2JUOA

Gabpa ost domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
89
structure length
89
Chain Sequence
MAECVSQAIDINEPIGNLKKLLEPRLQCSLDAHEICLQDIQLDPDRSLFDQGVKTDGTVQLSVQVISYQGMEPKLNILEIVKTAETVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and structural characterization of a CBP/p300-binding domain from the ETS family transcription factor GABP alpha
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords GA-binding protein alpha chain
total genus 14
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2007-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11620 GABP-alpha GA-binding protein alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2juoA00
4F7ZA 2LVQA 2KK8A 2KFJA 2KZRA 2L0TA 3ENEA 4XZ4A 3JYUA 4IUMB 2Z0DB 3M62B 3IVFA 2JUOA 3KUCB 2LVOA 4BKSD 1WJUA 4FA6A 3NHEB 1ZGUB 4W9JA 3QCAA 2FCQA 1YQBA 3ZDTA 2KMCA 3ZDMC 4IWPA 3QQ8B 2I1JA 1GJZA 1EUVB 2KWCA 2ZCBA 3W1SA 1WE6A 5LXHA 2CS4A 1A5RA 1UZXB 4BKSA 2KN5A 3DCGA 3PLVA 1EO6A 3AULA 2KC1A 2K39A 3Q3JA 4ANUA 1IPGA 4MGIE 1WGHA 2ZVOA 3GOEA 2LI5A 3L16A 2MW5A 1WFYA 2NBWB 4DHZB 2JPHA 4NAWB 1QZEA 2IO0B 2IO3B 4K81A 2MBHA 4RMAA 1E8WA 2GBJA 3VTUA 4JGHB 3KUZA 2KJRA 2R2QA 2BKFA 2PE9A 1VCBA 3MTNB 5CTRC 2DHZA 1KM7A 2R2OA 3KW5B 1UBIA 4DDID 3QAQA 4DXAB 4BBNC 2KD0A 2NPTB 4ZDVA 3V61A 1RAXA 3KVFB 3DBRI 3WAMA 2BWES 4WAAA 1WMHA 4WQOB 4G11A 5DPWA 2KHWB 3H7SA 3UINB 1LXDA 2G45B 2GOWA 3VTWA 4EEWA 4HDQA 4F1SA 4NJ6A 4XX5A 1WR1A 3BINA 5J18A 2LASA 4EOYA 2KTFA 3U8ZA 4GGQA 3KYDD 3R7QA 4FN2A 2IO2B 3L13A 3VTVA 4WJNA 3NOBA 4FJYA 2EKEC 1WYWB 2MSED 4TQ0A 2NBVB 4RM8A 3A33B 3ZTCA 4I6LB 3QK0A 3L17A 4KIKA 1UGMA 2CHXA 3A1QB 2KDFB 2LGDA 3ML8A 3VAWA 5CX3A 2L0FA 4PS7A 4EZLA 4IW0A 4PS8A 4BKTA 4K1RB 2KDIA 2MBOA 1C3TA 3KYCD 2DENB 3TL5A 4FJZA 4KZ0A 4FHJA 3ZNHB 4N9F4 3AU5A 4JQWC 4LCDE 1F9JA 5CHWA 3T9LA 1NDDA 3HHMA 3ZKJC 2M8SA 4MGYE 2V1YA 1PQSA 4HJKA 4A20A 5AZGA 1C1YB 2AEHA 4EFOA 2KDEB 4G0NB 2IY0B 3CF6E 1FXTB 3M3JA 4JLCA 5DPTA 2JY6A 3TIXA 3VUYA 3ZNGC 2KFKA 2KTRA 2NR2A 5J2RA 4BVUC 2V4LA 2C7HA 2BPSA 2K6QA 2WYQA 5LXIB 2HD5B 1TBEA 2DZJA 2OOBB 1E7UA 3CSTA 5KHQA 2PEAA 4AUQC 2L05A 2O6VA 5J17A 4A3PA 1J19A 3PPAA 2K8CA 3TMPB 2RPQA 4A3OA 5G55A 1EF1A 1E7VA 2FIFA 2KKCA 3APCA 3RZWC 2KNBA 2RGFA 3UIPB 4NQLB 1YX6B 1WJNA 2JWZA 3IHPC 1K8RB 3MHSD 5CHVC 1WZ0A 3VDZA 3PRPB 1V5TA 4HPLB 1WXAA 1CMXB 3QHTA 2ZZPB 4JIOU 3X23A 2HE7A 4KSLC 2KXJA 4GDLB 2D10A 2ZNVC 4ZRKA 3V60A 2JZZA 5AZFA 2OJRA 4B95A 2Z59B 4TUUA 4BBNF 4DBGA 4LJOB 3V6EB 5C1ZA 4ZRIA 1UELA 1WF9A 5D6JB 3VVWB 3DDCB 2L3ZA 2L76A 1GNUA 2PJHA 4HCNB 2L00B 4MJSB 3APDA 4PS3A 4HPMB 1E8YA 2CHWA 2LGXA 3OLMD 2D11A 2N4FA 2WDTB 4NQKE 2W9NA 1UH6A 4DHJD 3A9JA 3ZO5B 4B6WA 2IBIB 2NPTA 2Y5BB 3NY5A 3CSFA 2J0JA 2BYVE 4IM3A 4WJPA 4II2B 4M8NA 1AARA 1JRUA 4E3CA 4W9FA 1R4MI 4HCPB 3DVGX 1X1MA 1WIAA 2N9PC 3JW0X 2A4ZA 1WGDA 3DOWA 3UGBB 2N9XA 2KFKB 2NS5A 3HIZA 1LM8B 4X57B 2MP2A 3RD2A 3SD5A 2MQJA 4ICVA 2RR9A 