2JUOA

Gabpa ost domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
89
structure length
89
Chain Sequence
MAECVSQAIDINEPIGNLKKLLEPRLQCSLDAHEICLQDIQLDPDRSLFDQGVKTDGTVQLSVQVISYQGMEPKLNILEIVKTAETVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and structural characterization of a CBP/p300-binding domain from the ETS family transcription factor GABP alpha
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords GA-binding protein alpha chain
total genus 14
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2007-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11620 GABP-alpha GA-binding protein alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2juoA00
1J19A 3QAQA 1WJNA 1WJUA 3WAOA 1WR6E 3DBSA 2MBOA 3DVNV 4GMVA 4BKSD 1A5RA 2ASQA 3ZDMC 3ZNHB 1LQBA 4BFRA 4WJNA 5D94A 4PS8A 1TBEA 1NDDA 3HIZA 2LGYA 3T8MA 3L10B 3DCGA 3ZTCA 1V80A 2DHZA 1H8CA 2KJRA 4MSMB 3M63B 1WMHA 2JY6A 3L08A 2RGFA 1PQSA 1BT0A 1MG8A 3DBRI 2MA9B 3KW5B 4A20A 2KDBA 3OLMD 3C0RB 3V60A 3AU4A 3SHQA 3TL5A 4ICUA 2DX5B 2XK5A 3PHXB 5HKHA 1E8XA 1WH3A 2KDFB 2M17A 3VHTC 2PE6B 3BY4B 3TBLD 2MBQA 1OEYJ 3KUZA 1IPGA 1WYWB 1HE8A 3DQVA 3BINA 4DHJB 3ZRCA 4B95A 3IFWB 3RT3B 2IZVB 3ECIA 3QWZB 3NZSA 3S2AA 3P2BA 1WXMA 3ZUNA 1Q5WB 3DBLI 2MW5A 2BPSA 3CSTA 4XX5A 3W1SA 4ZYNA 5DPTA 3JW0X 2AEHA 3JSVA 2D10A 5CHWA 2JF5A 1RRBA 3MJWA 3PLVA 5DCNA 4CHKA 2KC1A 2ZVNA 4WQOB 4GN1A 3ZRFA 2KMAA 5LXIB 1Q0WB 2KNBA 2AWTA 2BYFA 4OVVA 1V6EA 4WWPA 4ICVA 2N9EB 4EUTA 3PLUA 4RM9A 2KJHB 1WX7A 2LGXA 3TCAA 2LVPA 2IY0B 1SE9A 1YIWA 4GU2A 2N1WA 3QCAA 4W9IA 2M8SA 1GUAB 2N1VA 4WJQA 1ISNA 3TMPB 3R7QA 3KH0A 3VTUA 1Y8RC 4MJSB 4BOSC 4EEWA 1K8RB 2CS4A 2ZJDA 3PVLA 5BO4B 5J18A 3QA8A 2OOBB 3NY5A 2MBEA 1V9JA 1GC6A 2GMIC 2DYOA 1YD8U 3UF8A 5J2RA 3OJ4B 4JIOU 3PRMB 2N9XA 3L54A 1XQQA 4FBJB 1I42A 3ZNID 1KLVA 3VTVA 1LXDA 2UWQA 2BYVE 2ZNVC 4B9KA 4G11A 1V86A 2FCNA 1V49A 2MSED 2PE9A 2IO0B 2QHOA 2L0FA 4HXDA 1UELA 4WAAA 3ZLZA 4TQ0A 4W9HA 1P3QU 2KTFA 4TUUA 4AP4C 2KWCA 3VXWA 2NCNA 3NS8A 4LJPB 2LRUA 4MH0E 1IYFA 1OTRB 2WX0A 4KSLC 2GBKA 1GC7A 2KX0A 3L16A 2RSUA 1WGDA 2ZZPB 3DPDA 2DZKA 3CSFA 3PRZA 3A9JA 4NQKE 1NI2A 2LI5A 2KZRA 5KHOA 2GBNA 3A1QA 2O6VB 4HPLB 4K81A 5L95C 2KTRB 3GOEA 1OEYA 2HE7A 2DZMA 2LJ5A 4IC7B 2J7QB 2LGDA 2G4SA 1WMHB 2WWZA 3LJ3A 3EC8A 3UQBA 2MX2A 2W9NA 4A3OA 2LZ6A 1WGYA 2KFKB 4ZRIA 1I35A 5IA7A 2IO3B 4ZDVA 4E3CA 2XK5B 1WJ6A 1WZ0A 3ALBA 2WDTB 1E90A 3QJZA 4K1RB 4KVGB 3UIOB 2V3SA 2RD0A 4DHZB 1EF5A 4XZ4A 2KDEB 3DOWA 3ZIMA 4W9DA 1R4NI 4HCPB 3RD2A 4JLCA 5GMVA 3TIXA 2N7DA 1E8YA 2KK8A 4PYUA 3NZUA 5TR5A 2N7EA 2JT4B 3IG3A 3R3MA 4FJVB 2XEWA 3JSVB 4GGQA 4ZRJA 3W1YA 3I3TB 4TKNA 3OJ3A 4FADA 3PREA 5CX3A 5IAAC 2IY1B 3NHEB 4AUQC 2LUEA 3PRPB 3VAWA 2AL3A 2KWVB 3DVGX 3N30A 4MEMA 2YVCA 4DDID 2AL6A 4KIKA 3SD5A 2KFJA 4JL9A 2L05A 4K7SA 3PS6A 4IUMB 1J8CA 1V81A 2G3QB 2ZCBA 4WJOA 2LWPA 1P98A 4LDTB 5LXHA 3ML8A 4GB9A 4MJSA 2K25A 4X57B 2GOWA 2NBVB 4HPMB 3JVZX 2ZEQA 4NJ6A 2HJ8A 4IW0A 4LCDE 1Z2MA 3VH3B 2KANA 1OGWA 4BBNC 2G4DB 1TGZB 3QQ8B 3APDA 1E8WA 1YJ1A 4W9FA 2Y5BB 4F1SA 2C7NB 2JPHA 4EZJA 3EECA 3UIPB 3WALA 2PPHA 3A1QB 1UH6A 2BWES 2NBUA 2FCMA 1TTNA 4GDLA 1V5OA 3H7PA 4W9CA 5D7GA 1H4RA 4FJYA 1WGGA 1WXSA 2LVQA 3X0WA 2N9PC 2K8HA 2O6VD 3IBEA 3OAWA 4MGYE 2J0MA 3ZW3A 1EO6A 3V6CB 2JXXA 2KHWB 3EFUA 1WM2A 2CHZA 1ZGUB 1ZW7A 3VTWA 4IWQA 3X23A 1QZEA 2D07B 2KO3A 3B1LX 2DAJA 5AZFA 4DXAB 4I6NB 2C7MB 4JGHB 3U7DA 2MBHA 5CHVC 4YL8A 2M4NA 2FCSA 1G6JA 2UYZB 4W9GA 2MWSB 2Z59B 4MDKE 1TZ1A 2DENB 2PEAA 2KKCA 1Q1OA 4GSWA 2G45B 4KZCA 4DBGA 2DYMA 2K6DB 2MCNB 1EUVB 5G55A 4E74A 4BKGA 4URKA 2LD9A 2J0KA 2C7HA 1WM3A 3MHSD 2NR2A 5KHQA 5J17A 1E5WA 2D2QA 2MRPA 4JQWC 2NS5A 4ANUA 2D3GA 2R2OA 2BF8B 2GBRA 3WANA 3O65B 3ZDTA 2ZNVB 1L7YA 4B6WA 3AU5A 3CMMB 3V61A 3M3JA 1E7UA 4NPNA 2ZPYA 3A9KA 3WIMA 5EDSA 4KZ0A 3B08A 2HTHA 4J6IA 4II3B 1LM8B 5DPSA 4DWFA 3PHWB 4MSQB 2I1KA 3ZNGC 4BKSA 2C60A 2JRHA 4FHKA 2N4FA 3RZFA 2M0XA 2C5LC 4DK5A 1S1QB 2KVRA 2I1JA 3LDZE 1WGHA 1WY8A 2KFKA 3N32A 3PV1A 3RCZA 2LRWA 2Z0DB 1U4AA 2BKRB 3PSEB 4KIKB 4RMAA 2IO2B 5CTRC 3SDLC 2MP2A 4F8CB 3A9JB 4ANVA 3H7PB 2LASA 3DVNU 3WA0A 2IO1B 1J0GA 1AARA 2JVCA 4DDGD 3ML9A 1WGRA 5AZGA 1WX8A 2CKHB 3K9OB 2JZZA 4FN2A 4K7WA 1YQBA 2C9WB 3PT2B 4FA6A 4FULA 2EKEC 2V4LA 4HCNB 4CO7A 1D3ZA 4HVBA 4M0WB 4HLEA 4II2B 3ZKJC 2RPQA 2KLCA 3H1UA 3K9PB 4A3PA 3VUWA 2PJHA 3VVWB 2L3ZA 1LFDA 1S3SG 2NPTB 4MGKE 2DYBA 2LVOA 2NVUI 2DZIA 3IHPC 3KYDD 2L0TA 2FCQA 1E8ZA 2RR9A 3HM6X 4OVUA 3ZTDA 4PYZA 4NAWB 1VCBA 3H9DA 3UQAA 1GG3A 3D32A 2JRIB 1Z5SB 2FIDA 2LXCA 3ZO5B 1UD7A 4HJKA 1WIAA 1WZ3A 1P9DU 4GDKA 2CHWA 1L2NA 2ZVOA 1WR1A 4CYEA 2DZJA 2JZ3B 5JZEB 3L0WB 3A9KB 4I6LB 3VUXA 3ZNZB 2KMCA 4MGZE 4IM3A 3Q3JA 1V5TA 1UZXB 4KSKC 5DPWA 2KOXA 5JH5C 2L7RA 2A4ZA 2KC2A 4E71A 2KD0A 2KXJA 2NBWB 5E6NA 5D6JB 4W9EA 3H7SA 1EF1A 4FJZA 2IYDB 3AI5A 3APFA 3N3KB 1GJZA 4FLHA 3IVFA 4AWJA 1E7VA 3VH4B 3RYTA 4GDLB 2K8CA 3U8ZA 2K8BA 2K1FA 5D2MB 3RUIB 3VFKA 3PGEA 4M8MA 2K6QA 1WXAA 2O2VB 3KVFB 4FHJA 4NQLB 3VQIA 3RULA 4BKTA 3A33B 4PS3A 3PTFC 4BBNF 1JRUA 1P0RA 4GXBA 5JHAA 3A4RA 4IG7B 4KV2A 2JUOA 4IWPA 4NNJB 1VD2A 3TJPA 3NOBA 4LJOB 2FNJB 4LDTD 4AJYB 2HD5B 1WX9A 3M95A 4HDQA 3GZNI 4DHZE 4AJWA 1R4MI 3QHTA 2KDIA 4KDIC 3R66C 2YLMA 1KJTA 2ZCCA 1KOTA 3DVGY 4G0NB 3V6EB 2VRRB 3KUCB 2GBMA 4K7UA 1FXTB 4ASWC 2D11A 3PZDA 4WWOA 2AYOB 4ZRKA 3R7RA 4NAWA 2KQ7A 3CF6E 4TV3A 1RLFA 4HK2A 2KX3A 2EMSA 4EZLA 1UBIA 3B0AA 4WWNA 3QK0A 2BGFA 2KWUB 1KM7A 4G50A 2V1YA 3ZVVA 4IM0A 4F7ZA 2DAFA 1C3TA 4AOFA 1F9JA 2ZPNA 5E6PA 2NPTA 2A5UA 1WFYA 4N9F4 4MGIE 3WAPA 4MELA 2FAZA 3L17A 1P1AA 5LLIA 1WI0A 2KJ6A 4KDLB 3WAMA 4EFOA 1RFAA 4NY0A 3Q3FA 3M62B 3QARA 4HDOA 3APCA 2GBJA 3H6NA 3QIJA 2CU1A 1M94A 5AZHA 3ENEA 4MM3A 1V2YA 1WXVA 1YX6B 4WJPA 2MQJA 5L83A 1IP9A 3SU8X 5DPRA 5C23A 1C1YB 3T9LA 1WF9A 2LXAA 5FR6A 3HM3A 5C1ZA 4W9JA 2Z0EB 3PPAA 1OQYA 2KQSA 4PS7A 2MP2B 2MLBA 1NBFC 2CHXA 2KTRA 3EHVA 3KUDB 4GOCA 4P7IA 4W9LA 2BWFA 1UGMA 3VUYA 1RAXA 3VDZA 2MBBB 2FUHB 2KLGA 5G2NA 2L76A 3KYCD 1SIFA 2WX1A 1WJ4A 3L13A 3QX1A 1WRDB 1XT9B 4GIVA 4G3XB 3QC8B 3ONSA 3UGBB 4ANWA 1GNUA 2L00B 2REXA 4EOYA 3RZWC 4BOZB 2CR5A 2O6VA 2OJRA 2J0JA 4M8NA 4DHJD 1YX5B 2BYEA 3AULA 4BVUC 1XD3B 2BKFA 4ANXA 1UBQA 2JWZA 4W9KA 4I6PA 2O2VA 3DDCB 1CMXB 4RM8A 4GDKB 2L8JA 3DBHI 4EZKA 5JHBA 3A4SC 3JYUA 2KN5A 4HWIB 4XC2A 3U30A 2K39A 3HHMA 4IWOA 5AEKB 4NJ7A 1WE7A 2FIFA 2IBIB 1ZKHA 3UINB 3W1SC 1X1MA 2R2QA 1SGHA 3MTNB 5CHFA 3AXCA 3V62A 2B3AA 3HK0A 1T0YA 5E6OA 2M1MA 2EMTA 2WYQA 4IM2A 4TQ1A 4EKUA 2XBBC 1WE6A
chains in the Genus database with same CATH superfamily
