;  3FEO A;  3J7A F;  1M5Q 1;  5FRM A;  2FVU A;  2DJZ A;  3GP8 A;  1HK9 A;  2V8J A;  3LGL A;  3CPW A;  3CCL T;  4BE1 A;  2E65 A;  1VQ9 A;  2EAY A;  3BW1 A;  5D6Y A;  4X34 A;  1U1T A;  3OYG A;  2LX9 A;  4KBM B;  4F7U E;  2LVM A;  3G71 T;  1KQS A;  2WSC E;  2DPP B;  4M77 F;  5FU7 C;  3OBY A;  3A8H B;  3CC4 T;  1KD1 C;  4PJO D;  5HK0 A;  2DXB A;  3A5Z B;  1VQK T;  2R5M A;  5CKB A;  4J6X A;  4C8Q C;  3JB9 G;  4IUT A;  2RA2 A;  3QHS A;  4E7J A;  2VUB A;  2K5L A;  2O01 E;  2R57 A;  3GNF B;  3HL8 A;  4XTV A;  2JZ2 A;  3CCS T;  1I81 A;  2E64 A;  2CS7 A;  3HHT B;  1Y7X A;  4O6J A;  3RUX A;  2OTL T;  4M7A G;  4M7D C;  1M8V A;  3P8B B;  4OP0 A;  3CCM T;  4ZTF A;  2DK3 A;  5IN1 A;  2E70 A;  4ZGJ B;  5GAO n;  2P4T A;  3UWN A;  2AHJ B;  5GAO r;  2RHZ A;  3BY7 A;  4QQG A;  3V7R A;  4ZGE B;  4ZN3 A;  2ZPG B;  1Q82 U;  4FU6 A;  2V8I A;  5EG2 A;  1WJQ A;  4BE0 A;  3JCM g;  2ZGW A;  3QZ5 B;  5J3B A;  3CMA A;  3BDL A;  3P8D A;  3HKS A;  1KQS S;  1U8R A;  1K9M C;  5FU6 C;  3GPL A;  5CIU A;  2YHT A;  3CCV T;  2KY9 A;  3QDR B;  3SWN B;  4J5Y A;  5GAN e;  4N4H A;  3CCU A;  4ELY C;  4A4E A;  4XTU A;  1QP3 A;  3H6Z A;  3L2Q A;  3DLM A;  3QYH B;  2XDP A;  3NFC A;  4PLL A;  3OMG A;  5GMK h;  3GF5 A;  3L1A A;  1K8A C;  3RMS A;  2RJF A;  1YJ9 A;  2VXE A;  3VKI A;  4J6W A;  4Q5W A;  3G6E T;  2HAX A;  2DO3 A;  4RKU E;  4B9W A;  4M7A F;  1U1S A;  4M7D G;  2XHC A;  2YRV A;  5LJ5 h;  1VQ9 T;  5HK3 A;  3CCJ A;  1JJ2 A;  2C06 A;  1G3S A;  5GAM h;  4DA4 A;  4XK8 E;  1VIF A;  4WF2 A;  1Y96 A;  4XU1 A;  4PJO C;  3VU3 C;  1M9S A;  2EIF A;  1KQ1 A;  3T9N A;  3N5B B;  4A53 A;  4ZN1 A;  4A4H A;  2D0Q B;  2E10 A;  5LJ3 j;  1Q7Y C;  4J83 A;  3ASK A;  4OB3 B;  4XAX B;  2Y4X A;  1VUB A;  2KK4 A;  2LT4 A;  1B34 A;  4EDU A;  5KCH A;  3TCJ A;  3JCM e;  1M1K C;  1VQ8 A;  2XD0 A;  2ZPI B;  3LW5 E;  3MCA B;  2P0P A;  3H8Z A;  4RG2 A;  1KHI A;  2DKG A;  4C5I A;  4E47 A;  5CK9 A;  2OAU A;  3RKX A;  3F70 A;  2GF7 A;  3CCQ T;  3DB3 A;  3R6O A;  2M9U A;  2P0Q A;  1N9S A;  2O4X A;  3E9G A;  2CZ7 B;  3L2Z A;  4C8Q F;  2CZ1 B;  4M75 A;  1N9R A;  4LD6 A;  5KCO A;  3MO8 A;  4GLK A;  2E6Z A;  1BIB A;  5LJ3 d;  4JRQ A;  4C92 C;  3JB9 D;  3CMA T;  4M7D F;  4FT4 A;  3URG A;  3GNG A;  4HT9 A;  2RI5 A;  3GLX A;  1NPR A;  4HCZ A;  2DD4 A;  3VV0 A;  2QA4 A;  4PJO G;  1IZ6 A;  1OZ2 A;  4XTX A;  2BUD A;  3CD6 A;  4MMK A;  3CCU T;  3PTA A;  1D3B B;  