3KUDB 2LRWA 3WALA 2I1KA 1Z2MA 1WXVA 2DYMA 3TCAA 4E74A 2GMIC 2IO1B 3VXWA 4FHKA 2A5UA 2EMSA 3H1UA 1OEYJ 1IP9A 4W9HA 4W9DA 1V49A 4TQ1A 5JZEB 3HM6X 2HTHA 3PS6A 4HK2A 2UYZB 1KJTA 4K7SA 2LD9A 2RD0A 3PVLA 2C60A 1OTRB 2REXA 1WGGA 3QA8A 3RCZA 4GMVA 2LXAA 2K8BA 1KLVA 4K7UA 2N9EB 1NI2A 2Z0EB 5BO4B 2XBBC 4G3XB 5L95C 2XK5B 2GBMA 1WH3A 3O65B 3PT2B 3VUXA 2KOXA 3APFA 3PSEB 4BOZB 2NVUI 4CYEA 4AJWA 4GDLA 5GMVA 4E71A 2C7MB 2FAZA 4TV3A 2KANA 2ZNVB 1GG3A 3QARA 3RULA 3ZTDA 4IC7B 1L2NA 1E8XA 1WMHB 3Q3FA 3UIOB 2XEWA 2NCNA 4OVVA 2N7DA 4ANVA 4NJ7A 1WJ4A 3RZFA 1Q0WB 4RM9A 2YVCA 5DPSA 4TKNA 1RRBA 2J0KA 2LGYA 5L83A 1KOTA 4W9IA 3VFKA 2G4DB 3VUWA 2MBBB 1OEYA 2O6VB 3A9KB 5E6OA 1UBQA 3R7RA 1GC7A 2LJ5A 4JL9A 4W9KA 2IY1B 4CO7A 1XT9B 2O2VA 2M17A 4GU2A 3JSVB 1WE7A 2L8JA 4GOCA 5JHBA 3PRZA 4HXDA 3PLUA 5IA7A 2FUHB 3ZIMA 1J0GA 2MLBA 2KC2A 3B08A 5JHAA 2G4SA 2KTRB 3ZNID 3BY4B 2IYDB 2MWSB 2LWPA 3M95A 5D7GA 3X0WA 3V6CB 1WGRA 4WJQA 1OQYA 4LJPB 1SGHA 3OJ4B 2KMAA 2KLCA 2JRHA 2B3AA 3PRMB 4GDKA 2MBQA 4MDKE 4WWOA 2WX1A 1XD3B 2DAFA 1RLFA 2J7QB 1BT0A 3W1YA 3DBLI 3N3KB 3UQAA 4WWNA 3U30A 2V3SA 3AI5A 3EC8A 1VD2A 4HVBA 3LDZE 1LQBA 4MEMA 4GXBA 1WY8A 5G2NA 5TR5A 2N1VA 4GN1A 1T0YA 1ISNA 2DZKA 4AP4C 2DZIA 5CHFA 2DZMA 2KQSA 4MGKE 4FLHA 3VH4B 4F8CB 2AL3A 2BKRB 2FNJB 1E8ZA 2K1FA 3ZRCA 2BGFA 1Q5WB 3CMMB 2ASQA 2C9WB 4ANXA 4KVGB 2KVRA 3NZUA 2KDBA 1GUAB 3GZNI 1YJ1A 1P9DU 2GBKA 3LJ3A 3OAWA 3U7DA 2JZ3B 4FBJB 5EDSA 1E5WA 2IZVB 1HE8A 1P0RA 4AOFA 2ZPYA 2QHOA 1D3ZA 3RUIB 3S2AA 5HKHA 3AU4A 2BYEA 2D2QA 3PHXB 3R66C 3W1SC 3UF8A 3QC8B 2VRRB 2JRIB 2KX3A 5DCNA 3L08A 1WR6E 2DX5B 3N30A 2BYFA 3DVNV 5AZHA 2FCNA 2ZVNA 3JSVA 5D94A 2O2VB 4IWQA 4NNJB 1P1AA 3PV1A 3SDLC 4DWFA 2MCNB 2C7NB 1WZ3A 4IM2A 5D2MB 5FR6A 2MA9B 2D07B 2FIDA 2XK5A 1WX8A 1LFDA 1WM3A 2CHZA 4WJOA 3PREA 1WXMA 2MBEA 3WAOA 3WIMA 2PPHA 1V86A 4IM0A 2KJ6A 1TTNA 4WWPA 2AYOB 1M94A 2O6VD 5E6PA 3DBHI 1UD7A 1P3QU 1ZKHA 1TGZB 4EUTA 1WRDB 2KLGA 2HJ8A 2LUEA 2DYBA 1H4RA 2KO3A 3R3MA 4KIKB 4ANWA 1XQQA 3ZUNA 2EMTA 4BFRA 2WX0A 4IWOA 2ZEQA 3QIJA 3L54A 2BWFA 2KWVB 3JVZX 4YL8A 4DHJB 4FJVB 5LLIA 1Q1OA 4LDTD 3A4RA 4M8MA 1GC6A 3ALBA 3PHWB 2MP2B 2M4NA 4FADA 1RFAA 2KJHB 2G3QB 2MX2A 3SU8X 4DDGD 3VH3B 4II3B 4BOSC 2GBRA 1E90A 2KX0A 4NPNA 1NBFC 1ZW7A 4ASWC 2ZPNA 3VQIA 2LVPA 4KDLB 2L7RA 3ZNZB 4HLEA 4ICUA 1OGWA 3TBLD 3ML9A 3QWZB 1SE9A 1WXSA 4G50A 2WWZA 4NY0A 1S1QB 3ZLZA 3ZW3A 3PGEA 1WX7A 3VHTC 4W9CA 4W9GA 3ZRFA 3DVGY 2K8HA 4BKGA 3H7PA 4J6IA 4KZCA 4I6PA 2CKHB 2FCSA 3B1LX 2AWTA 4GIVA 2D3GA 5KHOA 3K9PB 3A1QA 3C0RB 2JXXA 1SIFA 3V62A 1WJ6A 3KH0A 4PYZA 4EZKA 1G6JA 1L7YA 4GSWA 1EF5A 3IBEA 4MM3A 3PZDA 1P98A 2K25A 2DAJA 1R4NI 4HDOA 5JH5C 2KQ7A 3N32A 3WANA 5DPRA 2JT4B 2ZCCA 4AJYB 4URKA 4PYUA 2MRPA 2M0XA 3ECIA 2NBUA 3A9JB 1V80A 2RSUA 3ONSA 4AWJA 4KDIC 3IG3A 1WGYA 3TJPA 2UWQA 2YLMA 4DK5A 3SHQA 2N1WA 3L10B 2LZ6A 2M1MA 1Y8RC 3NZSA 1U4AA 3DPDA 3PTFC 1YD8U 3WAPA 4MH0E 4MJSA 3L0WB 1WX9A 4M0WB 4MSMB 