1WJNA 1WR6E 3RNCC 1A5RA 2ASQA 3ZDMC 1UWMA 5D94A 3HIZA 2LGYA 2KQ4X 2DHZA 4WIPA 2MH7A 3M63B 4JPSA 3DBRI 4A20A 1L0VB 2LGSA 3C0RB 3V60A 3AU4A 1WXQA 1WWTA 2IJ0A 3Q8EA 2DX5B 3PHXB 1SIJA 1JQ4A 3AM9A 4LK0M 2RDHA 3TBLD 3DQVA 2IZVB 4B0EA 3QWZB 3NZSA 3TSSA 3CSTA 3W1SA 1TJEA 4ZYNA 5DPTA 1PYWD 2W3RA 2JF5A 5DCNA 4CHKA 2KMAA 4A90A 2AWTA 3VR9B 1V6EA 2QJLA 4ICVA 2N9EB 3DBHB 3N20C 2RDGA 2JX5A 1HTQA 2N1WA 1GUAB 2N1VA 3VTUA 4BOSC 4MJSB 3RFZB 1K8RB 5FR3A 3QA8A 4DXGA 2GB1A 4KX6B 1F0ZA 2JZPA 3PZ7A 1XQQA 1I42A 4YTPB 1I4HA 2N7JA 4P1CC 3ZNID 3VTVA 1UWXA 4G11A 1V86A 4HXDA 1ET6A 2PE9A 3ZLZA 5BYSA 2DNFA 4TUUA 4ZYSA 3NS8A 1IYFA 1OTRB 3V05A 2N9KA 4RGNA 2INDC 2ACZB 2KZRA 5KHOA 5L95C 4K81A 2DZMA 2LJ5A 2KWDA 2G4SA 1WMHB 3RNAC 5EE1A 2M0AA 1WGYA 1F52A 1VZ6A 1EWYC 4E3CA 1ESFA 3AV8A 1BXTA 2RD0A 2W82A 1EF5A 3TIXA 1WSPA 2R61A 3NZUA 1YQ3B 2PKOA 1YN3A 4ZRJA 3W1YA 5I4DA 4XWTA 2V9HA 3PREA 4AUQC 3PRPB 1FD6A 2EELA 5BYQA 3UI3A 3NVWA 2KFJA 4JL9A 2L05A 1TKYA 4IUMB 4K7SA 3W9CB 2G3QB 2ZCBA 4WJOA 4XDCA 3ML8A 1ZUD2 2WHIA 2HJ8A 2KANA 2G4DB 2INPE 1E8WA 4F1SA 3EECA 3WALA 5CHFA 4GDLA 1V5OA 4W9CA 2L1AA 4FJYA 1WXSA 1NYQA 2N9PC 1FEHA 2K8HA 2O6VD 3IBEA 4YTNB 2WXKA 1EO6A 2CHZA 1ZGUB 3NVVA 2BT6A 3X23A 3IT4B 4IKGA 4I6NB 3U7DA 2JQRB 2MBHA 4YL8A 1HQRD 2FCSA 3BIID 2Z59B 4MDKE 2G45B 3AE2B 5G55A 4BKGA 3MHSD 5KHQA 1V97A 5J17A 1YNTE 2NS5A 2D3GA 2J53A 4YT0B 2R2OA 3WANA 3ZDTA 2ZW0A 2EKIA 1N5WA 1L7YA 4B6WA 4RF1A 1E7UA 2ZPYA 1N63A 3A9KA 4KZ0A 1OQRA 3PHWB 2FE8A 1GPXA 2M0XA 4US9A 4MACA 2KFKA 1U4AA 2BKRB 4KIKB 4RMAA 2V3PA 4AS1A 2IO1B 1J0GA 4EE2A 4LNFA 2ZW1A 1GAQB 1YQBA 3NVZA 1KLUD 4NAMA 3PT2B 3NJTA 1MPEA 4FULA 3SEBA 4HLEA 1QOGA 4YSXB 1YJJA 4L2YA 2WXQA 2NVUI 3NS1A 2K22A 3OWEB 4MM3B 1QLBB 2M56B 1ET9A 2PW9A 1PDXA 4GDKA 2BB6A 1JCKB 3RN9C 1WR1A 2FBWB 5FK9C 3EGRA 1ZP0B 3Q3JA 1V5TA 1UZXB 1JRPA 2L7RA 2KC2A 4E71A 4C80A 2KXJA 2NBWB 5E6NA 2WXLA 4C7YA 5D6JB 2WXOA 3N3KB 3EUB2 4GDLB 3OG5A 2WDRB 3BYYB 1JWUD 5BMGA 4NQLB 1WXAA 2O2VB 3KVFB 4BKTA 4PK1A 3RULA 3PZ8A 3PTFC 4GXBA 4KV2A 3NOBA 5C2TB 2YEPB 2VZKB 4LJOB 1WX9A 3GZNI 1QOFA 1R4MI 4AJWA 1CZPA 4S17A 1C4CA 4ASWC 1TYGB 2AYOB 4OHJA 1DYQA 1JWAD 1RLFA 1T3QA 2WXFA 2UU7A 4EZLA 1D5MC 3QK0A 2KWUB 4G50A 2V1YA 3ZVVA 4F7ZA 3DWGC 2A5UA 3WAMA 1D5XC 4NY0A 2SAKA 2IGDA 3H6NA 4ARIA 1WXVA 3HVDA 1C1YB 3AEBB 3Q8AA 4WQMA 2K5PA 2KQSA 4PS7A 3KUDB 3EHVA 4M0WA 2KTRA 4GOCA 2QIEB 1JWMD 3VUYA 4OW0A 3VDZA 2KLGA 2L76A 2BVCA 4WAFA 3Q69A 4OZCA 3QX1A 4NZLB 3ONSA 1WYGA 4ANWA 1GNUA 2REXA 3RZWC 2J0JA 4A8XC 3LXFA 2JWZA 4XDDA 5D3DA 3P42A 2L8JA 3DBHI 1DOYA 2JU6X 2KN5A 4FXCA 4NJ7A 1WE7A 3W1SC 2OEDA 3MTNB 1HA5A 3I5JC 3TEYA 2M1MA 1B1ZA 4EKUA 2XBBC 3AE9B 1J19A 3ABVB 1Y56A 3QAQA 1WJUA 4KGRA 3WAOA 5GXGB 5IO9A 3ZNHB 1VR9A 3I9V1 4WJNA 3T8MA 3L10B 2Z8LA 1V80A 4S0RA 2KJRA 1WMHA 2D5GA 2RGFA 1PQSA 1MG8A 3KW5B 2KDBA 4C4VA 3SHQA 5HKHA 2X8XX 3AE8B 2KDFB 3Q3OC 1XLOA 1CK1A 1OEYJ 4YXDB 1IPGA 1WYWB 1JALA 4US8A 1SXTA 3IFWB 3RT3B 3P2BA 4USAA 1GB4A 2BPSA 1T6BX 3J9CA 2D10A 1RRBA 3PLVA 1HEZE 2ZVNA 3FAHA 2PVOD 5LXIB 4GN1A 2KNBA 3AEAB 2BYFA 4OVVA 5IP4D 4EUTA 3PLUA 4RM9A 2LGXA 1WX7A 4IDIA 3TCAA 2LVPA 1SE9A 4GU2A 3FC4A 3KH0A 3Q6BA 3U52E 1ZXIA 2CS4A 4OVZA 1STEA 1FNUA 2IGHA 2OOBB 1I7HA 4P1BC 5LNK1 4JE3B 3GS2A 2MBEA 3UF8A 3OJ4B 3PRMB 3RNEC 4FBJB 2LUMA 2ZNVC 4B9KA 1XCTL 2L0FA 1RM6C 3L4PA 3AEDB 4L23A 3NUHB 2KTFA 3ZQ4A 2KWCA 1YN4A 4Q2JA 2CJNA 5AUKA 3KWLA 1QQRA 2ZZPB 3CSFA 2H88B 4N6EB 2GBNA 4IC7B 2I38A 1BMLC 2MX2A 1V1PA 4A3OA 4ZRIA 4CQNA 5IA7A 2IO3B 4ZDVA 2WDTB 1E90A 2I2YA 3U2SC 2WU5B 5H8YE 3UIOB 2V3SA 2K9XA 2KDEB 1FXIA 4REZA 1R4NI 4HCPB 1E8YA 4PYUA 4YSZB 3DHGC 2N7EA 4FJVB 2XEWA 2L32A 3N1ZC 4TKNA 3OJ3A 2IY1B 2IGGA 2AL3A 2KWVB 2L52A 2YVCA 4DDID 4KIKA 1R4NB 3PS6A 1D4BA 4LDTB 3AMZA 4GB9A 2GOWA 1EM7A 4HPMB 2ZEQA 4IW0A 4LCDE 2AX5A 1OGWA 3CIRB 2WU2B 3B2GA 3APDA 5IN7A 2Q5WD 2C7NB 2JPHA 4EZJA 3UIPB 3A1QB 2KYWA 2FCMA 3U7ZA 1QF6A 1H4RA 1SEBD 2JYTA 1FMAD 2JXXA 4IWQA 2D07B 3VRBB 1FO4A 5MPOA 2WDQB 4DXAB 3C19A 5CHVC 2BW2A 2B76B 2MJ3A 1G6JA 2OJWA 1PGBA 1CJEA 1JW9D 2DENB 3BWUD 4KZCA 2DYMA 4UDUC 2LD9A 1WM3A 1F77A 2NR2A 1KLGD 2KACA 2D2QA 2MRPA 4JQWC 3AE3B 3P4QB 2BF8B 3I63C 3O65B 3FKYA 2JXTA 4BAXA 5H92C 2ICIA 2K3UA 4WURA 3V61A 3M3JA 4NPNA 2KDMA 4DWFA 4BKSA 1UNSA 2I1KA 3ZNGC 2JRHA 2QSDA 2N4FA 2C5LC 1WY8A 3N32A 4YTMB 1ZXHA 2LRWA 2KVZA 3PSEB 3ZGZA 1E10A 4TMAB 1K51A 2LASA 3WA0A 1AARA 2INCC 2JVCA 2JZZA 4FN2A 2MHJA 4ZRQA 3AEEB 1NENB 4LNKA 4FA6A 2LFIA 2EKEC 2V4LA 4CO7A 3TUOA 3AE5B 2KLCA 1YQ4B 3VVWB 1FIQA 1LFDA 2NPTB 4MGKE 3RNFC 3ZJUA 2HDEA 1E8ZA 4NAWB 1VCBA 1RYJA 3UQAA 2IPKD 4R3DA 3D32A 1TS3A 4HJKA 1L6VA 2CHWA 2PIAA 2ZVOA 1L2NA 3L0WB 3VUXA 3ZNZB 2QMTA 2WNMA 5TSSA 3AEGB 3R2IA 4KSKC 5DPWA 1T0RC 5JH5C 1VJKA 4W9EA 1DOXA 3H7SA 3ZJTA 4FJZA 3APFA 4FLHA 1IBXA 1E7VA 2K8CA 4PT5A 2LJIA 5D2MB 3RUIB 4QAYA 3VQIA 4PS3A 2WXNA 1XLPA 2JSVX 5JHAA 3A4RA 4IWPA 4NNJB 5C3JB 4RGTA 1JWBD 1V1OA 1E9MA 2YLMA 3Q3NC 1AWDA 4WWOA 4WWNA 1OQQA 1C3TA 4IM0A 3P4PB 4AOFA 2VH2A 2ZPNA 1VDVA 5HFYA 1WFYA 4C4VB 4MGIE 3WAPA 1QOBA 4MELA 1E7PB 4KDLB 3M62B 4HJGE 4HDOA 3APCA 1UGJA 1M94A 3ENEA 4MM3A 2M19A 4WJPA 1MHXA 1IP9A 3SU8X 2V4IB 1WF9A 5FR6A 2Z0EB 4RH6A 1NBFC 2CHXA 2MLBA 1MVKA 4P7IA 4W9LA 2BWFA 1UGMA 2WXMA 3R2TA 2MBBB 3Q3MC 3KYCD 1SIFA 1SBBB 1XT9B 4G3XB 3QC8B 3AEFB 4EOYA 2DLBA 1WGKA 4BOZB 3NVYA 1M4VA 4ANXA 3AE7B 4HWIB 4TSSA 1VRAB 4IWOA 5E6JA 4BZAA 2IBIB 1ZKHA 3UINB 2QILA 2WQYB 3BYTB 3V62A 1IGCA 2RPVA 4TQ1A 3RD2A 1L5PA 1WE6A 2MBOA 4GMVA 5FKAC 4BFRA 2WXGA 4KKIA 1I4RA 2WXJA 4MSMB 5BYRA 1B9RA 3L08A 1NEKB 4P16A 2MA9B 4RNAA 1QT9A 1AN8A 2J52A 3OLMD 2N0SB 4ICUA 1I4QA 2XK5A 4K3CA 1E8XA 2D3CA 1N61A 2M17A 3EFCA 1SJHD 2PE6B 3BY4B 1SSNA 3KUZA 3MC0B 1HE8A 2JYEA 1YMHE 1WXMA 3DBRB 3DBLI 2MW5A 4XX5A 3JW0X 2AEHA 3JSVA 1FCLA 3MJWA 2KC1A 4WQOB 3ZRFA 1KFYB 3ZJVA 3MJ5A 4WWPA 3I57A 2KJHB 2IY0B 4W9IA 5HI1A 3QCAA 4WJQA 3TMPB 1ISNA 4LTUA 3R7QA 1Y8RC 4XWWA 4ACFA 3FILB 4RCOA 4ZOHC 3EA6A 3PVLA 5BO4B 5J18A 3NY5A 4JWSC 2KMMA 1GC6A 2GMIC 5J2RA 1XF5L 1KLVA 1TS4A 2FCNA 1V49A 2MSED 2QHOA 2IO0B 3GB1A 2Y5PA 1UELA 1N5XA 4W9HA 2NCNA 4LJPB 2LRUA 4KSLC 2WX0A 2GBKA 2KX0A 3DPDA 3PRZA 4NQKE 5EE9A 3HUIA 3KLSX 3A1QA 2O6VB 3GOEA 2HE7A 2J7QB 2KT7A 2WWZA 3UQBA 4XGAB 3TEXA 4DXFA 3BVMA 2W9NA 1PFDA 1TY2A 1I35A 1K52A 1L0YB 1KH0A 1YOVB 1WJ6A 3ALBA 4RGOS 2WP9B 1L0XB 3QJZA 4K1RB 3MP9A 4KVGB 1TKGA 3VR8B 4JWUC 1ZDXA 4JLCA 2W3SA 5TR5A 2JT4B 2X38A 3IG3A 3LB8C 3R3MA 3I3TB 2GRIA 4FADA 2WXPA 1F2RC 2LUEA 3VAWA 3SFEB 4MEMA 1C79A 1JMLA 3SD5A 3Q2AC 3DWMA 1L6UA 2LWPA 1P98A 2RDBC 2K25A 4X57B 2OHFA 2NBVB 2BTEA 3JVZX 1Z2MA 3VH3B 4BBNC 3QQ8B 3AN1A 1YJ1A 3IAM1 1YN5A 3IAS1 2Y5BB 4W9FA 1UH6A 2BWES 4LLGM 1TTNA 1TY0A 2JWUA 3X0WA 2LVQA 2QCZA 3T3NA 3ZW3A 2WXRA 1TS5A 2MJEA 3V6CB 1FFVA 1ZW7A 1HZ6A 3VTWA 1AYFA 2WDVB 3GP7A 1IBXB 2KO3A 3B1LX 2C7MB 4JGHB 1OFFA 2M4NA 2UYZB 1TZ1A 2PEAA 1Q1OA 2VH1A 3GE8C 2K6DB 1EUVB 3RPFC 2C7HA 4P6VF 2BBCA 4ANUA 1SB3C 1I4PA 1ZDVA 3E56A 1T5XD 2GBRA 5AUIA 2ZNVB 1MI0A 3O13A 3AU5A 2W55A 1SE4A 4LNOA 3WIMA 5EDSA 4J6IA 5DPSA 4HKQA 4MSQB 2C60A 4FHKA 3RZFA 1FPYA 2I1JA 2E3TA 3SFDB 3PV1A 2Z0DB 4MT5A 1VZ8A 5CTRC 2MP2A 2W54A 3U4EG 4ANVA 3H7PB 3TEZA 3DVNU 4DDGD 1ZOYB 1WGRA 4K7WA 3MC9A 2LHEA 2MEKA 3VRAB 1VZ7A 4HVBA 1LO5D 4N59A 3ZKJC 2RPQA 3K9PB 4L1BA 3VUWA 3AB5A 2L3ZA 1S3SG 1TS2A 2DYBA 2LVOA 2CU3A 1XLNA 3KYDD 2IDYA 2L0TA 4OVUA 3HM6X 4PYZA 3H9DA 1GG3A 1PUTA 4XYCA 3DBLB 1Z5SB 3Q8BA 1VLBA 2PMVA 2LXCA 2KN4A 1WZ3A 2VZKD 3P1MA 2BS4B 1K53A 2DZJA 1ROEA 2JZ3B 1HTOA 5JZEB 2KMCA 3MFGA 2BB5A 2KOXA 2RMMA 2A4ZA 2KD0A 3DHIC 1GOZA 1SF0A 1EU3A 2GLSA 3IVFA 3VH4B 3RYTA 1LGRA 2K8BA 2AQ3B 3VFKA 4ARCA 4M8MA 2K6QA 4FHJA 1SE3A 1E0ZA 4ZHOA 1JRUA 3AECB 3TJPA 4KGTA 4LDTD 4AJYB 1F2RI 4HDQA 4DHZE 2KDIA 4KDIC 3Q14C 3R66C 1KOTA 3DVGY 4G0NB 3KUCB 4K7UA 2D11A 3PZDA 1UUPA 4ZRKA 5IOIA 4NAWA 4TV3A 1DOIA 2EMSA 1J7BA 1K50A 1KM7A 2DAFA 2N9LA 2NPTA 3P4SB 1R4MB 4N9F4 4KKJA 3N1YC 1P1AA 4EFOA 2BS2B 3QARA 3H8HA 