3QG1 A;  2MMP A;  4M75 E;  4X9C A;  3OW2 A;  4LDW A;  1YJ9 T;  1VQN A;  3UPU A;  3FJP A;  1WPY A;  3AHU A;  2L89 A;  4BDY A;  1PSE A;  5D6W A;  1H64 1;  3CCJ T;  1QP2 A;  4EMK C;  1KQ2 A;  3E9F A;  5KE3 A;  3G7Z A;  2LT1 A;  3X25 B;  4C0G A;  3C4S A;  2RK1 A;  3QJY A;  5A0D A;  1EIF A;  3GIB A;  5LJ3 g;  5LJ3 f;  3V7C A;  1VQ8 T;  3QJ6 A;  2RHX A;  5D6X A;  2QTX A;  4KT0 E;  2F5K A;  4PJO F;  3CC2 A;  4DQ2 A;  2R5A A;  1YIJ A;  4ATO A;  4A4F A;  2VGM A;  1KHC A;  1O75 A;  4M7A E;  3ZEH A;  2LC4 A;  2WAC A;  3CBM A;  2VXF A;  1HXD A;  5GAN d;  2X4Y A;  2QDY B;  3OYN A;  1G3W A;  4N0A A;  4HT8 A;  2DAQ A;  1JBM A;  1QVG S;  3CME T;  4QVD A;  1MHN A;  3CCE A;  4L6V 5;  4EMH A;  3NTI A;  3RKW A;  1NZ9 A;  2MF2 A;  3JCM Q;  1N8R C;  1VQP A;  4F7U A;  4PNO A;  4OGE A;  2QA4 T;  1Q86 U;  4N4I A;  2QEX A;  3CD6 T;  2RHU A;  3OYY A;  3SDZ A;  1G3T A;  1BKB A;  4C92 F;  1VQL A;  2OTJ A;  1FX7 A;  3LWI A;  2G3R A;  3SWN C;  4BUG A;  2K57 A;  1VQ5 A;  1XNI A;  4C8Q E;  3JCM d;  1VQN T;  5L8R E;  4C5G A;  1Y96 B;  3HFN A;  1BIA A;  3EFS A;  3G4S A;  3GOX A;  4LD9 K;  1ZBX A;  2CZ6 B;  2K4Y A;  2JUF A;  1WJR A;  3WVE B;  4M7D E;  2WSF E;  4Y28 E;  2DD5 A;  3QO3 A;  5GAN 6;  5C0M A;  5GAN g;  5HY6 A;  5GAN f;  1B34 B;  3ME9 A;  3MEW A;  2PUK B;  4JLG A;  1W2B S;  1X6O A;  1YBY A;  1Q7Y U;  3OYC A;  2BIV A;  4FL6 A;  2JNG A;  4OF1 A;  2CYZ B;  1O9S A;  2L3R A;  3FDR A;  1M1K U;  5FRN A;  4ZTJ A;  3CC2 T;  1Y71 A;  2O4X B;  4P5N A;  3PIP A;  5CKD A;  2PQW A;  5LJ5 e;  2HQX A;  4M75 B;  3CCR A;  1YIJ T;  5CR2 A;  5LL6 S;  1BI1 A;  1BYM A;  4NS5 A;  4OVA A;  4LDU A;  1XQH A;  3EFR A;  2E41 A;  3PT9 A;  3V7S A;  4M78 A;  2P0K A;  4PKC C;  3JB9 I;  4C0Z A;  3JCM f;  5GAO m;  3KUF A;  1I5L A;  2XIC A;  3MET A;  3CCE T;  2ZCF B;  2X4J A;  4QW2 A;  3OYM A;  3JB9 H;  1JB0 E;  4LDY A;  1OZ3 A;  1S72 A;  2EJ9 A;  4HA8 A;  5CAI A;  1VQP T;  1OYX A;  2QQR A;  3INZ A;  2LQ8 A;  2XK0 A;  4C0D B;  2QEX T;  2X4W A;  3TRE A;  2PVG B;  4Z02 A;  3JB9 F;  3SFM A;  4RCC A;  4M78 E;  3M4Y A;  5CQX A;  1VQL T;  2OTJ T;  3MHX A;  5CKE A;  1M90 C;  4RCB A;  1YJN A;  1VQ5 T;  4BD3 A;  4C0F A;  2QQA A;  4C92 A;  2DXC A;  2DTI A;  4N4G A;  3FLG A;  3L2R A;  2DIQ A;  2M0O A;  4KUL A;  3FC3 A;  1BI3 A;  1UGP B;  2RH2 A;  2LDM A;  2Y90 A;  4PL6 A;  4QVC A;  2EKO A;  4IUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...