3DVNU 4B9KA 2PE6B 4GDKB 1MG8A 1I35A 4IG7B 4DHZE 3D32A 2GBNA 2K6DB 1V9JA 2JVCA 4MSQB 4HWIB 4W9LA 2JF5A 4KSKC 1H8CA 3B0AA 4GB9A 2KWUB 3NS8A 3OJ3A 4I6NB 3DQVA 5AEKB 3QJZA 4P7IA 4EZJA 3EECA 1V5OA 3P2BA 4NAWA 3QX1A 3K9OB 2ZJDA 1V81A 3HK0A 3H7PB 4XC2A 3UQBA 1J8CA 3EFUA 3EHVA 2N7EA 1IYFA 3M63B 2CU1A 1YIWA 3A9KA 2BF8B 4MGZE 1YX5B 4W9EA 4ZRJA 3RT3B 3ZVVA 1S3SG 2J0MA 4KV2A 2LXCA 1WI0A 4CHKA 3WA0A 4LDTB 5IAAC 3DBSA 3HM3A 1Z5SB 5C23A 2FCMA 4EKUA 3H9DA 2C5LC 3AXCA 4MELA 4ZYNA 2CR5A 3MJWA 3A4SC 3H6NA 4K7WA 3RYTA 1V6EA 3I3TB 1WM2A 2AL6A 3IFWB 4FULA 4OVUA 1V2YA 1TZ1A 2DYOA 2LRUA 3T8MA 5E6NA 1I42A
chains in the Genus database with same CATH superfamily
4F7ZA 3TEWA 1VZ8A 2KK8A 2L0TA 3AB5A 2JUOA 1WJUA 3NHEB 1T0RC 1ZGUB 3QCAA 2FCQA 2W55A 4IWPA 2QIEB 4C56C 1WE6A 4BKSA 3DCGA 4ANUA 3AULA 4MM3B 3IT4B 5E6JA 1JQ4A 4NAMA 2NBWB 1QZEA 2G9HD 3KLSX 2MBHA 4C7ZA 2JXTA 3ZXVA 1ZOYB 2DHZA 1DYQA 2ACZB 1KM7A 1UNSA 2R2OA 4BBNC 4ZDVA 4OW0A 3V61A 3DBRI 3WAMA 4HJGE 2KHWB 2GOWA 3VTWA 4EEWA 4NJ6A 5J18A 2WDRB 2LASA 2ONQA 4EOYA 3U8ZA 2IO2B 4WJNA 3NOBA 2QMTA 4RM8A 3QK0A 1UGMA 2Z8LA 2KDFB 2WXQA 2L0FA 4IW0A 4PS8A 1QKZA 2LMCA 4IKGA 3AU5A 4LCDE 3T9LA 1NDDA 2M8SA 1PQSA 4KGTA 4HJKA 2AEHA 5DPTA 4JLCA 2JY6A 4HKQA 3ZNGC 2KFKA 2KTRA 2NR2A 5J2RA 2N7JA 3AECB 4KX6B 3J9CA 3Q8CA 2BPSA 2DZJA 2OOBB 2PW9A 2L05A 1QOFA 1SJHD 3MC9A 1J19A 2K8CA 1RM6C 3FKYA 3RZWC 1V1OA 2KNBA 4HEA1 3VDZA 1V5TA 2WHIA 1CMXB 2HE7A 2ZNVC 4TUUA 4BBNF 4DBGA 2J53A 1DOIA 4ZRIA 4HKZE 3DDCB 2L3ZA 1N63A 1FNWA 2ZW0A 2RDHA 4AQ7A 1V8CA 3ZJTA 4DHJD 1A70A 2PIAA 2J0JA 2BYTA 1HEZE 4IM3A 4WJPA 4E3CA 2PVOD 4HCPB 1C4AA 2OHFA 4XWWA 1E10A 4D2KA 1WIAA 3NS1A 1UWMA 4X57B 3SD5A 4ICVA 2RR9A 2LRWA 3WALA 2I1KA 1Z2MA 1WXVA 3TCAA 2IO1B 2A5UA 4WIPA 4W9DA 3PS6A 1YQ3B 2ZW1A 1OTRB 1TKYA 1YMHE 2LXAA 2NTSA 2ICIA 4K7UA 1JCKB 2XBBC 4G3XB 3HVZA 5L95C 1Q10A 2WXIA 2GBMA 2XK5B 4JPSA 1WH3A 3EUB2 3PT2B 3APFA 1N5XA 1B1ZA 2FAZA 3AMZA 4TV3A 2RPVA 1GG3A 1QF6A 1L2NA 3Q3FA 2XEWA 4OVVA 1P7FA 2N7DA 3ZXRA 4ANVA 3IT6B 3RZFA 4RM9A 2YVCA 4TKNA 1UWXA 2GRIA 1BXTA 3AEBB 1E0ZA 1TY0A 1JWSD 1F2RC 2LJ5A 4C80A 2M17A 3Q8BA 1WE7A 2D5GA 4TSSA 2KTRB 3BY4B 5D7GA 3BVGA 3FILB 3V6CB 1WGRA 2JQRB 2KN4A 2KMAA 2WQYB 2MBQA 4MDKE 4WWOA 4C7YA 2DAFA 2J7QB 3DBLI 3N3KB 1F1HA 3UQAA 2V3SA 3AI5A 3LDZE 4MEMA 2LHDA 2G1EA 5G2NA 2DZKA 4AP4C 2NMQA 3NJTA 4FLHA 2BKRB 2K1FA 2WXRA 2VZKB 3CMMB 3AE7B 3P4PB 1EWYC 1D6EC 1PGXA 4YT0B 3KQ4A 3LJ3A 3EGRA 1XF5L 2WXMA 3N9YC 5IO9A 5EDSA 2IZVB 2ZPYA 2QHOA 4NZLB 1QOGA 3AU4A 2D2QA 4CQNA 3UF8A 4US8A 2JRIB 3L08A 4C00A 5AZHA 1DOYA 3JSVA 4IWQA 4NNJB 1C77A 2NTTA 5FR6A 2MA9B 1L6UA 1D4BA 1WM3A 3PREA 4WAFA 1R4MB 2MBEA 1V86A 5IP4D 1F0ZA 4WWPA 3ABVB 1TZOA 1P3QU 3C8YA 2JZPA 3R3MA 1H4RA 4KIKB 1PDXA 3ZUNA 1TS4A 2EMTA 2WX0A 4IWOA 2OJWA 4YXDB 4FJVB 4O1NA 4LDTD 2J42A 2MX2A 1HTQA 1MHHE 1FCCC 3GP7A 4S17A 3E9SA 1SIJA 1FMAD 2QJLA 3MP9A 3CWIA 3DHGC 3O13A 2ON8A 4RF1A 2M19A 3HVDA 1FIQA 1EWCA 