3QIJA 2CU1A 1PGAA 3RNGC 1MHHE 2MQJA 1FNWA 5C23A 3T9LA 2LXAA 4W9JA 3PPAA 1OQYA 2MP2B 2H89B 5G5HA 3B9JA 1RAXA 2FUHB 5G2NA 3ETRA 1WJ4A 2WLBA 1V1PB 1WRDB 4K3BA 1T0QC 3AH7A 3UGBB 3SR6A 3BVZA 1P7FA 4H2AA 1TKEA 2CR5A 2INNE 2O6VA 4M8NA 2AQ2B 2OJRA 3KQ4A 2D3BA 3AULA 3V3XA 2WXIA 1XD3B 3W5UB 1UBQA 4W9KA 4I6PA 3DDCB 1CMXB 5HHDG 3AE1B 5JHBA 3A4SC 3JYUA 4XC2A 3U30A 2K39A 2V3NA 2FIFA 2R2QA 2B3AA 2HTME 2K0PA 3HVZA 2EMTA 2WYQA 2LEKA 3DBSA 3DVNV 4BKSD 1LQBA 2Y3AA 1N60A 2ON8A 4PS8A 1TBEA 1HXYD 1NDDA 3DCGA 3ZTCA 1QKZA 1H8CA 1FRRA 2JY6A 1RWSA 1BT0A 2E6XA 1I4XA 3IT6B 3TL5A 2ONQA 1WH3A 1L4DB 3VHTC 4A9AA 2MBQA 3ZYYX 4DHJB 1XCQL 3BINA 3ZRCA 3NG0A 4B95A 3ECIA 4MH8A 3S2AA 3ZUNA 1Q5WB 1JROA 5CHWA 1MJDA 4HKZE 1BUIC 1Q0WB 2NTSA 5G5GA 1ENFA 3KWVA 3MC8A 1YIWA 2KAJA 2M8SA 4EEWA 1PGXA 2ZJDA 2XN9C 1ACCA 1V9JA 4N58A 3W5VB 4C7ZA 2DYOA 1YD8U 3DHHC 4JIOU 1NI3A 2N9XA 3BVGA 3L54A 4C00A 1LXDA 2UWQA 2BYVE 4WAAA 4TQ0A 1P3QU 3E9SA 4ZRPA 4AP4C 3VXWA 4MH0E 3P63A 4J3OD 3L16A 1GC7A 2RSUA 1WGDA 2DZKA 3A9JA 1NI2A 2LI5A 1FRDA 4HPLB 2KTRB 1OEYA 2LGDA 4DQOC 1ZE3D 3LJ3A 1NVID 2SEBD 3EC8A 3N1XC 3WCQA 3RI7C 4OZBA 2LZ6A 2KFKB 2LGIA 3AE6B 3PO0A 2XK5B 1WZ0A 4RGMA 4DHZB 4XZ4A 3DOWA 3ZIMA 4W9DA 2G1EA 1CQVA 1JWSD 5GMVA 2N7DA 2KK8A 2FUG1 4O1NA 4GGQA 3JSVB 4HPPA 1KTKA 1HZ5A 5CX3A 5IAAC 3NHEB 3DVGX 3N30A 2AL6A 1F1HA 1J8CA 1V81A 5LXHA 1TZOA 4MJSA 2TSSA 4NJ6A 1FXAA 1TGZB 3RNBC 3BK2A 1P7EA 2PPHA 2NBUA 4NJCA 5D7GA 1MFWA 3H7PA 2NTTA 1WGGA 2BS3B 3OAWA 1IUEA 4MGYE 2J0MA 2PVGC 2KHWB 3EFUA 1WM2A 3GE3C 1QZEA 3Q8CA 4A6QA 1ZPSA 5AZFA 2DAJA 4W9GA 2MWSB 3URYA 1E6EB 2KKCA 1FNVA 4GSWA 2LMCA 4DBGA 1DGJA 2MCNB 4E74A 4URKA 4M02A 2J0KA 3IXSA 1E5WA 4OZAA 2BYTA 3ZXRA 3CWIA 4YSYB 3W2DA 2AQ1B 1TIFA 3CMMB 2DBYA 3RMKC 3B08A 2HTHA 4II3B 1LM8B 4M01A 4DK5A 1S1QB 2BQQA 2KVRA 3LDZE 4IOIE 1WGHA 1D5ZC 5D3IB 3RCZA 4D2KA 1UF0A 2IO2B 3SDLC 4F8CB 3A9JB 1SE2A 4ITKA 2CJOA 4HRSA 2J42A 3LYYA 3ML9A 5AZGA 1WX8A 2CKHB 3K9OB 2NMQA 1L4ZB 4RFBA 2C9WB 3ZXVA 1TT5B 2YEPF 4HCNB 4M00A 1D3ZA 4M0WB 4II2B 1N62A 3H1UA 4A3PA 2PJHA 4GLSC 1GB1A 1R7SA 2DZIA 3IHPC 1XLQA 2FCQA 2RR9A 5BMIA 3ZTDA 1IGDA 1T0SC 4B0MA 4ZHPA 3TEWA 2JRIB 2PLPA 3NZ3A 2FIDA 3ZO5B 1UD7A 2WGSA 1WIAA 1P9DU 4CYEA 1MG4A 2MJDA 5T8IA 3A9KB 1N6ZA 4I6LB 4WWMA 5HG2A 4MGZE 3Q8FA 4IM3A 1D6EC 1V8CA 5BMHA 2PTLA 1EF1A 2IYDB 3AI5A 1GJZA 2QC8A 2WS3B 4AWJA 3U8ZA 2K1FA 1C9FA 3PGEA 3N9YC 2L83A 1SJED 3A33B 4BBNF 1P0RA 3MHZA 4IG7B 2JUOA 1VD2A 2FNJB 2HD5B 3M95A 5EE3A 3QHTA 2GI9A 4HEA1 1FFUA 2ZCCA 1KJTA 1NYRA 3AE4B 1Q10A 3V6EB 2VRRB 2GBMA 2G9HD 3HRDD 1FXTB 2HJ1A 1C76A 4A55A 1C78A 1QILA 3BK1A 1XEEA 3R7RA 2KQ7A 3CF6E 4HK2A 2KX3A 1UBIA 4KGSA 1FCCC 3B0AA 1XO3A 2BGFA 3FILA 1EU4A 1EWCA 3C8YA 1F9JA 2J4XA 2QEJC 2XNAC 5E6PA 4C56C 2FAZA 1J7CA 3L17A 1WRIA 5EE0A 5LLIA 1WI0A 2KJ6A 1RFAA 3Q3FA 2Y5CA 2LHDA 2GBJA 5AZHA 1V2YA 1AW7A 2D3AA 1YX6B 5L83A 4LNNA 5DPRA 2DWQA 2QDFA 3T3OA 3HM3A 5C1ZA 4JX1C 1C4PA 2V0GA 1C77A 1KF6B 4LNIA 2WX1A 3L13A 3NRZA 1KRHA 4WH4A 4GIVA 3B2FA 4XE0A 1YJIA 4YWGG 1A70A 3BZDB 2L00B 1FM0D 4DHJD 4HROA 4AQ7A 1YX5B 2BYEA 4BVUC 5IKCM 3GZNB 2BKFA 1C4AA 1RFKA 1XXGA 3R8BA 2O2VA 5JXVA 4RM8A 1QOAA 4GDKB 1I4GA 4EZKA 2WXHA 4RF0A 3HHMA 5AEKB 3P4RB 1X1MA 1SGHA 1J7AA 3AXCA 3HK0A 1T0YA 5E6OA 4IM2A
chains in the Genus database with same CATH topology
1J19A 3QAQA 1WJNA 1WJUA 3WAOA 1WR6E 3DBSA 2MBOA 3DVNV 4GMVA 4BKSD 1A5RA 2ASQA 3ZDMC 3ZNHB 1LQBA 4BFRA 4WJNA 5D94A 4PS8A 1TBEA 1NDDA 3HIZA 2LGYA 3T8MA 3L10B 3DCGA 3ZTCA 1V80A 2DHZA 1H8CA 2KJRA 4MSMB 3M63B 1WMHA 2JY6A 3L08A 2RGFA 1PQSA 1BT0A 1MG8A 3DBRI 2MA9B 3KW5B 4A20A 2KDBA 3OLMD 3C0RB 3V60A 3AU4A 3SHQA 3TL5A 4ICUA 2DX5B 2XK5A 3PHXB 5HKHA 1E8XA 1WH3A 2KDFB 2M17A 3VHTC 2PE6B 3BY4B 3TBLD 2MBQA 1OEYJ 3KUZA 1IPGA 1WYWB 1HE8A 3DQVA 3BINA 4DHJB 3ZRCA 4B95A 3IFWB 3RT3B 2IZVB 3ECIA 3QWZB 3NZSA 3S2AA 3P2BA 1WXMA 3ZUNA 1Q5WB 3DBLI 2MW5A 2BPSA 3CSTA 4XX5A 3W1SA 4ZYNA 5DPTA 3JW0X 2AEHA 3JSVA 2D10A 5CHWA 2JF5A 1RRBA 3MJWA 3PLVA 5DCNA 4CHKA 2KC1A 2ZVNA 4WQOB 4GN1A 3ZRFA 2KMAA 5LXIB 1Q0WB 2KNBA 2AWTA 2BYFA 4OVVA 1V6EA 4WWPA 4ICVA 2N9EB 4EUTA 3PLUA 4RM9A 2KJHB 1WX7A 2LGXA 3TCAA 2LVPA 2IY0B 1SE9A 1YIWA 4GU2A 2N1WA 3QCAA 4W9IA 2M8SA 1GUAB 2N1VA 4WJQA 1ISNA 3TMPB 3R7QA 3KH0A 3VTUA 1Y8RC 4MJSB 4BOSC 4EEWA 1K8RB 2CS4A 2ZJDA 3PVLA 5BO4B 5J18A 3QA8A 2OOBB 3NY5A 2MBEA 1V9JA 1GC6A 2GMIC 2DYOA 1YD8U 3UF8A 5J2RA 3OJ4B 4JIOU 3PRMB 2N9XA 3L54A 1XQQA 4FBJB 1I42A 3ZNID 1KLVA 3VTVA 1LXDA 2UWQA 2BYVE 2ZNVC 4B9KA 4G11A 1V86A 2FCNA 1V49A 2MSED 2PE9A 2IO0B 2QHOA 2L0FA 4HXDA 1UELA 4WAAA 3ZLZA 4TQ0A 4W9HA 1P3QU 2KTFA 4TUUA 4AP4C 2KWCA 3VXWA 2NCNA 3NS8A 4LJPB 2LRUA 4MH0E 1IYFA 1OTRB 2WX0A 4KSLC 2GBKA 1GC7A 2KX0A 3L16A 2RSUA 1WGDA 2ZZPB 3DPDA 2DZKA 3CSFA 3PRZA 3A9JA 4NQKE 1NI2A 2LI5A 2KZRA 5KHOA 2GBNA 3A1QA 2O6VB 4HPLB 4K81A 5L95C 2KTRB 3GOEA 1OEYA 2HE7A 2DZMA 2LJ5A 4IC7B 2J7QB 2LGDA 2G4SA 1WMHB 2WWZA 3LJ3A 3EC8A 3UQBA 2MX2A 2W9NA 4A3OA 2LZ6A 1WGYA 2KFKB 4ZRIA 1I35A 5IA7A 2IO3B 4ZDVA 4E3CA 2XK5B 1WJ6A 1WZ0A 3ALBA 2WDTB 1E90A 3QJZA 4K1RB 4KVGB 3UIOB 2V3SA 2RD0A 4DHZB 1EF5A 4XZ4A 2KDEB 3DOWA 3ZIMA 4W9DA 1R4NI 4HCPB 3RD2A 4JLCA 5GMVA 3TIXA 2N7DA 1E8YA 2KK8A 4PYUA 3NZUA 5TR5A 2N7EA 2JT4B 3IG3A 3R3MA 4FJVB 2XEWA 3JSVB 4GGQA 4ZRJA 3W1YA 3I3TB 4TKNA 3OJ3A 4FADA 3PREA 5CX3A 5IAAC 2IY1B 3NHEB 4AUQC 2LUEA 3PRPB 3VAWA 2AL3A 2KWVB 3DVGX 3N30A 4MEMA 2YVCA 4DDID 2AL6A 4KIKA 3SD5A 2KFJA 4JL9A 2L05A 4K7SA 3PS6A 4IUMB 1J8CA 1V81A 2G3QB 2ZCBA 4WJOA 2LWPA 1P98A 4LDTB 5LXHA 3ML8A 4GB9A 4MJSA 2K25A 4X57B 2GOWA 2NBVB 4HPMB 3JVZX 2ZEQA 4NJ6A 2HJ8A 4IW0A 4LCDE 1Z2MA 3VH3B 2KANA 1OGWA 4BBNC 2G4DB 1TGZB 3QQ8B 3APDA 1E8WA 1YJ1A 4W9FA 2Y5BB 4F1SA 2C7NB 2JPHA 4EZJA 3EECA 3UIPB 3WALA 2PPHA 3A1QB 1UH6A 2BWES 2NBUA 2FCMA 1TTNA 4GDLA 1V5OA 3H7PA 4W9CA 5D7GA 1H4RA 4FJYA 1WGGA 1WXSA 2LVQA 3X0WA 2N9PC 2K8HA 2O6VD 3IBEA 3OAWA 4MGYE 2J0MA 3ZW3A 1EO6A 3V6CB 2JXXA 2KHWB 3EFUA 1WM2A 2CHZA 1ZGUB 1ZW7A 3VTWA 4IWQA 3X23A 1QZEA 2D07B 2KO3A 3B1LX 2DAJA 5AZFA 4DXAB 4I6NB 2C7MB 4JGHB 3U7DA 2MBHA 5CHVC 4YL8A 2M4NA 2FCSA 1G6JA 2UYZB 4W9GA 2MWSB 2Z59B 4MDKE 1TZ1A 2DENB 2PEAA 2KKCA 1Q1OA 4GSWA 2G45B 4KZCA 4DBGA 2DYMA 2K6DB 2MCNB 1EUVB 5G55A 4E74A 4BKGA 4URKA 2LD9A 2J0KA 2C7HA 1WM3A 3MHSD 2NR2A 5KHQA 5J17A 1E5WA 2D2QA 2MRPA 4JQWC 2NS5A 4ANUA 2D3GA 2R2OA 2BF8B 2GBRA 3WANA 3O65B 3ZDTA 2ZNVB 1L7YA 4B6WA 3AU5A 3CMMB 3V61A 3M3JA 1E7UA 4NPNA 2ZPYA 3A9KA 3WIMA 5EDSA 4KZ0A 3B08A 2HTHA 4J6IA 4II3B 1LM8B 5DPSA 4DWFA 3PHWB 4MSQB 2I1KA 3ZNGC 4BKSA 2C60A 2JRHA 4FHKA 2N4FA 3RZFA 2M0XA 2C5LC 4DK5A 1S1QB 2KVRA 2I1JA 3LDZE 1WGHA 1WY8A 2KFKA 3N32A 3PV1A 3RCZA 2LRWA 2Z0DB 1U4AA 2BKRB 3PSEB 4KIKB 4RMAA 2IO2B 5CTRC 3SDLC 2MP2A 4F8CB 3A9JB 4ANVA 3H7PB 2LASA 3DVNU 3WA0A 2IO1B 1J0GA 1AARA 2JVCA 4DDGD 3ML9A 1WGRA 5AZGA 1WX8A 2CKHB 3K9OB 2JZZA 4FN2A 4K7WA 1YQBA 2C9WB 3PT2B 4FA6A 4FULA 2EKEC 2V4LA 4HCNB 4CO7A 1D3ZA 4HVBA 4M0WB 4HLEA 4II2B 3ZKJC 2RPQA 2KLCA 3H1UA 3K9PB 4A3PA 3VUWA 2PJHA 3VVWB 2L3ZA 1LFDA 1S3SG 2NPTB 4MGKE 2DYBA 2LVOA 2NVUI 2DZIA 3IHPC 3KYDD 2L0TA 2FCQA 1E8ZA 2RR9A 3HM6X 4OVUA 3ZTDA 4PYZA 4NAWB 1VCBA 3H9DA 3UQAA 1GG3A 3D32A 2JRIB 1Z5SB 2FIDA 2LXCA 3ZO5B 1UD7A 4HJKA 1WIAA 1WZ3A 1P9DU 4GDKA 2CHWA 1L2NA 2ZVOA 1WR1A 4CYEA 2DZJA 2JZ3B 5JZEB 3L0WB 