3TBLD 3QWZB 4LNFA 2WWZA 3ZLZA 4WQMA 2V4IB 1I4GA 3BWUD 1NI3A 3DVGY 2K8HA 2B76B 2IDYA 4KKJA 2D3GA 3A1QA 1E7PB 1B9RA 3MJ5A 1WJ6A 3KH0A 4EZKA 4L23A 5LNK1 3RNBC 1R4NI 5DPRA 3T3OA 1XLPA 1V80A 2RSUA 3GE8C 2WLBA 2YLMA 4DK5A 1K53A 2WXNA 3AE2B 1Y8RC 3NZSA 4MSMB 3DVNU 4GDKB 4DHZE 3D32A 3RFZB 2YEPB 3IXSA 2JF5A 2DBYA 1R7SA 2KWUB 3OJ3A 5GXGB 3P1MA 2GI9A 1V1PB 2N7EA 1IYFA 2IPKD 1K50A 3CIRB 2INNE 1YIWA 3A9KA 2BF8B 4MGZE 1YX5B 3UI3A 4ZRJA 4XE0A 4KV2A 4OZAA 3WA0A 4LDTB 3DBSA 3HM3A 5C23A 4ZYNA 3MJWA 3AEFB 1JROA 1V6EA 2AL6A 1TS3A 1TZ1A 2DYOA 3N1YC 2PMVA 2INPE 3JYUA 2Z0DB 2DNFA 2N0SB 2WXLA 3KUCB 2LVOA 3T3NA 4W9JA 2KMCA 3ZDMC 1AYFA 1GJZA 4JX1C 3P4SB 1J7AA 4ITKA 1UZXB 2AQ1B 3PLVA 2XNAC 2KC1A 3Q3JA 1NVID 1WFYA 2UU7A 3P42A 4NAWB 2YEPF 2IO0B 4ZOHC 3SFEB 4K3BA 1YNTE 3KUZA 2BKFA 3GE3C 2AQ2B 3NRZA 2MEKA 2JYEA 4DDID 4YSYB 2BWES 4WAAA 3W5VB 2M0AA 5DPWA 3H7SA 4HDQA 3BINA 2KTFA 4FN2A 3L13A 4JE3B 2EKEC 1XEEA 3NVWA 2LGDA 3P4QB 1L4ZB 2KDIA 2MBOA 3HUIA 3TL5A 4FJZA 3DBHB 4FHJA 1KLGD 3ZNHB 1FRDA 4C4VA 1F9JA 1T0QC 2LFIA 2V1YA 2KMMA 5AZGA 1C1YB 2KDEB 2W54A 2IY0B 3CF6E 1KTKA 3SEBA 2CU3A 1I4XA 1IBXB 4Q2JA 4LK0M 4RGOS 1K51A 3P4RB 3Q8AA 3CSTA 1ET6A 5KHQA 2PEAA 4AUQC 3E56A 5JXVA 2W3RA 4A3PA 2RPQA 2HJ1A 5G55A 2FIFA 3APCA 2FBWB 2RGFA 1T5XD 1WGKA 4NQLB 1YX6B 5CHVC 4HPLB 2R61A 2PTLA 3LYYA 2D10A 4ZRKA 4WURA 4N59A 4B95A 5D6JB 4HCNB 3PZ7A 1SJED 1FNVA 1N61A 3EA6A 3OLMD 2LHEA 4GLSC 5EE9A 4MT5A 3ZO5B 1KFYB 3NY5A 3CSFA 2BYVE 1MJDA 4XWTA 1JRUA 3BZDB 3Q3NC 1OQRA 3JW0X 1YQ4B 1IGCA 2NS5A 3DWMA 1LM8B 3RD2A 2MQJA 3KUDB 1T3QA 5EE3A 3RPFC 2DYMA 3VXWA 1V1PA 3AEGB 4W9HA 1V49A 2FE8A 1ZP0B 1KJTA 2RD0A 2C60A 1KLVA 2K8BA 1KLUD 2LGSA 2N9EB 5BO4B 3VRBB 2I2YA 3VUXA 4AJWA 5GMVA 4E71A 1JWAD 4IC7B 1E8XA 3UIOB 1N62A 1D5MC 2NCNA 4J3OD 2J0KA 2LGYA 5L83A 1KOTA 4P1BC 2BW2A 2G4DB 3VUWA 1JWUD 4RFBA 1XT9B 2O2VA 4KGRA 3TUOA 2V3PA 4GU2A 3PRZA 1LGRA 2FUHB 3V3XA 3B08A 5H8YE 2G4SA 1IBXA 3ZNID 4M01A 4PT5A 2LWPA 3X0WA 3NZ3A 1YN4A 4N6EB 1T6BX 4RCOA 2WX1A 2K5PA 3RNGC 1RLFA 1SXTA 1FEHA 1GAQB 5TR5A 2N1VA 4GN1A 1T0YA 2DZIA 1QT9A 3Q3OC 5CHFA 4MGKE 2AL3A 4RGMA 2D3CA 3MFGA 5EE0A 3NUHB 3ZRCA 2BGFA 2MH7A 1Q5WB 2ASQA 2C9WB 5D3IB 1VZ7A 2KVRA 3GZNI 5IKCM 3BIID 1P9DU 2GBKA 3Q8FA 4FBJB 1FFUA 3I57A 2Y5PA 3VR8B 5HKHA 3R66C 4ARIA 2VRRB 4A6QA 2KX3A 1F52A 1WR6E 3N30A 1TKEA 2ZVNA 4ZYSA 2BVCA 1PFDA 1L0YB 2MCNB 1SF0A 5D2MB 4IM2A 2FIDA 5HG2A 2MJDA 2CHZA 4WJOA 1QOBA 1MI0A 2AYOB 2IJ0A 2O6VD 3AE4B 1WRDB 2KLGA 2LUEA 2DYBA 2E3TA 4ANWA 1N60A 2WXJA 2BWFA 3JVZX 1Q1OA 3DHIC 1GC6A 4A8XC 2MP2B 2M4NA 2WS3B 4FADA 1WRIA 5BMIA 3SU8X 3TSSA 1RYJA 1GOZA 1LO5D 4H2AA 4NPNA 3VQIA 2LVPA 4KDLB 1P7EA 3ZYYX 4DXFA 4XGAB 4G50A 4NY0A 3PGEA 1WX7A 3RNEC 2BS3B 2KT7A 4W9GA 3MHZA 4KZCA 1UGJA 1STEA 2CKHB 2K3UA 4BAXA 4GIVA 1HTOA 3C0RB 2JXXA 1SIFA 3V62A 5BYRA 3ZGZA 1WWTA 1GPXA 4RGTA 1K52A 1OQQA 2KQ7A 3N32A 2MRPA 2M0XA 2NBUA 3ONSA 4KDIC 1WGYA 1L0VB 2N1WA 3DPDA 3PTFC 1E6EB 2WU5B 1YD8U 2RDBC 4DXGA 4M0WB 3N1ZC 1VR9A 3FAHA 5C2TB 2N9KA 2PE6B 1F2RI 1I35A 2K6DB 1V9JA 2JVCA 4MSQB 2RMMA 4I6NB 5AEKB 1WYGA 3EECA 1V5OA 4NAWA 1L5PA 3QX1A 1J8CA 3EFUA 2GB1A 1HZ6A 1KH0A 2VH2A 3RT3B 4FXCA 4AS1A 5IN7A 4R3DA 1XLOA 4P6VF 4CHKA 3Q2AC 3B2GA 3MC0B 1R4NB 2KAJA 2D3BA 2C5LC 3AXCA 3A4SC 3H6NA 3RYTA 3I3TB 1WM2A 4OVUA 2L1AA 2LRUA 2LGIA 3T8MA 1I42A 2WXPA 2KFJA 2KZRA 1HQRD 4IUMB 3M62B 4IDIA 3IVFA 3N20C 4B0EA 4BKSD 4L2YA 4FA6A 1SE4A 1OFFA 4OZCA 3ETRA 1MHXA 4M02A 2KWCA 1SBBB 2ZCBA 3RNCC 2GLSA 1NEKB 3W1SA 1A5RA 1ZXIA 2CS4A 3WCQA 1EO6A 3RN9C 2K39A 2VZKD 1IPGA 1MPEA 2ZVOA 3SFDB 3L16A 2LI5A 2MW5A 4DHZB 2JPHA 3AEDB 3W9CB 1SSNA 4S0RA 2KJRA 2R2QA 3MTNB 2VH1A 4OVZA 2KD0A 3KVFB 4MACA 5HFYA 1WMHA 4WQOB 1FCLA 4G11A 3UINB 1LXDA 4XX5A 2LUMA 5C3JB 4GGQA 3KYDD 3AE8B 3VTVA 1DGJA 4FJYA 2MSED 4C4VB 3A33B 3ZTCA 4KIKA 2CHXA 4PS7A 4EZLA 4BKTA 4LNOA 4KZ0A 3P63A 4LNNA 3OWEB 4N9F4 4JQWC 1SE3A 1XLNA 3ZKJC 4MGYE 3Q3MC 3VR9B 3M3JA 2V4LA 2C7HA 2K6QA 2WYQA 3URYA 2HD5B 1TBEA 1ZDVA 2O6VA 3TMPB 2W3SA 1AW7A 1EF1A 2KKCA 2WXKA 4US9A 1WJNA 2JWZA 1WZ0A 5D3DA 3QHTA 4JIOU 3X23A 4KSLC 2KXJA 3V60A 2JZZA 5AZFA 2OJRA 2Z59B 3V6EB 4K3CA 5C1ZA 2I38A 1WF9A 5FR3A 2PJHA 4MJSB 4PS3A 4HPMB 1E8YA 2L83A 4JWUC 2LGXA 5BMGA 3I5JC 1ZXHA 1JALA 2N4FA 4YSXB 3RMKC 2W9NA 5HI1A 2LEKA 3DBRB 1ROEA 4B6WA 2NPTA 2Y5BB 1GB4A 3AM9A 3GS2A 4II2B 4M8NA 1EM7A 1R4MI 3DVGX 4BZAA 1X1MA 2N9PC 3BVZA 2A4ZA 1WGDA 3TEXA 3UGBB 1HZ5A 2KFKB 3HIZA 4E74A 2BBCA 2N9LA 3H1UA 1IP9A 4OHJA 1UF0A 4TQ1A 1AN8A 4HK2A 1I4HA 1JWMD 4XYCA 3RCZA 1MG4A 2Q5WD 5BMHA 1NI2A 1ENFA 1ESFA 3O65B 2V0GA 3PSEB 4BOZB 2NVUI 2C7MB 2Y3AA 2KANA 3QARA 2BQQA 1WMHB 4NJ7A 1XLQA 2KQ4X 3C19A 1OEYA 2O6VB 3A9KB 5E6OA 1GC7A 4JL9A 1PYWD 3R2TA 2WXHA 1JMLA 2L8JA 4HRSA 1YN3A 4GOCA 5JHBA 1J0GA 1GB1A 5IA7A 2MLBA 1FD6A 3NVVA 2KC2A 1FRRA 1T0SC 2W82A 4N58A 3HRDD 1QILA 2MWSB 2HTME 1OQYA 3MC8A 2KLCA 2JRHA 2B3AA 3NG0A 3W1YA 1BMLC 4HPPA 1V97A 4YTPB 3U30A 1LQBA 4GXBA 3AH7A 2X8XX 2DZMA 2KQSA 3VH4B 1XO3A 1E8ZA 3FILA 1VJKA 5BYQA 2JX5A 1C78A 2V3NA 4YWGG 2JZ3B 1FFVA 2DWQA 4IOIE 1TKGA 5EE1A 3S2AA 1QLBB 2BYEA 4WH4A 3W1SC 3QC8B 2D3AA 5DCNA 2DX5B 2BYFA 1NYQA 2FCNA 3SDLC 4YSZB 4DWFA 2C7NB 2D07B 1F77A 1WX8A 1LFDA 3AEEB 3BK2A 1WXMA 3EFCA 1CK1A 2KJ6A 1TTNA 1YJJA 1M94A 3DBHI 1UD7A 3R2IA 4HROA 1TGZB 4XDCA 2BT6A 2KO3A 1XQQA 2ZEQA 3QIJA 2KWVB 1C76A 2AX5A 5LLIA 3U52E 3ALBA 3PHWB 4QAYA 2KJHB 1QOAA 2CJOA 2FUG1 2MJ3A 4DDGD 1JRPA 3VH3B 1RWSA 2LJIA 3IAM1 2GBRA 4L1BA 2KX0A 3RNAC 1NBFC 2X38A 3BYYB 4REZA 4ICUA 2L32A 4XDDA 1SE9A 1WXSA 5BYSA 3ZW3A 3VHTC 2KDMA 4ZHPA 2BB6A 4BKGA 3H7PA 5KHOA 3K9PB 5G5HA 3IAS1 1G6JA 1L7YA 4MH8A 4MM3A 3DHHC 3IBEA 2DAJA 5JH5C 4M0WA 2ZCCA 4AJYB 2DLBA 4PYUA 3ECIA 1TY2A 4UDUC 3A9JB 4AWJA 2EKIA 4USAA 2UWQA 3SHQA 3L10B 2LZ6A 5H92C 2M1MA 2QEJC 1U4AA 4WWMA 3RI7C 4MH0E 3L0WB 1AWDA 1TJEA 1RFKA 1IUEA 1WSPA 1MG8A 2IGDA 3ZJVA 4KSKC 3DWGC 4B0MA 1CZPA 3NS8A 4GB9A 1XCQL 4EZJA 1J7BA 