3A9KB 4I6LB 3VUXA 3ZNZB 2KMCA 4MGZE 4IM3A 3Q3JA 1V5TA 1UZXB 4KSKC 5DPWA 2KOXA 5JH5C 2L7RA 2A4ZA 2KC2A 4E71A 2KD0A 2KXJA 2NBWB 5E6NA 5D6JB 4W9EA 3H7SA 1EF1A 4FJZA 2IYDB 3AI5A 3APFA 3N3KB 1GJZA 4FLHA 3IVFA 4AWJA 1E7VA 3VH4B 3RYTA 4GDLB 2K8CA 3U8ZA 2K8BA 2K1FA 5D2MB 3RUIB 3VFKA 3PGEA 4M8MA 2K6QA 1WXAA 2O2VB 3KVFB 4FHJA 4NQLB 3VQIA 3RULA 4BKTA 3A33B 4PS3A 3PTFC 4BBNF 1JRUA 1P0RA 4GXBA 5JHAA 3A4RA 4IG7B 4KV2A 2JUOA 4IWPA 4NNJB 1VD2A 3TJPA 3NOBA 4LJOB 2FNJB 4LDTD 4AJYB 2HD5B 1WX9A 3M95A 4HDQA 3GZNI 4DHZE 4AJWA 1R4MI 3QHTA 2KDIA 4KDIC 3R66C 2YLMA 1KJTA 2ZCCA 1KOTA 3DVGY 4G0NB 3V6EB 2VRRB 3KUCB 2GBMA 4K7UA 1FXTB 4ASWC 2D11A 3PZDA 4WWOA 2AYOB 4ZRKA 3R7RA 4NAWA 2KQ7A 3CF6E 4TV3A 1RLFA 4HK2A 2KX3A 2EMSA 4EZLA 1UBIA 3B0AA 4WWNA 3QK0A 2BGFA 2KWUB 1KM7A 4G50A 2V1YA 3ZVVA 4IM0A 4F7ZA 2DAFA 1C3TA 4AOFA 1F9JA 2ZPNA 5E6PA 2NPTA 2A5UA 1WFYA 4N9F4 4MGIE 3WAPA 4MELA 2FAZA 3L17A 1P1AA 5LLIA 1WI0A 2KJ6A 4KDLB 3WAMA 4EFOA 1RFAA 4NY0A 3Q3FA 3M62B 3QARA 4HDOA 3APCA 2GBJA 3H6NA 3QIJA 2CU1A 1M94A 5AZHA 3ENEA 4MM3A 1V2YA 1WXVA 1YX6B 4WJPA 2MQJA 5L83A 1IP9A 3SU8X 5DPRA 5C23A 1C1YB 3T9LA 1WF9A 2LXAA 5FR6A 3HM3A 5C1ZA 4W9JA 2Z0EB 3PPAA 1OQYA 2KQSA 4PS7A 2MP2B 2MLBA 1NBFC 2CHXA 2KTRA 3EHVA 3KUDB 4GOCA 4P7IA 4W9LA 2BWFA 1UGMA 3VUYA 1RAXA 3VDZA 2MBBB 2FUHB 2KLGA 5G2NA 2L76A 3KYCD 1SIFA 2WX1A 1WJ4A 3L13A 3QX1A 1WRDB 1XT9B 4GIVA 4G3XB 3QC8B 3ONSA 3UGBB 4ANWA 1GNUA 2L00B 2REXA 4EOYA 3RZWC 4BOZB 2CR5A 2O6VA 2OJRA 2J0JA 4M8NA 4DHJD 1YX5B 2BYEA 3AULA 4BVUC 1XD3B 2BKFA 4ANXA 1UBQA 2JWZA 4W9KA 4I6PA 2O2VA 3DDCB 1CMXB 4RM8A 4GDKB 2L8JA 3DBHI 4EZKA 5JHBA 3A4SC 3JYUA 2KN5A 4HWIB 4XC2A 3U30A 2K39A 3HHMA 4IWOA 5AEKB 4NJ7A 1WE7A 2FIFA 2IBIB 1ZKHA 3UINB 3W1SC 1X1MA 2R2QA 1SGHA 3MTNB 5CHFA 3AXCA 3V62A 2B3AA 3HK0A 1T0YA 5E6OA 2M1MA 2EMTA 2WYQA 4IM2A 4TQ1A 4EKUA 2XBBC 1WE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J19 A;  3QAQ A;  1WJN A;  1WJU A;  3WAO A;  1WR6 E;  3DBS A;  2MBO A;  3DVN V;  4GMV A;  4BKS D;  1A5R A;  2ASQ A;  3ZDM C;  3ZNH B;  1LQB A;  4BFR A;  4WJN A;  5D94 A;  4PS8 A;  1TBE A;  1NDD A;  3HIZ A;  2LGY A;  3T8M A;  3L10 B;  3DCG A;  3ZTC A;  1V80 A;  2DHZ A;  1H8C A;  2KJR A;  4MSM B;  3M63 B;  1WMH A;  2JY6 A;  3L08 A;  2RGF A;  1PQS A;  1BT0 A;  1MG8 A;  3DBR I;  2MA9 B;  3KW5 B;  4A20 A;  2KDB A;  3OLM D;  3C0R B;  3V60 A;  3AU4 A;  3SHQ A;  3TL5 A;  4ICU A;  2DX5 B;  2XK5 A;  3PHX B;  5HKH A;  1E8X A;  1WH3 A;  2KDF B;  2M17 A;  3VHT C;  2PE6 B;  3BY4 B;  3TBL D;  2MBQ A;  1OEY J;  3KUZ A;  1IPG A;  1WYW B;  1HE8 A;  3DQV A;  3BIN A;  4DHJ B;  3ZRC A;  4B95 A;  3IFW B;  3RT3 B;  2IZV B;  3ECI A;  3QWZ B;  3NZS A;  3S2A A;  3P2B A;  1WXM A;  3ZUN A;  1Q5W B;  3DBL I;  2MW5 A;  2BPS A;  3CST A;  4XX5 A;  3W1S A;  4ZYN A;  5DPT A;  3JW0 X;  2AEH A;  3JSV A;  2D10 A;  5CHW A;  2JF5 A;  1RRB A;  3MJW A;  3PLV A;  5DCN A;  4CHK A;  2KC1 A;  2ZVN A;  4WQO B;  4GN1 A;  3ZRF A;  2KMA A;  5LXI B;  1Q0W B;  2KNB A;  2AWT A;  2BYF A;  4OVV A;  1V6E A;  4WWP A;  4ICV A;  2N9E B;  4EUT A;  3PLU A;  4RM9 A;  2KJH B;  1WX7 A;  2LGX A;  3TCA A;  2LVP A;  2IY0 B;  1SE9 A;  1YIW A;  4GU2 A;  2N1W A;  3QCA A;  4W9I A;  2M8S A;  1GUA B;  2N1V A;  4WJQ A;  1ISN A;  3TMP B;  3R7Q A;  3KH0 A;  3VTU A;  1Y8R C;  4MJS B;  4BOS C;  4EEW A;  1K8R B;  2CS4 A;  2ZJD A;  3PVL A;  5BO4 B;  5J18 A;  3QA8 A;  2OOB B;  3NY5 A;  2MBE A;  1V9J A;  1GC6 A;  2GMI C;  2DYO A;  1YD8 U;  3UF8 A;  5J2R A;  3OJ4 B;  4JIO U;  3PRM B;  2N9X A;  3L54 A;  1XQQ A;  4FBJ B;  1I42 A;  3ZNI D;  1KLV A;  3VTV A;  1LXD A;  2UWQ A;  2BYV E;  2ZNV C;  4B9K A;  4G11 A;  1V86 A;  2FCN A;  1V49 A;  2MSE D;  2PE9 A;  2IO0 B;  2QHO A;  2L0F A;  4HXD A;  1UEL A;  4WAA A;  3ZLZ A;  4TQ0 A;  4W9H A;  1P3Q U;  2KTF A;  4TUU A;  4AP4 C;  2KWC A;  3VXW A;  2NCN A;  3NS8 A;  4LJP B;  2LRU A;  4MH0 E;  1IYF A;  1OTR B;  2WX0 A;  4KSL C;  2GBK A;  1GC7 A;  2KX0 A;  3L16 A;  2RSU A;  1WGD A;  2ZZP B;  3DPD A;  2DZK A;  3CSF A;  3PRZ A;  3A9J A;  4NQK E;  1NI2 A;  2LI5 A;  2KZR A;  5KHO A;  2GBN A;  3A1Q A;  2O6V B;  4HPL B;  4K81 A;  5L95 C;  2KTR B;  3GOE A;  1OEY A;  2HE7 A;  2DZM A;  2LJ5 A;  4IC7 B;  2J7Q B;  2LGD A;  2G4S A;  1WMH B;  2WWZ A;  3LJ3 A;  3EC8 A;  3UQB A;  2MX2 A;  2W9N A;  4A3O A;  2LZ6 A;  1WGY A;  2KFK B;  4ZRI A;  1I35 A;  5IA7 A;  2IO3 B;  4ZDV A;  4E3C A;  2XK5 B;  1WJ6 A;  1WZ0 A;  3ALB A;  2WDT B;  1E90 A;  3QJZ A;  4K1R B;  4KVG B;  3UIO B;  2V3S A;  2RD0 A;  4DHZ B;  1EF5 A;  4XZ4 A;  2KDE B;  3DOW A;  3ZIM A;  4W9D A;  1R4N I;  4HCP B;  3RD2 A;  4JLC A;  5GMV A;  3TIX A;  2N7D A;  1E8Y A;  2KK8 A;  4PYU A;  3NZU A;  5TR5 A;  2N7E A;  2JT4 B;  3IG3 A;  3R3M A;  4FJV B;  2XEW A;  3JSV B;  4GGQ A;  4ZRJ A;  3W1Y A;  3I3T B;  4TKN A;  3OJ3 A;  4FAD A;  3PRE A;  5CX3 A;  5IAA C;  2IY1 B;  3NHE B;  4AUQ C;  2LUE A;  3PRP B;  3VAW A;  2AL3 A;  2KWV B;  3DVG X;  3N30 A;  4MEM A;  2YVC A;  4DDI D;  2AL6 A;  4KIK A;  3SD5 A;  2KFJ A;  4JL9 A;  2L05 A;  4K7S A;  3PS6 A;  4IUM B;  1J8C A;  1V81 A;  2G3Q B;  2ZCB A;  4WJO A;  2LWP A;  1P98 A;  4LDT B;  5LXH A;  3ML8 A;  4GB9 A;  4MJS A;  2K25 A;  4X57 B;  2GOW A;  2NBV B;  4HPM B;  3JVZ X;  2ZEQ A;  4NJ6 A;  2HJ8 A;  4IW0 A;  4LCD E;  1Z2M A;  3VH3 B;  2KAN A;  1OGW A;  4BBN C;  2G4D B;  1TGZ B;  3QQ8 B;  3APD A;  1E8W A;  1YJ1 A;  4W9F A;  2Y5B B;  4F1S A;  2C7N B;  2JPH A;  4EZJ A;  3EEC A;  3UIP B;  3WAL A;  2PPH A;  3A1Q B;  1UH6 A;  2BWE S;  2NBU A;  2FCM A;  1TTN A;  4GDL A;  1V5O A;  3H7P A;  4W9C A;  5D7G A;  1H4R A;  4FJY A;  1WGG A;  1WXS A;  2LVQ A;  3X0W A;  2N9P C;  2K8H A;  2O6V D;  3IBE A;  3OAW A;  4MGY E;  2J0M A;  3ZW3 A;  1EO6 A;  3V6C B;  2JXX A;  2KHW B;  3EFU A;  1WM2 A;  2CHZ A;  1ZGU B;  1ZW7 A;  3VTW A;  4IWQ A;  3X23 A;  1QZE A;  2D07 B;  2KO3 A;  3B1L X;  2DAJ A;  5AZF A;  4DXA B;  4I6N B;  2C7M B;  4JGH B;  3U7D A;  2MBH A;  5CHV C;  4YL8 A;  2M4N A;  2FCS A;  1G6J A;  2UYZ B;  4W9G A;  2MWS B;  2Z59 B;  4MDK E;  1TZ1 A;  2DEN B;  2PEA A;  2KKC A;  1Q1O A;  4GSW A;  2G45 B;  4KZC A;  4DBG A;  2DYM A;  2K6D B;  2MCN B;  1EUV B;  5G55 A;  4E74 A;  4BKG A;  4URK A;  2LD9 A;  2J0K A;  2C7H A;  1WM3 A;  3MHS D;  2NR2 A;  5KHQ A;  5J17 A;  1E5W A;  2D2Q A;  2MRP A;  4JQW C;  2NS5 A;  4ANU A;  2D3G A;  2R2O A;  2BF8 B;  2GBR A;  3WAN A;  3O65 B;  3ZDT A;  2ZNV B;  1L7Y A;  4B6W A;  3AU5 A;  3CMM B;  3V61 A;  3M3J A;  1E7U A;  4NPN A;  2ZPY A;  3A9K A;  3WIM A;  5EDS A;  4KZ0 A;  3B08 A;  2HTH A;  4J6I A;  4II3 B;  1LM8 B;  5DPS A;  4DWF A;  3PHW B;  4MSQ B;  2I1K A;  3ZNG C;  4BKS A;  2C60 A;  2JRH A;  4FHK A;  2N4F A;  3RZF A;  2M0X A;  2C5L C;  4DK5 A;  1S1Q B;  2KVR A;  2I1J A;  3LDZ E;  1WGH A;  1WY8 A;  2KFK A;  3N32 A;  3PV1 A;  3RCZ A;  2LRW A;  2Z0D B;  1U4A A;  2BKR B;  3PSE B;  4KIK B;  4RMA A;  2IO2 B;  5CTR C;  3SDL C;  2MP2 A;  4F8C B;  3A9J B;  4ANV A;  3H7P B;  2LAS A;  3DVN U;  3WA0 A;  2IO1 B;  1J0G A;  1AAR A;  2JVC A;  4DDG D;  3ML9 A;  1WGR A;  5AZG A;  1WX8 A;  2CKH B;  3K9O B;  2JZZ A;  4FN2 A;  4K7W A;  1YQB A;  2C9W B;  3PT2 B;  4FA6 A;  4FUL A;  2EKE C;  2V4L A;  4HCN B;  