3P2BA 1ZE3D 4KKIA 3K9OB 1V81A 3H7PB 4XC2A 3UQBA 4EE2A 1PUTA 3M63B 2CU1A 4OZBA 1YOVB 4W9EA 2WXOA 3ZVVA 1ZPSA 1S3SG 1WI0A 4P1CC 1XXGA 1Z5SB 2FCMA 4EKUA 3W5UB 4MELA 1FXIA 1M4VA 1DOXA 3AE1B 3ZJUA 2LVQA 5FKAC 2Y5CA 3ENEA 4XZ4A 2JWUA 1YQBA 4P16A 3ZDTA 3QQ8B 2I1JA 1EUVB 3B2FA 1PGBA 5LXHA 2KN5A 3H8HA 2KYWA 5IOIA 4MGIE 3FC4A 1WGHA 2H89B 2AQ3B 3GOEA 1I7HA 2IO3B 4K81A 4A90A 4RMAA 1E8WA 2GBJA 3VTUA 4JGHB 3BYTB 2PE9A 1VCBA 5CTRC 1N5WA 2PLPA 3N1XC 3Q14C 3KW5B 5AUKA 2JYTA 1UBIA 3QAQA 4DXAB 2NPTB 1RAXA 2J52A 2G45B 4F1SA 1WR1A 4ZRQA 2KWDA 2MHJA 2WDVB 3V05A 3R7QA 3U4EG 1WYWB 4TQ0A 2NBVB 3W2DA 4I6LB 3L17A 3VAWA 3A1QB 3ML8A 5CX3A 4RNAA 2L52A 4K1RB 1C3TA 3KYCD 2WXGA 2DENB 1HA5A 2JSVX 5CHWA 2INCC 3HHMA 3SR6A 4A20A 1CJEA 4EFOA 4G0NB 1FXTB 3TIXA 3VUYA 1D5ZC 4JWSC 1N6ZA 1JWBD 4BVUC 4RF0A 5LXIB 1L6VA 1YJIA 1E7UA 4LTUA 1SB3C 5J17A 3Q8EA 3PPAA 4A3OA 1E7VA 3DBLB 3UIPB 3IHPC 1K8RB 3MHSD 3PRPB 3PO0A 2WNMA 1WXAA 2ZZPB 1FPYA 4GDLB 2BTEA 3AE3B 4LJOB 1UELA 3VVWB 2L76A 1GNUA 2H88B 2L00B 3APDA 2CHWA 4M00A 1ZUD2 3AE5B 2D11A 2QILA 1FM0D 3KWVA 2RDGA 2WDTB 4NQKE 1UH6A 3A9JA 2IBIB 1PGAA 1AARA 1Y56A 3GB1A 4W9FA 4YTNB 3RNFC 2MJEA 3DOWA 4PK1A 2N9XA 1J7CA 4YTMB 1L4DB 1EU4A 2MP2A 2SEBD 2GMIC 1IGDA 2K22A 2EMSA 4FHKA 1OEYJ 1HXYD 5AUIA 2V9HA 5JZEB 3HM6X 2HTHA 2UYZB 2K0PA 4K7SA 2LD9A 3PVLA 2REXA 1WGGA 3QA8A 2J4XA 4GMVA 3LXFA 3Q6BA 1MFWA 1VRAB 2EELA 2Z0EB 2BS2B 1I4QA 2KOXA 4CYEA 4GDLA 1BUIC 2ZNVB 1JW9D 3LB8C 3RULA 3ZTDA 1WJ4A 1Q0WB 5DPSA 4ZRPA 1RRBA 1FO4A 4W9IA 3VFKA 2MBBB 1KF6B 3R7RA 1UBQA 4TMAB 2IY1B 4W9KA 4CO7A 3AE6B 3AEAB 3L4PA 3JSVB 4HXDA 3PLUA 3ZIMA 2OEDA 2WXFA 5JHAA 2IYDB 3M95A 4WJQA 1TIFA 4LJPB 2WDQB 1SGHA 3OJ4B 3PRMB 4GDKA 3NVZA 1C79A 1XD3B 5HHDG 1BT0A 4WWNA 5I4DA 3EC8A 1VD2A 4HVBA 2IGHA 1C9FA 1WY8A 1E9MA 3ZQ4A 1I4RA 1ISNA 4F8CB 1C4CA 4A9AA 4DQOC 2FNJB 3R8BA 1L0XB 4ANXA 1UUPA 4KVGB 3U7ZA 2K9XA 3NZUA 2KDBA 1GUAB 4KGSA 1YJ1A 1TS5A 3OAWA 3U7DA 1E5WA 4ARCA 1HE8A 1MVKA 1P0RA 4AOFA 1D3ZA 3GZNB 3RUIB 3PHXB 4ACFA 4RGNA 1VZ6A 3U2SC 3NVYA 3DVNV 5D94A 2O2VB 1P1AA 3PV1A 3AV8A 1WZ3A 1NYRA 2XK5A 3Q69A 3WAOA 3WIMA 2PPHA 4IM0A 5E6PA 1ZKHA 4EUTA 2BS4B 1CQVA 2HJ8A 3BVMA 3OG5A 2XN9C 4BFRA 3L54A 5G5GA 4YL8A 4DHJB 4NJCA 3A4RA 2M56B 4M8MA 5T8IA 1RFAA 2G3QB 4II3B 4BOSC 1E90A 1ZW7A 1VLBA 4ASWC 2ZPNA 2CJNA 2INDC 5FK9C 2L7RA 3ZNZB 4HLEA 1OGWA 3ML9A 2E6XA 1VDVA 1TS2A 2QCZA 1S1QB 4LNIA 4W9CA 1YN5A 3ZRFA 4J6IA 3B9JA 2JU6X 4I6PA 4ZHOA 2FCSA 3B1LX 2AWTA 3AE9B 4RH6A 3KWLA 1NENB 4PYZA 3VRAB 2TSSA 4GSWA 1FXAA 3I9V1 1EF5A 2SAKA 3PZDA 1P98A 2K25A 1SE2A 1EU3A 3PZ8A 4HDOA 1ACCA 3WANA 1I4PA 2JT4B 4URKA 2BB5A 3IG3A 3BK1A 3TJPA 2IGGA 4A55A 1XCTL 3AN1A 5TSSA 3WAPA 4MJSA 2PVGC 1WX9A 2QC8A 3I63C 2WP9B 4B9KA 1TT5B 4IG7B 2GBNA 5MPOA 4HWIB 4W9LA 1ZDXA 4LNKA 1H8CA 3B0AA 3DQVA 3QJZA 4P7IA 1C4PA 2ZJDA 2HDEA 3HK0A 1SEBD 3EHVA 4LLGM 2QDFA 1FNUA 2WU2B 2J0MA 2LXCA 1KRHA 5IAAC 2WGSA 3TEYA 1QQRA 3H9DA 2KACA 2KVZA 1WXQA 2CR5A 4K7WA 1D5XC 3TEZA 2PKOA 3IFWB 4FULA 1V2YA 2QSDA 1TYGB 5E6NA 1ET9A
chains in the Genus database with same CATH topology
4F7ZA 2LVQA 2KK8A 2KFJA 2KZRA 2L0TA 3ENEA 4XZ4A 3JYUA 4IUMB 2Z0DB 3M62B 3IVFA 2JUOA 3KUCB 2LVOA 4BKSD 1WJUA 4FA6A 3NHEB 1ZGUB 4W9JA 3QCAA 2FCQA 1YQBA 3ZDTA 2KMCA 3ZDMC 4IWPA 3QQ8B 2I1JA 1GJZA 1EUVB 2KWCA 2ZCBA 3W1SA 1WE6A 5LXHA 2CS4A 1A5RA 1UZXB 4BKSA 2KN5A 3DCGA 3PLVA 1EO6A 3AULA 2KC1A 2K39A 3Q3JA 4ANUA 1IPGA 4MGIE 1WGHA 2ZVOA 3GOEA 2LI5A 3L16A 2MW5A 1WFYA 2NBWB 4DHZB 2JPHA 4NAWB 1QZEA 2IO0B 2IO3B 4K81A 2MBHA 4RMAA 1E8WA 2GBJA 3VTUA 4JGHB 3KUZA 2KJRA 2R2QA 2BKFA 2PE9A 1VCBA 3MTNB 5CTRC 2DHZA 1KM7A 2R2OA 3KW5B 1UBIA 4DDID 3QAQA 4DXAB 4BBNC 2KD0A 2NPTB 4ZDVA 3V61A 1RAXA 3KVFB 3DBRI 3WAMA 2BWES 4WAAA 1WMHA 4WQOB 4G11A 5DPWA 2KHWB 3H7SA 3UINB 1LXDA 2G45B 2GOWA 3VTWA 4EEWA 4HDQA 4F1SA 4NJ6A 4XX5A 1WR1A 3BINA 5J18A 2LASA 4EOYA 2KTFA 3U8ZA 4GGQA 3KYDD 3R7QA 4FN2A 2IO2B 3L13A 3VTVA 4WJNA 3NOBA 4FJYA 2EKEC 1WYWB 2MSED 4TQ0A 2NBVB 4RM8A 3A33B 3ZTCA 4I6LB 3QK0A 3L17A 4KIKA 1UGMA 2CHXA 3A1QB 2KDFB 2LGDA 3ML8A 3VAWA 5CX3A 2L0FA 4PS7A 4EZLA 4IW0A 4PS8A 4BKTA 4K1RB 2KDIA 2MBOA 1C3TA 3KYCD 2DENB 3TL5A 4FJZA 4KZ0A 4FHJA 3ZNHB 4N9F4 3AU5A 4JQWC 4LCDE 1F9JA 5CHWA 3T9LA 1NDDA 3HHMA 3ZKJC 2M8SA 4MGYE 2V1YA 1PQSA 4HJKA 4A20A 5AZGA 1C1YB 2AEHA 4EFOA 2KDEB 4G0NB 2IY0B 3CF6E 1FXTB 3M3JA 4JLCA 5DPTA 2JY6A 3TIXA 3VUYA 3ZNGC 2KFKA 2KTRA 2NR2A 5J2RA 4BVUC 2V4LA 2C7HA 2BPSA 2K6QA 2WYQA 5LXIB 2HD5B 1TBEA 2DZJA 2OOBB 1E7UA 3CSTA 5KHQA 2PEAA 4AUQC 2L05A 2O6VA 5J17A 4A3PA 1J19A 3PPAA 2K8CA 3TMPB 2RPQA 4A3OA 5G55A 1EF1A 1E7VA 2FIFA 2KKCA 3APCA 3RZWC 2KNBA 2RGFA 3UIPB 4NQLB 1YX6B 1WJNA 2JWZA 3IHPC 1K8RB 3MHSD 5CHVC 1WZ0A 3VDZA 3PRPB 1V5TA 4HPLB 1WXAA 1CMXB 3QHTA 2ZZPB 4JIOU 3X23A 2HE7A 4KSLC 2KXJA 4GDLB 2D10A 2ZNVC 4ZRKA 3V60A 2JZZA 5AZFA 2OJRA 4B95A 2Z59B 4TUUA 4BBNF 4DBGA 4LJOB 3V6EB 5C1ZA 4ZRIA 1UELA 1WF9A 5D6JB 3VVWB 3DDCB 2L3ZA 2L76A 1GNUA 2PJHA 4HCNB 2L00B 4MJSB 3APDA 4PS3A 4HPMB 1E8YA 2CHWA 2LGXA 3OLMD 2D11A 2N4FA 2WDTB 4NQKE 2W9NA 1UH6A 4DHJD 3A9JA 3ZO5B 4B6WA 2IBIB 2NPTA 2Y5BB 3NY5A 3CSFA 2J0JA 2BYVE 4IM3A 4WJPA 4II2B 4M8NA 1AARA 1JRUA 4E3CA 4W9FA 1R4MI 4HCPB 3DVGX 1X1MA 1WIAA 2N9PC 3JW0X 2A4ZA 1WGDA 3DOWA 3UGBB 2N9XA 2KFKB 2NS5A 3HIZA 1LM8B 4X57B 2MP2A 3RD2A 3SD5A 2MQJA 4ICVA 2RR9A 3KUDB 2LRWA 3WALA 2I1KA 1Z2MA 1WXVA 2DYMA 3TCAA 4E74A 2GMIC 2IO1B 3VXWA 4FHKA 2A5UA 2EMSA 3H1UA 1OEYJ 1IP9A 4W9HA 4W9DA 1V49A 4TQ1A 5JZEB 3HM6X 2HTHA 3PS6A 4HK2A 2UYZB 1KJTA 4K7SA 2LD9A 2RD0A 3PVLA 2C60A 1OTRB 2REXA 1WGGA 3QA8A 3RCZA 4GMVA 2LXAA 2K8BA 1KLVA 4K7UA 2N9EB 1NI2A 2Z0EB 5BO4B 2XBBC 4G3XB 5L95C 2XK5B 2GBMA 1WH3A 3O65B 3PT2B 3VUXA 2KOXA 3APFA 3PSEB 4BOZB 2NVUI 4CYEA 4AJWA 4GDLA 5GMVA 4E71A 2C7MB 2FAZA 4TV3A 2KANA 2ZNVB 1GG3A 3QARA 3RULA 3ZTDA 4IC7B 1L2NA 1E8XA 1WMHB 3Q3FA 3UIOB 2XEWA 2NCNA 4OVVA 2N7DA 4ANVA 4NJ7A 1WJ4A 3RZFA 1Q0WB 4RM9A 2YVCA 