4CO7 A;  1D3Z A;  4HVB A;  4M0W B;  4HLE A;  4II2 B;  3ZKJ C;  2RPQ A;  2KLC A;  3H1U A;  3K9P B;  4A3P A;  3VUW A;  2PJH A;  3VVW B;  2L3Z A;  1LFD A;  1S3S G;  2NPT B;  4MGK E;  2DYB A;  2LVO A;  2NVU I;  2DZI A;  3IHP C;  3KYD D;  2L0T A;  2FCQ A;  1E8Z A;  2RR9 A;  3HM6 X;  4OVU A;  3ZTD A;  4PYZ A;  4NAW B;  1VCB A;  3H9D A;  3UQA A;  1GG3 A;  3D32 A;  2JRI B;  1Z5S B;  2FID A;  2LXC A;  3ZO5 B;  1UD7 A;  4HJK A;  1WIA A;  1WZ3 A;  1P9D U;  4GDK A;  2CHW A;  1L2N A;  2ZVO A;  1WR1 A;  4CYE A;  2DZJ A;  2JZ3 B;  5JZE B;  3L0W B;  3A9K B;  4I6L B;  3VUX A;  3ZNZ B;  2KMC A;  4MGZ E;  4IM3 A;  3Q3J A;  1V5T A;  1UZX B;  4KSK C;  5DPW A;  2KOX A;  5JH5 C;  2L7R A;  2A4Z A;  2KC2 A;  4E71 A;  2KD0 A;  2KXJ A;  2NBW B;  5E6N A;  5D6J B;  4W9E A;  3H7S A;  1EF1 A;  4FJZ A;  2IYD B;  3AI5 A;  3APF A;  3N3K B;  1GJZ A;  4FLH A;  3IVF A;  4AWJ A;  1E7V A;  3VH4 B;  3RYT A;  4GDL B;  2K8C A;  3U8Z A;  2K8B A;  2K1F A;  5D2M B;  3RUI B;  3VFK A;  3PGE A;  4M8M A;  2K6Q A;  1WXA A;  2O2V B;  3KVF B;  4FHJ A;  4NQL B;  3VQI A;  3RUL A;  4BKT A;  3A33 B;  4PS3 A;  3PTF C;  4BBN F;  1JRU A;  1P0R A;  4GXB A;  5JHA A;  3A4R A;  4IG7 B;  4KV2 A;  2JUO A;  4IWP A;  4NNJ B;  1VD2 A;  3TJP A;  3NOB A;  4LJO B;  2FNJ B;  4LDT D;  4AJY B;  2HD5 B;  1WX9 A;  3M95 A;  4HDQ A;  3GZN I;  4DHZ E;  4AJW A;  1R4M I;  3QHT A;  2KDI A;  4KDI C;  3R66 C;  2YLM A;  1KJT A;  2ZCC A;  1KOT A;  3DVG Y;  4G0N B;  3V6E B;  2VRR B;  3KUC B;  2GBM A;  4K7U A;  1FXT B;  4ASW C;  2D11 A;  3PZD A;  4WWO A;  2AYO B;  4ZRK A;  3R7R A;  4NAW A;  2KQ7 A;  3CF6 E;  4TV3 A;  1RLF A;  4HK2 A;  2KX3 A;  2EMS A;  4EZL A;  1UBI A;  3B0A A;  4WWN A;  3QK0 A;  2BGF A;  2KWU B;  1KM7 A;  4G50 A;  2V1Y A;  3ZVV A;  4IM0 A;  4F7Z A;  2DAF A;  1C3T A;  4AOF A;  1F9J A;  2ZPN A;  5E6P A;  2NPT A;  2A5U A;  1WFY A;  4N9F 4;  4MGI E;  3WAP A;  4MEL A;  2FAZ A;  3L17 A;  1P1A A;  5LLI A;  1WI0 A;  2KJ6 A;  4KDL B;  3WAM A;  4EFO A;  1RFA A;  4NY0 A;  3Q3F A;  3M62 B;  3QAR A;  4HDO A;  3APC A;  2GBJ A;  3H6N A;  3QIJ A;  2CU1 A;  1M94 A;  5AZH A;  3ENE A;  4MM3 A;  1V2Y A;  1WXV A;  1YX6 B;  4WJP A;  2MQJ A;  5L83 A;  1IP9 A;  3SU8 X;  5DPR A;  5C23 A;  1C1Y B;  3T9L A;  1WF9 A;  2LXA A;  5FR6 A;  3HM3 A;  5C1Z A;  4W9J A;  2Z0E B;  3PPA A;  1OQY A;  2KQS A;  4PS7 A;  2MP2 B;  2MLB A;  1NBF C;  2CHX A;  2KTR A;  3EHV A;  3KUD B;  4GOC A;  4P7I A;  4W9L A;  2BWF A;  1UGM A;  3VUY A;  1RAX A;  3VDZ A;  2MBB B;  2FUH B;  2KLG A;  5G2N A;  2L76 A;  3KYC D;  1SIF A;  2WX1 A;  1WJ4 A;  3L13 A;  3QX1 A;  1WRD B;  1XT9 B;  4GIV A;  4G3X B;  3QC8 B;  3ONS A;  3UGB B;  4ANW A;  1GNU A;  2L00 B;  2REX A;  4EOY A;  3RZW C;  4BOZ B;  2CR5 A;  2O6V A;  2OJR A;  2J0J A;  4M8N A;  4DHJ D;  1YX5 B;  2BYE A;  3AUL A;  4BVU C;  1XD3 B;  2BKF A;  4ANX A;  1UBQ A;  2JWZ A;  4W9K A;  4I6P A;  2O2V A;  3DDC B;  1CMX B;  4RM8 A;  4GDK B;  2L8J A;  3DBH I;  4EZK A;  5JHB A;  3A4S C;  3JYU A;  2KN5 A;  4HWI B;  4XC2 A;  3U30 A;  2K39 A;  3HHM A;  4IWO A;  5AEK B;  4NJ7 A;  1WE7 A;  2FIF A;  2IBI B;  1ZKH A;  3UIN B;  3W1S C;  1X1M A;  2R2Q A;  1SGH A;  3MTN B;  5CHF A;  3AXC A;  3V62 A;  2B3A A;  3HK0 A;  1T0Y A;  5E6O A;  2M1M A;  2EMT A;  2WYQ A;  4IM2 A;  4TQ1 A;  4EKU A;  2XBB C;  1WE6 A; 
#chains in the Genus database with same CATH topology
 1WJN A;  1WR6 E;  3RNC C;  1A5R A;  2ASQ A;  3ZDM C;  1UWM A;  5D94 A;  3HIZ A;  2LGY A;  2KQ4 X;  2DHZ A;  4WIP A;  2MH7 A;  3M63 B;  4JPS A;  3DBR I;  4A20 A;  1L0V B;  2LGS A;  3C0R B;  3V60 A;  3AU4 A;  1WXQ A;  1WWT A;  2IJ0 A;  3Q8E A;  2DX5 B;  3PHX B;  1SIJ A;  1JQ4 A;  3AM9 A;  4LK0 M;  2RDH A;  3TBL D;  3DQV A;  2IZV B;  4B0E A;  3QWZ B;  3NZS A;  3TSS A;  3CST A;  3W1S A;  1TJE A;  4ZYN A;  5DPT A;  1PYW D;  2W3R A;  2JF5 A;  5DCN A;  4CHK A;  2KMA A;  4A90 A;  2AWT A;  3VR9 B;  1V6E A;  2QJL A;  4ICV A;  2N9E B;  3DBH B;  3N20 C;  2RDG A;  2JX5 A;  1HTQ A;  2N1W A;  1GUA B;  2N1V A;  3VTU A;  4BOS C;  4MJS B;  3RFZ B;  1K8R B;  5FR3 A;  3QA8 A;  4DXG A;  2GB1 A;  4KX6 B;  1F0Z A;  2JZP A;  3PZ7 A;  1XQQ A;  1I42 A;  4YTP B;  1I4H A;  2N7J A;  4P1C C;  3ZNI D;  3VTV A;  1UWX A;  4G11 A;  1V86 A;  4HXD A;  1ET6 A;  2PE9 A;  3ZLZ A;  5BYS A;  2DNF A;  4TUU A;  4ZYS A;  3NS8 A;  1IYF A;  1OTR B;  3V05 A;  2N9K A;  4RGN A;  2IND C;  2ACZ B;  2KZR A;  5KHO A;  5L95 C;  4K81 A;  2DZM A;  2LJ5 A;  2KWD A;  2G4S A;  1WMH B;  3RNA C;  5EE1 A;  2M0A A;  1WGY A;  1F52 A;  1VZ6 A;  1EWY C;  4E3C A;  1ESF A;  3AV8 A;  1BXT A;  2RD0 A;  2W82 A;  1EF5 A;  3TIX A;  1WSP A;  2R61 A;  3NZU A;  1YQ3 B;  2PKO A;  1YN3 A;  4ZRJ A;  3W1Y A;  5I4D A;  4XWT A;  2V9H A;  3PRE A;  4AUQ C;  3PRP B;  1FD6 A;  2EEL A;  5BYQ A;  3UI3 A;  3NVW A;  2KFJ A;  4JL9 A;  2L05 A;  1TKY A;  4IUM B;  4K7S A;  3W9C B;  2G3Q B;  2ZCB A;  4WJO A;  4XDC A;  3ML8 A;  1ZUD 2;  2WHI A;  2HJ8 A;  2KAN A;  2G4D B;  2INP E;  1E8W A;  4F1S A;  3EEC A;  3WAL A;  5CHF A;  4GDL A;  1V5O A;  4W9C A;  2L1A A;  4FJY A;  1WXS A;  1NYQ A;  2N9P C;  1FEH A;  2K8H A;  2O6V D;  3IBE A;  4YTN B;  2WXK A;  1EO6 A;  2CHZ A;  1ZGU B;  3NVV A;  2BT6 A;  3X23 A;  3IT4 B;  4IKG A;  4I6N B;  3U7D A;  2JQR B;  2MBH A;  4YL8 A;  1HQR D;  2FCS A;  3BII D;  2Z59 B;  4MDK E;  2G45 B;  3AE2 B;  5G55 A;  4BKG A;  3MHS D;  5KHQ A;  1V97 A;  5J17 A;  1YNT E;  2NS5 A;  2D3G A;  2J53 A;  4YT0 B;  2R2O A;  3WAN A;  3ZDT A;  2ZW0 A;  2EKI A;  1N5W A;  1L7Y A;  4B6W A;  4RF1 A;  1E7U A;  2ZPY A;  1N63 A;  3A9K A;  4KZ0 A;  1OQR A;  3PHW B;  2FE8 A;  1GPX A;  2M0X A;  4US9 A;  4MAC A;  2KFK A;  1U4A A;  2BKR B;  4KIK B;  4RMA A;  2V3P A;  4AS1 A;  2IO1 B;  1J0G A;  4EE2 A;  4LNF A;  2ZW1 A;  1GAQ B;  1YQB A;  3NVZ A;  1KLU D;  4NAM A;  3PT2 B;  3NJT A;  1MPE A;  4FUL A;  3SEB A;  4HLE A;  1QOG A;  4YSX B;  1YJJ A;  4L2Y A;  2WXQ A;  2NVU I;  3NS1 A;  2K22 A;  3OWE B;  4MM3 B;  1QLB B;  2M56 B;  1ET9 A;  2PW9 A;  1PDX A;  4GDK A;  2BB6 A;  1JCK B;  3RN9 C;  1WR1 A;  2FBW B;  5FK9 C;  3EGR A;  1ZP0 B;  3Q3J A;  1V5T A;  1UZX B;  1JRP A;  2L7R A;  2KC2 A;  4E71 A;  4C80 A;  2KXJ A;  2NBW B;  5E6N A;  2WXL A;  4C7Y A;  5D6J B;  2WXO A;  3N3K B;  3EUB 2;  4GDL B;  3OG5 A;  2WDR B;  3BYY B;  1JWU D;  5BMG A;  4NQL B;  1WXA A;  2O2V B;  3KVF B;  4BKT A;  4PK1 A;  3RUL A;  3PZ8 A;  3PTF C;  4GXB A;  4KV2 A;  3NOB A;  5C2T B;  2YEP B;  2VZK B;  4LJO B;  1WX9 A;  3GZN I;  1QOF A;  1R4M I;  4AJW A;  1CZP A;  4S17 A;  1C4C A;  4ASW C;  1TYG B;  2AYO B;  4OHJ A;  1DYQ A;  1JWA D;  1RLF A;  1T3Q A;  2WXF A;  2UU7 A;  4EZL A;  1D5M C;  3QK0 A;  2KWU B;  4G50 A;  2V1Y A;  3ZVV A;  4F7Z A;  3DWG C;  2A5U A;  3WAM A;  1D5X C;  4NY0 A;  2SAK A;  2IGD A;  3H6N A;  4ARI A;  1WXV A;  3HVD A;  1C1Y B;  3AEB B;  3Q8A A;  4WQM A;  2K5P A;  2KQS A;  4PS7 A;  3KUD B;  3EHV A;  4M0W A;  2KTR A;  4GOC A;  2QIE B;  1JWM D;  3VUY A;  4OW0 A;  3VDZ A;  2KLG A;  2L76 A;  2BVC A;  4WAF A;  3Q69 A;  4OZC A;  3QX1 A;  4NZL B;  3ONS A;  1WYG A;  4ANW A;  1GNU A;  2REX A;  3RZW C;  2J0J A;  4A8X C;  3LXF A;  2JWZ A;  4XDD A;  5D3D A;  3P42 A;  2L8J A;  3DBH I;  1DOY A;  2JU6 X;  2KN5 A;  4FXC A;  4NJ7 A;  1WE7 A;  3W1S C;  2OED A;  3MTN B;  1HA5 A;  3I5J C;  3TEY A;  2M1M A;  1B1Z A;  4EKU A;  2XBB C;  3AE9 B;  1J19 A;  3ABV B;  1Y56 A;  3QAQ A;  1WJU A;  4KGR A;  3WAO A;  5GXG B;  5IO9 A;  3ZNH B;  1VR9 A;  3I9V 1;  4WJN A;  3T8M A;  3L10 B;  2Z8L A;  1V80 A;  4S0R A;  2KJR A;  1WMH A;  2D5G A;  2RGF A;  1PQS A;  1MG8 A;  3KW5 B;  2KDB A;  4C4V A;  3SHQ A;  5HKH A;  2X8X X;  3AE8 B;  2KDF B;  3Q3O C;  1XLO A;  1CK1 A;  1OEY J;  4YXD B;  1IPG A;  1WYW B;  1JAL A;  4US8 A;  1SXT A;  3IFW B;  3RT3 B;  3P2B A;  4USA A;  1GB4 A;  2BPS A;  1T6B X;  3J9C A;  2D10 A;  1RRB A;  3PLV A;  1HEZ E;  2ZVN A;  3FAH A;  2PVO D;  5LXI B;  4GN1 A;  2KNB A;  3AEA B;  2BYF A;  4OVV A;  5IP4 D;  4EUT A;  3PLU A;  4RM9 A;  2LGX A;  1WX7 A;  4IDI A;  3TCA A;  2LVP A;  1SE9 A;  4GU2 A;  3FC4 A;  3KH0 A;  3Q6B A;  3U52 E;  1ZXI A;  2CS4 A;  4OVZ A;  1STE A;  1FNU A;  2IGH A;  2OOB B;  1I7H A;  4P1B C;  5LNK 1;  4JE3 B;  3GS2 A;  2MBE A;  3UF8 A;  3OJ4 B;  3PRM B;  3RNE C;  4FBJ B;  2LUM A;  2ZNV C;  4B9K A;  1XCT L;  2L0F A;  1RM6 C;  3L4P A;  3AED B;  4L23 A;  3NUH B;  2KTF A;  3ZQ4 A;  2KWC A;  1YN4 A;  4Q2J A;  2CJN A;  5AUK A;  3KWL A;  1QQR A;  2ZZP B;  3CSF A;  2H88 B;  4N6E B;  2GBN A;  4IC7 B;  2I38 A;  1BML C;  2MX2 A;  1V1P A;  4A3O A;  4ZRI A;  4CQN A;  5IA7 A;  2IO3 B;  4ZDV A;  2WDT B;  1E90 A;  2I2Y A;  3U2S C;  2WU5 B;  5H8Y E;  3UIO B;  2V3S A;  2K9X A;  2KDE B;  1FXI A;  4REZ A;  1R4N I;  4HCP B;  1E8Y A;  4PYU A;  4YSZ B;  3DHG C;  2N7E A;  4FJV B;  2XEW A;  2L32 A;  3N1Z C;  4TKN A;  3OJ3 A;  2IY1 B;  2IGG A;  2AL3 A;  2KWV B;  2L52 A;  2YVC A;  4DDI D;  4KIK A;  1R4N B;  3PS6 A;  1D4B A;  4LDT B;  3AMZ A;  4GB9 A;  2GOW A;  1EM7 A;  4HPM B;  2ZEQ A;  4IW0 A;  4LCD E;  2AX5 A;  1OGW A;  3CIR B;  2WU2 B;  3B2G A;  3APD A;  5IN7 A;  2Q5W D;  2C7N B;  2JPH A;  4EZJ A;  3UIP B;  3A1Q B;  2KYW A;  2FCM A;  3U7Z A;  1QF6 A;  1H4R A;  1SEB D;  2JYT A;  1FMA D;  2JXX A;  4IWQ A;  2D07 B;  3VRB B;  1FO4 A;  5MPO A;  2WDQ B;  4DXA B;  3C19 A;  5CHV C;  2BW2 A;  2B76 B;  2MJ3 A;  1G6J A;  2OJW A;  1PGB A;  1CJE A;  1JW9 D;  2DEN B;  3BWU D;  4KZC A;  2DYM A;  4UDU C;  2LD9 A;  1WM3 A;  1F77 A;  2NR2 A;  1KLG D;  2KAC A;  2D2Q A;  2MRP A;  4JQW C;  3AE3 B;  3P4Q B;  2BF8 B;  3I63 C;  3O65 B;  3FKY A;  2JXT A;  4BAX A;  5H92 C;  2ICI A;  2K3U A;  4WUR A;  3V61 A;  3M3J A;  4NPN A;  2KDM A;  4DWF A;  4BKS A;  1UNS A;  2I1K A;  3ZNG C;  2JRH A;  2QSD A;  2N4F A;  2C5L C;  1WY8 A;  3N32 A;  4YTM B;  1ZXH A;  2LRW A;  2KVZ A;  3PSE B;  3ZGZ A;  1E10 A;  4TMA B;  1K51 A;  2LAS A;  3WA0 A;  1AAR A;  2INC C;  2JVC A;  2JZZ A;  4FN2 A;  2MHJ A;  4ZRQ A;  3AEE B;  1NEN B;  4LNK A;  4FA6 A;  2LFI A;  2EKE C;  2V4L A;  4CO7 A;  3TUO A;  3AE5 B;  2KLC A;  1YQ4 B;  3VVW B;  1FIQ A;  1LFD A;  2NPT B;  4MGK E;  3RNF C;  3ZJU A;  2HDE A;  1E8Z A;  4NAW B;  1VCB A;  1RYJ A;  3UQA A;  2IPK D;  4R3D A;  3D32 A;  1TS3 A;  4HJK A;  1L6V A;  2CHW A;  2PIA A;  2ZVO A;  1L2N A;  3L0W B;  3VUX A;  3ZNZ B;  2QMT A;  2WNM A;  5TSS A;  3AEG B;  3R2I A;  4KSK C;  5DPW A;  1T0R C;  5JH5 C;  1VJK A;  4W9E A;  1DOX A;  3H7S A;  3ZJT A;  4FJZ A;  3APF A;  4FLH A;  1IBX A;  1E7V A;  2K8C A;  4PT5 A;  2LJI A;  5D2M B;  3RUI B;  4QAY A;  3VQI A;  4PS3 A;  2WXN A;  1XLP A;  2JSV X;  5JHA A;  3A4R A;  4IWP A;  4NNJ B;  5C3J B;  4RGT A;  1JWB D;  1V1O A;  1E9M A;  2YLM A;  3Q3N C;  1AWD A;  4WWO A;  4WWN A;  1OQQ A;  1C3T A;  4IM0 A;  3P4P B;  4AOF A;  2VH2 A;  2ZPN A;  1VDV A;  5HFY A;  1WFY A;  4C4V B;  4MGI E;  3WAP A;  1QOB A;  4MEL A;  1E7P B;  4KDL B;  3M62 B;  4HJG E;  4HDO A;  3APC A;  1UGJ A;  1M94 A;  3ENE A;  4MM3 A;  2M19 A;  4WJP A;  1MHX A;  1IP9 A;  3SU8 X;  2V4I B;  1WF9 A;  5FR6 A;  2Z0E B;  4RH6 A;  1NBF C;  2CHX A;  2MLB A;  1MVK A;  4P7I A;  4W9L A;  2BWF A;  1UGM A;  2WXM A;  3R2T A;  2MBB B;  3Q3M C;  3KYC D;  1SIF A;  1SBB B;  1XT9 B;  4G3X B;  3QC8 B;  3AEF B;  4EOY A;  2DLB A;  1WGK A;  4BOZ B;  3NVY A;  1M4V A;  4ANX A;  3AE7 B;  4HWI B;  4TSS A;  1VRA B;  4IWO A;  5E6J A;  4BZA A;  2IBI B;  1ZKH A;  3UIN B;  2QIL A;  2WQY B;  3BYT B;  3V62 A;  1IGC A;  2RPV A;  4TQ1 A;  3RD2 A;  1L5P A;  1WE6 A;  2MBO A;  4GMV A;  5FKA C;  4BFR A;  2WXG A;  4KKI A;  1I4R A;  2WXJ A;  4MSM B;  5BYR A;  1B9R A;  3L08 A;  1NEK B;  4P16 A;  2MA9 B;  4RNA A;  1QT9 A;  1AN8 A;  2J52 A;  3OLM D;  2N0S B;  4ICU A;  1I4Q A;  2XK5 A;  4K3C A;  1E8X A;  2D3C A;  1N61 A;  2M17 A;  3EFC A;  1SJH D;  2PE6 B;  3BY4 B;  1SSN A;  3KUZ A;  3MC0 B;  1HE8 A;  2JYE A;  1YMH E;  1WXM A;  3DBR B;  3DBL I;  2MW5 A;  4XX5 A;  3JW0 X;  2AEH A;  3JSV A;  1FCL A;  3MJW A;  2KC1 A;  4WQO B;  3ZRF A;  1KFY B;  3ZJV A;  3MJ5 A;  4WWP A;  3I57 A;  2KJH B;  2IY0 B;  4W9I A;  5HI1 A;  3QCA A;  4WJQ A;  3TMP B;  1ISN A;  4LTU A;  3R7Q A;  1Y8R C;  4XWW A;  4ACF A;  3FIL B;  4RCO A;  4ZOH C;  3EA6 A;  3PVL A;  5BO4 B;  5J18 A;  3NY5 A;  4JWS C;  2KMM A;  1GC6 A;  2GMI C;  5J2R A;  1XF5 L;  1KLV A;  1TS4 A;  2FCN A;  1V49 A;  2MSE D;  2QHO A;  2IO0 B;  3GB1 A;  2Y5P A;  1UEL A;  1N5X A;  4W9H A;  2NCN A;  4LJP B;  2LRU A;  4KSL C;  2WX0 A;  2GBK A;  2KX0 A;  3DPD A;  3PRZ A;  4NQK E;  5EE9 A;  3HUI A;  3KLS X;  3A1Q A;  2O6V B;  3GOE A;  2HE7 A;  2J7Q B;  2KT7 A;  2WWZ A;  3UQB A;  4XGA B;  3TEX A;  4DXF A;  3BVM A;  2W9N A;  1PFD A;  1TY2 A;  1I35 A;  1K52 A;  1L0Y B;  1KH0 A;  1YOV B;  1WJ6 A;  3ALB A;  4RGO S;  2WP9 B;  1L0X B;  3QJZ A;  4K1R B;  3MP9 A;  4KVG B;  1TKG A;  3VR8 B;  4JWU C;  1ZDX A;  4JLC A;  2W3S A;  5TR5 A;  2JT4 B;  2X38 A;  3IG3 A;  3LB8 C;  3R3M A;  3I3T B;  2GRI A;  4FAD A;  2WXP A;  1F2R C;  2LUE A;  3VAW A;  3SFE B;  4MEM A;  1C79 A;  1JML A;  3SD5 A;  3Q2A C;  3DWM A;  1L6U A;  2LWP A;  1P98 A;  2RDB C;  2K25 A;  4X57 B;  2OHF A;  2NBV B;  2BTE A;  3JVZ X;  1Z2M A;  3VH3 B;  4BBN C;  3QQ8 B;  3AN1 A;  1YJ1 A;  3IAM 1;  1YN5 A;  3IAS 1;  2Y5B B;  4W9F A;  1UH6 A;  2BWE S;  4LLG M;  1TTN A;  1TY0 A;  2JWU A;  3X0W A;  2LVQ A;  2QCZ A;  3T3N A;  3ZW3 A;  2WXR A;  1TS5 A;  2MJE A;  3V6C B;  1FFV A;  1ZW7 A;  1HZ6 A;  3VTW A;  1AYF A;  2WDV B;  3GP7 A;  1IBX B;  2KO3 A;  3B1L X;  2C7M B;  4JGH B;  1OFF A;  2M4N A;  2UYZ B;  1TZ1 A;  2PEA A;  1Q1O A;  2VH1 A;  3GE8 C;  2K6D B;  1EUV B;  3RPF C;  2C7H A;  4P6V F;  2BBC A;  4ANU A;  1SB3 C;  1I4P A;  1ZDV A;  3E56 A;  1T5X D;  2GBR A;  5AUI A;  2ZNV B;  1MI0 A;  3O13 A;  3AU5 A;  2W55 A;  1SE4 A;  4LNO A;  3WIM A;  5EDS A;  4J6I A;  5DPS A;  4HKQ A;  4MSQ B;  2C60 A;  4FHK A;  3RZF A;  1FPY A;  2I1J A;  2E3T A;  3SFD B;  3PV1 A;  2Z0D B;  4MT5 A;  1VZ8 A;  5CTR C;  2MP2 A;  2W54 A;  3U4E G;  4ANV A;  3H7P B;  3TEZ A;  3DVN U;  4DDG D;  1ZOY B;  1WGR A;  4K7W A;  3MC9 A;  2LHE A;  2MEK A;  3VRA B;  1VZ7 A;  4HVB A;  1LO5 D;  4N59 A;  3ZKJ C;  2RPQ A;  3K9P B;  4L1B A;  3VUW A;  3AB5 A;  2L3Z A;  1S3S G;  1TS2 A;  2DYB A;  2LVO A;  2CU3 A;  1XLN A;  3KYD D;  2IDY A;  2L0T A;  4OVU A;  3HM6 X;  4PYZ A;  3H9D A;  1GG3 A;  1PUT A;  4XYC A;  3DBL B;  1Z5S B;  3Q8B A;  1VLB A;  2PMV A;  2LXC A;  2KN4 A;  1WZ3 A;  2VZK D;  3P1M A;  2BS4 B;  1K53 A;  2DZJ A;  1ROE A;  2JZ3 B;  1HTO A;  5JZE B;  2KMC A;  3MFG A;  2BB5 A;  2KOX A;  2RMM A;  2A4Z A;  2KD0 A;  3DHI C;  1GOZ A;  1SF0 A;  1EU3 A;  2GLS A;  3IVF A;  3VH4 B;  3RYT A;  1LGR A;  2K8B A;  2AQ3 B;  3VFK A;  4ARC A;  4M8M A;  2K6Q A;  4FHJ A;  1SE3 A;  1E0Z A;  4ZHO A;  1JRU A;  3AEC B;  3TJP A;  4KGT A;  4LDT D;  4AJY B;  1F2R I;  4HDQ A;  4DHZ E;  2KDI A;  4KDI C;  3Q14 C;  3R66 C;  1KOT A;  3DVG Y;  4G0N B;  3KUC B;  4K7U A;  2D11 A;  3PZD A;  1UUP A;  4ZRK A;  5IOI A;  4NAW A;  4TV3 A;  1DOI A;  2EMS A;  1J7B A;  1K50 A;  1KM7 A;  2DAF A;  2N9L A;  2NPT A;  3P4S B;  1R4M B;  4N9F 4;  4KKJ A;  3N1Y C;  1P1A A;  4EFO A;  2BS2 B;  3QAR A;  3H8H A;  3QIJ A;  2CU1 A;  1PGA A;  3RNG C;  1MHH E;  2MQJ A;  1FNW A;  5C23 A;  3T9L A;  2LXA A;  4W9J A;  3PPA A;  1OQY A;  2MP2 B;  2H89 B;  5G5H A;  3B9J A;  1RAX A;  2FUH B;  5G2N A;  3ETR A;  1WJ4 A;  2WLB A;  1V1P B;  1WRD B;  4K3B A;  1T0Q C;  3AH7 A;  3UGB B;  3SR6 A;  3BVZ A;  1P7F A;  4H2A A;  1TKE A;  2CR5 A;  2INN E;  2O6V A;  4M8N A;  2AQ2 B;  2OJR A;  3KQ4 A;  2D3B A;  3AUL A;  3V3X A;  2WXI A;  1XD3 B;  3W5U B;  1UBQ A;  4W9K A;  4I6P A;  3DDC B;  1CMX B;  5HHD G;  3AE1 B;  5JHB A;  3A4S C;  3JYU A;  4XC2 A;  3U30 A;  2K39 A;  2V3N A;  2FIF A;  2R2Q A;  2B3A A;  2HTM E;  2K0P A;  3HVZ A;  2EMT A;  2WYQ A;  2LEK A;  3DBS A;  3DVN V;  4BKS D;  1LQB A;  2Y3A A;  1N60 A;  2ON8 A;  4PS8 A;  1TBE A;  1HXY D;  1NDD A;  3DCG A;  3ZTC A;  1QKZ A;  1H8C A;  1FRR A;  2JY6 A;  1RWS A;  1BT0 A;  2E6X A;  1I4X A;  3IT6 B;  3TL5 A;  2ONQ A;  1WH3 A;  1L4D B;  3VHT C;  4A9A A;  2MBQ A;  3ZYY X;  4DHJ B;  1XCQ L;  3BIN A;  3ZRC A;  3NG0 A;  4B95 A;  3ECI A;  4MH8 A;  3S2A A;  3ZUN A;  1Q5W B;  1JRO A;  5CHW A;  1MJD A;  4HKZ E;  1BUI C;  1Q0W B;  2NTS A;  5G5G A;  1ENF A;  3KWV A;  3MC8 A;  1YIW A;  2KAJ A;  2M8S A;  4EEW A;  1PGX A;  2ZJD A;  2XN9 C;  1ACC A;  1V9J A;  4N58 A;  3W5V B;  4C7Z A;  2DYO A;  1YD8 U;  3DHH C;  4JIO U;  1NI3 A;  2N9X A;  3BVG A;  3L54 A;  4C00 A;  1LXD A;  2UWQ A;  2BYV E;  4WAA A;  4TQ0 A;  1P3Q U;  3E9S A;  4ZRP A;  4AP4 C;  3VXW A;  4MH0 E;  3P63 A;  4J3O D;  3L16 A;  1GC7 A;  2RSU A;  1WGD A;  2DZK A;  3A9J A;  1NI2 A;  2LI5 A;  1FRD A;  4HPL B;  2KTR B;  1OEY A;  2LGD A;  4DQO C;  1ZE3 D;  3LJ3 A;  1NVI D;  2SEB D;  3EC8 A;  3N1X C;  3WCQ A;  3RI7 C;  4OZB A;  2LZ6 A;  2KFK B;  2LGI A;  3AE6 B;  3PO0 A;  2XK5 B;  1WZ0 A;  4RGM A;  4DHZ B;  4XZ4 A;  3DOW A;  3ZIM A;  4W9D A;  2G1E A;  1CQV A;  1JWS D;  5GMV A;  2N7D A;  2KK8 A;  2FUG 1;  4O1N A;  4GGQ A;  3JSV B;  4HPP A;  1KTK A;  1HZ5 A;  5CX3 A;  5IAA C;  3NHE B;  3DVG X;  3N30 A;  2AL6 A;  1F1H A;  1J8C A;  1V81 A;  5LXH A;  1TZO A;  4MJS A;  2TSS A;  4NJ6 A;  1FXA A;  1TGZ B;  3RNB C;  3BK2 A;  1P7E A;  2PPH A;  2NBU A;  4NJC A;  5D7G A;  1MFW A;  3H7P A;  2NTT A;  1WGG A;  2BS3 B;  3OAW A;  1IUE A;  4MGY E;  2J0M A;  2PVG C;  2KHW B;  3EFU A;  1WM2 A;  3GE3 C;  1QZE A;  3Q8C A;  4A6Q A;  1ZPS A;  5AZF A;  2DAJ A;  4W9G A;  2MWS B;  3URY A;  1E6E B;  2KKC A;  1FNV A;  4GSW A;  2LMC A;  4DBG A;  1DGJ A;  2MCN B;  4E74 A;  4URK A;  4M02 A;  2J0K A;  3IXS A;  1E5W A;  4OZA A;  2BYT A;  3ZXR A;  3CWI A;  4YSY B;  3W2D A;  2AQ1 B;  1TIF A;  3CMM B;  2DBY A;  3RMK C;  3B08 A;  2HTH A;  4II3 B;  1LM8 B;  4M01 A;  4DK5 A;  1S1Q B;  2BQQ A;  2KVR A;  3LDZ E;  4IOI E;  1WGH A;  1D5Z C;  5D3I B;  3RCZ A;  4D2K A;  1UF0 A;  2IO2 B;  3SDL C;  4F8C B;  3A9J B;  1SE2 A;  4ITK A;  2CJO A;  4HRS A;  2J42 A;  3LYY A;  3ML9 A;  5AZG A;  1WX8 A;  2CKH B;  3K9O B;  2NMQ A;  1L4Z B;  4RFB A;  2C9W B;  3ZXV A;  1TT5 B;  2YEP F;  4HCN B;  4M00 A;  1D3Z A;  4M0W B;  4II2 B;  1N62 A;  3H1U A;  4A3P A;  2PJH A;  4GLS C;  1GB1 A;  1R7S A;  2DZI A;  3IHP C;  1XLQ A;  2FCQ A;  2RR9 A;  5BMI A;  3ZTD A;  1IGD A;  1T0S C;  4B0M A;  4ZHP A;  3TEW A;  2JRI B;  2PLP A;  3NZ3 A;  2FID A;  3ZO5 B;  1UD7 A;  2WGS A;  1WIA A;  1P9D U;  4CYE A;  1MG4 A;  2MJD A;  5T8I A;  3A9K B;  1N6Z A;  4I6L B;  4WWM A;  5HG2 A;  4MGZ E;  3Q8F A;  4IM3 A;  1D6E C;  1V8C A;  5BMH A;  2PTL A;  1EF1 A;  2IYD B;  3AI5 A;  1GJZ A;  2QC8 A;  2WS3 B;  4AWJ A;  3U8Z A;  2K1F A;  1C9F A;  3PGE A;  3N9Y C;  2L83 A;  1SJE D;  3A33 B;  4BBN F;  1P0R A;  3MHZ A;  4IG7 B;  2JUO A;  1VD2 A;  2FNJ B;  2HD5 B;  3M95 A;  5EE3 A;  3QHT A;  2GI9 A;  4HEA 1;  1FFU A;  2ZCC A;  1KJT A;  1NYR A;  3AE4 B;  1Q10 A;  3V6E B;  2VRR B;  2GBM A;  2G9H D;  3HRD D;  1FXT B;  2HJ1 A;  1C76 A;  4A55 A;  1C78 A;  1QIL A;  3BK1 A;  1XEE A;  3R7R A;  2KQ7 A;  3CF6 E;  4HK2 A;  2KX3 A;  1UBI A;  4KGS A;  1FCC C;  3B0A A;  1XO3 A;  2BGF A;  3FIL A;  1EU4 A;  1EWC A;  3C8Y A;  1F9J A;  2J4X A;  2QEJ C;  2XNA C;  5E6P A;  4C56 C;  2FAZ A;  1J7C A;  3L17 A;  1WRI A;  5EE0 A;  5LLI A;  1WI0 A;  2KJ6 A;  1RFA A;  3Q3F A;  2Y5C A;  2LHD A;  2GBJ A;  5AZH A;  1V2Y A;  1AW7 A;  2D3A A;  1YX6 B;  5L83 A;  4LNN A;  5DPR A;  2DWQ A;  2QDF A;  3T3O A;  3HM3 A;  5C1Z A;  4JX1 C;  1C4P A;  2V0G A;  1C77 A;  1KF6 B;  4LNI A;  2WX1 A;  3L13 A;  3NRZ A;  1KRH A;  4WH4 A;  4GIV A;  3B2F A;  4XE0 A;  1YJI A;  4YWG G;  1A70 A;  3BZD B;  2L00 B;  1FM0 D;  4DHJ D;  4HRO A;  4AQ7 A;  1YX5 B;  2BYE A;  4BVU C;  5IKC M;  3GZN B;  2BKF A;  1C4A A;  1RFK A;  1XXG A;  3R8B A;  2O2V A;  5JXV A;  4RM8 A;  1QOA A;  4GDK B;  1I4G A;  4EZK A;  2WXH A;  4RF0 A;  3HHM A;  5AEK B;  3P4R B;  1X1M A;  1SGH A;  1J7A A;  3AXC A;  3HK0 A;  1T0Y A;  5E6O A;  4IM2 A; 
#chains in the Genus database with same CATH homology
 1J19 A;  3QAQ A;  1WJN A;  1WJU A;  3WAO A;  1WR6 E;  3DBS A;  2MBO A;  3DVN V;  4GMV A;  4BKS D;  1A5R A;  2ASQ A;  3ZDM C;  3ZNH B;  1LQB A;  4BFR A;  4WJN A;  5D94 A;  4PS8 A;  1TBE A;  1NDD A;  3HIZ A;  2LGY A;  3T8M A;  3L10 B;  3DCG A;  3ZTC A;  1V80 A;  2DHZ A;  1H8C A;  2KJR A;  4MSM B;  3M63 B;  1WMH A;  2JY6 A;  3L08 A;  2RGF A;  1PQS A;  1BT0 A;  1MG8 A;  3DBR I;  2MA9 B;  3KW5 B;  4A20 A;  2KDB A;  3OLM D;  3C0R B;  3V60 A;  3AU4 A;  3SHQ A;  3TL5 A;  4ICU A;  2DX5 B;  2XK5 A;  3PHX B;  5HKH A;  1E8X A;  1WH3 A;  2KDF B;  2M17 A;  3VHT C;  2PE6 B;  3BY4 B;  3TBL D;  2MBQ A;  1OEY J;  3KUZ A;  1IPG A;  1WYW B;  1HE8 A;  3DQV A;  3BIN A;  4DHJ B;  3ZRC A;  4B95 A;  3IFW B;  3RT3 B;  2IZV B;  3ECI A;  3QWZ B;  3NZS A;  3S2A A;  3P2B A;  1WXM A;  3ZUN A;  1Q5W B;  3DBL I;  2MW5 A;  2BPS A;  3CST A;  4XX5 A;  3W1S A;  4ZYN A;  5DPT A;  3JW0 X;  2AEH A;  3JSV A;  2D10 A;  5CHW A;  2JF5 A;  1RRB A;  3MJW A;  3PLV A;  5DCN A;  4CHK A;  2KC1 A;  2ZVN A;  4WQO B;  4GN1 A;  3ZRF A;  2KMA A;  5LXI B;  1Q0W B;  2KNB A;  2AWT A;  2BYF A;  4OVV A;  1V6E A;  4WWP A;  4ICV A;  2N9E B;  4EUT A;  3PLU A;  4RM9 A;  2KJH B;  1WX7 A;  2LGX A;  3TCA A;  2LVP A;  2IY0 B;  1SE9 A;  1YIW A;  4GU2 A;  2N1W A;  3QCA A;  4W9I A;  2M8S A;  1GUA B;  2N1V A;  4WJQ A;  1ISN A;  3TMP B;  3R7Q A;  3KH0 A;  3VTU A;  1Y8R C;  4MJS B;  4BOS C;  4EEW A;  1K8R B;  2CS4 A;  2ZJD A;  3PVL A;  5BO4 B;  5J18 A;  3QA8 A;  2OOB B;  3NY5 A;  2MBE A;  1V9J A;  1GC6 A;  2GMI C;  2DYO A;  1YD8 U;  3UF8 A;  5J2R A;  3OJ4 B;  4JIO U;  3PRM B;  2N9X A;  3L54 A;  1XQQ A;  4FBJ B;  1I42 A;  3ZNI D;  1KLV A;  3VTV A;  1LXD A;  2UWQ A;  2BYV E;  2ZNV C;  4B9K A;  4G11 A;  1V86 A;  2FCN A;  1V49 A;  2MSE D;  2PE9 A;  2IO0 B;  2QHO A;  2L0F A;  4HXD A;  1UEL A;  4WAA A;  3ZLZ A;  4TQ0 A;  4W9H A;  1P3Q U;  2KTF A;  4TUU A;  4AP4 C;  2KWC A;  3VXW A;  2NCN A;  3NS8 A;  4LJP B;  2LRU A;  4MH0 E;  1IYF A;  1OTR B;  2WX0 A;  4KSL C;  2GBK A;  1GC7 A;  2KX0 A;  3L16 A;  2RSU A;  1WGD A;  2ZZP B;  3DPD A;  2DZK A;  3CSF A;  3PRZ A;  3A9J A;  4NQK E;  1NI2 A;  2LI5 A;  2KZR A;  5KHO A;  2GBN A;  3A1Q A;  2O6V B;  4HPL B;  4K81 A;  5L95 C;  2KTR B;  3GOE A;  1OEY A;  2HE7 A;  2DZM A;  2LJ5 A;  4IC7 B;  2J7Q B;  2LGD A;  2G4S A;  1WMH B;  2WWZ A;  3LJ3 A;  3EC8 A;  3UQB A;  2MX2 A;  2W9N A;  4A3O A;  2LZ6 A;  1WGY A;  2KFK B;  4ZRI A;  1I35 A;  5IA7 A;  2IO3 B;  4ZDV A;  4E3C A;  2XK5 B;  1WJ6 A;  1WZ0 A;  3ALB A;  2WDT B;  1E90 A;  3QJZ A;  4K1R B;  4KVG B;  3UIO B;  2V3S A;  2RD0 A;  4DHZ B;  1EF5 A;  4XZ4 A;  2KDE B;  3DOW A;  3ZIM A;  4W9D A;  1R4N I;  4HCP B;  3RD2 A;  4JLC A;  5GMV A;  3TIX A;  2N7D A;  1E8Y A;  2KK8 A;  4PYU A;  3NZU A;  5TR5 A;  2N7E A;  2JT4 B;  3IG3 A;  3R3M A;  4FJV B;  2XEW A;  3JSV B;  4GGQ A;  4ZRJ A;  3W1Y A;  3I3T B;  4TKN A;  3OJ3 A;  4FAD A;  3PRE A;  5CX3 A;  5IAA C;  2IY1 B;  3NHE B;  4AUQ C;  2LUE A;  3PRP B;  3VAW A;  2AL3 A;  2KWV B;  3DVG X;  3N30 A;  4MEM A;  2YVC A;  4DDI D;  2AL6 A;  4KIK A;  3SD5 A;  2KFJ A;  4JL9 A;  2L05 A;  4K7S A;  3PS6 A;  4IUM B;  1J8C A;  1V81 A;  2G3Q B;  2ZCB A;  4WJO A;  2LWP A;  1P98 A;  4LDT B;  5LXH A;  3ML8 A;  4GB9 A;  4MJS A;  2K25 A;  4X57 B;  2GOW A;  2NBV B;  4HPM B;  3JVZ X;  2ZEQ A;  4NJ6 A;  2HJ8 A;  4IW0 A;  4LCD E;  1Z2M A;  3VH3 B;  2KAN A;  1OGW A;  4BBN C;  2G4D B;  1TGZ B;  3QQ8 B;  3APD A;  1E8W A;  1YJ1 A;  4W9F A;  2Y5B B;  4F1S A;  2C7N B;  2JPH A;  4EZJ A;  3EEC A;  3UIP B;  3WAL A;  2PPH A;  3A1Q B;  1UH6 A;  2BWE S;  2NBU A;  2FCM A;  1TTN A;  4GDL A;  1V5O A;  3H7P A;  4W9C A;  5D7G A;  1H4R A;  4FJY A;  1WGG A;  1WXS A;  2LVQ A;  3X0W A;  2N9P C;  2K8H A;  2O6V D;  3IBE A;  3OAW A;  4MGY E;  2J0M A;  3ZW3 A;  1EO6 A;  3V6C B;  2JXX A;  2KHW B;  3EFU A;  1WM2 A;  2CHZ A;  1ZGU B;  1ZW7 A;  3VTW A;  4IWQ A;  3X23 A;  1QZE A;  2D07 B;  2KO3 A;  3B1L X;  2DAJ A;  5AZF A;  4DXA B;  4I6N B;  2C7M B;  4JGH B;  3U7D A;  2MBH A;  5CHV C;  4YL8 A;  2M4N A;  2FCS A;  1G6J A;  2UYZ B;  4W9G A;  2MWS B;  2Z59 B;  4MDK E;  1TZ1 A;  2DEN B;  2PEA A;  2KKC A;  1Q1O A;  4GSW A;  2G45 B;  4KZC A;  4DBG A;  2DYM A;  2K6D B;  2MCN B;  1EUV B;  5G55 A;  4E74 A;  4BKG A;  4URK A;  2LD9 A;  2J0K A;  2C7H A;  1WM3 A;  3MHS D;  2NR2 A;  5KHQ A;  5J17 A;  1E5W A;  2D2Q A;  2MRP A;  4JQW C;  2NS5 A;  4ANU A;  2D3G A;  2R2O A;  2BF8 B;  2GBR A;  3WAN A;  3O65 B;  3ZDT A;  2ZNV B;  1L7Y A;  4B6W A;  3AU5 A;  3CMM B;  3V61 A;  3M3J A;  1E7U A;  4NPN A;  2ZPY A;  3A9K A;  3WIM A;  5EDS A;  4KZ0 A;  3B08 A;  2HTH A;  4J6I A;  4II3 B;  1LM8 B;  5DPS A;  4DWF A;  3PHW B;  4MSQ B;  2I1K A;  3ZNG C;  4BKS A;  2C60 A;  2JRH A;  4FHK A;  2N4F A;  3RZF A;  2M0X A;  2C5L C;  4DK5 A;  1S1Q B;  2KVR A;  2I1J A;  3LDZ E;  1WGH A;  1WY8 A;  2KFK A;  3N32 A;  3PV1 A;  3RCZ A;  2LRW A;  2Z0D B;  1U4A A;  2BKR B;  3PSE B;  4KIK B;  4RMA A;  2IO2 B;  5CTR C;  3SDL C;  2MP2 A;  4F8C B;  3A9J B;  4ANV A;  3H7P B;  2LAS A;  3DVN U;  3WA0 A;  2IO1 B;  1J0G A;  1AAR A;  2JVC A;  4DDG D;  3ML9 A;  1WGR A;  5AZG A;  1WX8 A;  2CKH B;  3K9O B;  2JZZ A;  4FN2 A;  4K7W A;  1YQB A;  2C9W B;  3PT2 B;  4FA6 A;  4FUL A;  2EKE C;  2V4L A;  4HCN B;  4CO7 A;  1D3Z A;  4HVB A;  4M0W B;  4HLE A;  4II2 B;  3ZKJ C;  2RPQ A;  2KLC A;  3H1U A;  3K9P B;  4A3P A;  3VUW A;  2PJH A;  3VVW B;  2L3Z A;  1LFD A;  1S3S G;  2NPT B;  4MGK E;  2DYB A;  2LVO A;  2NVU I;  2DZI A;  3IHP C;  3KYD D;  2L0T A;  2FCQ A;  1E8Z A;  2RR9 A;  3HM6 X;  4OVU A;  3ZTD A;  4PYZ A;  4NAW B;  1VCB A;  3H9D A;  3UQA A;  1GG3 A;  3D32 A;  2JRI B;  1Z5S B;  2FID A;  2LXC A;  3ZO5 B;  1UD7 A;  4HJK A;  1WIA A;  1WZ3 A;  1P9D U;  4GDK A;  2CHW A;  1L2N A;  2ZVO A;  1WR1 A;  4CYE A;  2DZJ A;  2JZ3 B;  5JZE B;  3L0W B;  3A9K B;  4I6L B;  3VUX A;  3ZNZ B;  2KMC A;  4MGZ E;  4IM3 A;  3Q3J A;  1V5T A;  1UZX B;  4KSK C;  5DPW A;  2KOX A;  5JH5 C;  2L7R A;  2A4Z A;  2KC2 A;  4E71 A;  2KD0 A;  2KXJ A;  2NBW B;  5E6N A;  5D6J B;  4W9E A;  3H7S A;  1EF1 A;  4FJZ A;  2IYD B;  3AI5 A;  3APF A;  3N3K B;  1GJZ A;  4FLH A;  3IVF A;  4AWJ A;  1E7V A;  3VH4 B;  3RYT A;  4GDL B;  2K8C A;  3U8Z A;  2K8B A;  2K1F A;  5D2M B;  3RUI B;  3VFK A;  3PGE A;  4M8M A;  2K6Q A;  1WXA A;  2O2V B;  3KVF B;  4FHJ A;  4NQL B;  3VQI A;  3RUL A;  4BKT A;  3A33 B;  4PS3 A;  3PTF C;  4BBN F;  1JRU A;  1P0R A;  4GXB A;  5JHA A;  3A4R A;  4IG7 B;  4KV2 A;  2JUO A;  4IWP A;  4NNJ B;  1VD2 A;  3TJP A;  3NOB A;  4LJO B;  2FNJ B;  4LDT D;  4AJY B;  2HD5 B;  1WX9 A;  3M95 A;  4HDQ A;  3GZN I;  4DHZ E;  4AJW A;  1R4M I;  3QHT A;  2KDI A;  4KDI C;  3R66 C;  2YLM A;  1KJT A;  2ZCC A;  1KOT A;  3DVG Y;  4G0N B;  3V6E B;  2VRR B;  3KUC B;  2GBM A;  4K7U A;  1FXT B;  4ASW C;  2D11 A;  3PZD A;  4WWO A;  2AYO B;  4ZRK A;  3R7R A;  4NAW A;  2KQ7 A;  3CF6 E;  4TV3 A;  1RLF A;  4HK2 A;  2KX3 A;  2EMS A;  4EZL A;  1UBI A;  3B0A A;  4WWN A;  3QK0 A;  2BGF A;  2KWU B;  1KM7 A;  4G50 A;  2V1Y A;  3ZVV A;  4IM0 A;  4F7Z A;  2DAF A;  1C3T A;  4AOF A;  1F9J A;  2ZPN A;  5E6P A;  2NPT A;  2A5U A;  1WFY A;  4N9F 4;  4MGI E;  3WAP A;  4MEL A;  2FAZ A;  3L17 A;  1P1A A;  5LLI A;  1WI0 A;  2KJ6 A;  4KDL B;  3WAM A;  4EFO A;  1RFA A;  4NY0 A;  3Q3F A;  3M62 B;  3QAR A;  4HDO A;  3APC A;  2GBJ A;  3H6N A;  3QIJ A;  2CU1 A;  1M94 A;  5AZH A;  3ENE A;  4MM3 A;  1V2Y A;  1WXV A;  1YX6 B;  4WJP A;  2MQJ A;  5L83 A;  1IP9 A;  3SU8 X;  5DPR A;  5C23 A;  1C1Y B;  3T9L A;  1WF9 A;  2LXA A;  5FR6 A;  3HM3 A;  5C1Z A;  4W9J A;  2Z0E B;  3PPA A;  1OQY A;  2KQS A;  4PS7 A;  2MP2 B;  2MLB A;  1NBF C;  2CHX A;  2KTR A;  3EHV A;  3KUD B;  4GOC A;  4P7I A;  4W9L A;  2BWF A;  1UGM A;  3VUY A;  1RAX A;  3VDZ A;  2MBB B;  2FUH B;  2KLG A;  5G2N A;  2L76 A;  3KYC D;  1SIF A;  2WX1 A;  1WJ4 A;  3L13 A;  3QX1 A;  1WRD B;  1XT9 B;  4GIV A;  4G3X B;  3QC8 B;  3ONS A;  3UGB B;  4ANW A;  1GNU A;  2L00 B;  2REX A;  4EOY A;  3RZW C;  4BOZ B;  2CR5 A;  2O6V A;  2OJR A;  2J0J A;  4M8N A;  4DHJ D;  1YX5 B;  2BYE A;  3AUL A;  4BVU C;  1XD3 B;  2BKF A;  4ANX A;  1UBQ A;  2JWZ A;  4W9K A;  4I6P A;  2O2V A;  3DDC B;  1CMX B;  4RM8 A;  4GDK B;  2L8J A;  3DBH I;  4EZK A;  5JHB A;  3A4S C;  3JYU A;  2KN5 A;  4HWI B;  4XC2 A;  3U30 A;  2K39 A;  3HHM A;  4IWO A;  5AEK B;  4NJ7 A;  1WE7 A;  2FIF A;  2IBI B;  1ZKH A;  3UIN B;  3W1S C;  1X1M A;  2R2Q A;  1SGH A;  3MTN B;  5CHF A;  3AXC A;  3V62 A;  2B3A A;  3HK0 A;  1T0Y A;  5E6O A;  2M1M A;  2EMT A;  2WYQ A;  4IM2 A;  4TQ1 A;  4EKU A;  2XBB C;  1WE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...