5DPSA 4TKNA 1RRBA 2J0KA 2LGYA 5L83A 1KOTA 4W9IA 3VFKA 2G4DB 3VUWA 2MBBB 1OEYA 2O6VB 3A9KB 5E6OA 1UBQA 3R7RA 1GC7A 2LJ5A 4JL9A 4W9KA 2IY1B 4CO7A 1XT9B 2O2VA 2M17A 4GU2A 3JSVB 1WE7A 2L8JA 4GOCA 5JHBA 3PRZA 4HXDA 3PLUA 5IA7A 2FUHB 3ZIMA 1J0GA 2MLBA 2KC2A 3B08A 5JHAA 2G4SA 2KTRB 3ZNID 3BY4B 2IYDB 2MWSB 2LWPA 3M95A 5D7GA 3X0WA 3V6CB 1WGRA 4WJQA 1OQYA 4LJPB 1SGHA 3OJ4B 2KMAA 2KLCA 2JRHA 2B3AA 3PRMB 4GDKA 2MBQA 4MDKE 4WWOA 2WX1A 1XD3B 2DAFA 1RLFA 2J7QB 1BT0A 3W1YA 3DBLI 3N3KB 3UQAA 4WWNA 3U30A 2V3SA 3AI5A 3EC8A 1VD2A 4HVBA 3LDZE 1LQBA 4MEMA 4GXBA 1WY8A 5G2NA 5TR5A 2N1VA 4GN1A 1T0YA 1ISNA 2DZKA 4AP4C 2DZIA 5CHFA 2DZMA 2KQSA 4MGKE 4FLHA 3VH4B 4F8CB 2AL3A 2BKRB 2FNJB 1E8ZA 2K1FA 3ZRCA 2BGFA 1Q5WB 3CMMB 2ASQA 2C9WB 4ANXA 4KVGB 2KVRA 3NZUA 2KDBA 1GUAB 3GZNI 1YJ1A 1P9DU 2GBKA 3LJ3A 3OAWA 3U7DA 2JZ3B 4FBJB 5EDSA 1E5WA 2IZVB 1HE8A 1P0RA 4AOFA 2ZPYA 2QHOA 1D3ZA 3RUIB 3S2AA 5HKHA 3AU4A 2BYEA 2D2QA 3PHXB 3R66C 3W1SC 3UF8A 3QC8B 2VRRB 2JRIB 2KX3A 5DCNA 3L08A 1WR6E 2DX5B 3N30A 2BYFA 3DVNV 5AZHA 2FCNA 2ZVNA 3JSVA 5D94A 2O2VB 4IWQA 4NNJB 1P1AA 3PV1A 3SDLC 4DWFA 2MCNB 2C7NB 1WZ3A 4IM2A 5D2MB 5FR6A 2MA9B 2D07B 2FIDA 2XK5A 1WX8A 1LFDA 1WM3A 2CHZA 4WJOA 3PREA 1WXMA 2MBEA 3WAOA 3WIMA 2PPHA 1V86A 4IM0A 2KJ6A 1TTNA 4WWPA 2AYOB 1M94A 2O6VD 5E6PA 3DBHI 1UD7A 1P3QU 1ZKHA 1TGZB 4EUTA 1WRDB 2KLGA 2HJ8A 2LUEA 2DYBA 1H4RA 2KO3A 3R3MA 4KIKB 4ANWA 1XQQA 3ZUNA 2EMTA 4BFRA 2WX0A 4IWOA 2ZEQA 3QIJA 3L54A 2BWFA 2KWVB 3JVZX 4YL8A 4DHJB 4FJVB 5LLIA 1Q1OA 4LDTD 3A4RA 4M8MA 1GC6A 3ALBA 3PHWB 2MP2B 2M4NA 4FADA 1RFAA 2KJHB 2G3QB 2MX2A 3SU8X 4DDGD 3VH3B 4II3B 4BOSC 2GBRA 1E90A 2KX0A 4NPNA 1NBFC 1ZW7A 4ASWC 2ZPNA 3VQIA 2LVPA 4KDLB 2L7RA 3ZNZB 4HLEA 4ICUA 1OGWA 3TBLD 3ML9A 3QWZB 1SE9A 1WXSA 4G50A 2WWZA 4NY0A 1S1QB 3ZLZA 3ZW3A 3PGEA 1WX7A 3VHTC 4W9CA 4W9GA 3ZRFA 3DVGY 2K8HA 4BKGA 3H7PA 4J6IA 4KZCA 4I6PA 2CKHB 2FCSA 3B1LX 2AWTA 4GIVA 2D3GA 5KHOA 3K9PB 3A1QA 3C0RB 2JXXA 1SIFA 3V62A 1WJ6A 3KH0A 4PYZA 4EZKA 1G6JA 1L7YA 4GSWA 1EF5A 3IBEA 4MM3A 3PZDA 1P98A 2K25A 2DAJA 1R4NI 4HDOA 5JH5C 2KQ7A 3N32A 3WANA 5DPRA 2JT4B 2ZCCA 4AJYB 4URKA 4PYUA 2MRPA 2M0XA 3ECIA 2NBUA 3A9JB 1V80A 2RSUA 3ONSA 4AWJA 4KDIC 3IG3A 1WGYA 3TJPA 2UWQA 2YLMA 4DK5A 3SHQA 2N1WA 3L10B 2LZ6A 2M1MA 1Y8RC 3NZSA 1U4AA 3DPDA 3PTFC 1YD8U 3WAPA 4MH0E 4MJSA 3L0WB 1WX9A 4M0WB 4MSMB 3DVNU 4B9KA 2PE6B 4GDKB 1MG8A 1I35A 4IG7B 4DHZE 3D32A 2GBNA 2K6DB 1V9JA 2JVCA 4MSQB 4HWIB 4W9LA 2JF5A 4KSKC 1H8CA 3B0AA 4GB9A 2KWUB 3NS8A 3OJ3A 4I6NB 3DQVA 5AEKB 3QJZA 4P7IA 4EZJA 3EECA 1V5OA 3P2BA 4NAWA 3QX1A 3K9OB 2ZJDA 1V81A 3HK0A 3H7PB 4XC2A 3UQBA 1J8CA 3EFUA 3EHVA 2N7EA 1IYFA 3M63B 2CU1A 1YIWA 3A9KA 2BF8B 4MGZE 1YX5B 4W9EA 4ZRJA 3RT3B 3ZVVA 1S3SG 2J0MA 4KV2A 2LXCA 1WI0A 4CHKA 3WA0A 4LDTB 5IAAC 3DBSA 3HM3A 1Z5SB 5C23A 2FCMA 4EKUA 3H9DA 2C5LC 3AXCA 4MELA 4ZYNA 2CR5A 3MJWA 3A4SC 3H6NA 4K7WA 3RYTA 1V6EA 3I3TB 1WM2A 2AL6A 3IFWB 4FULA 4OVUA 1V2YA 1TZ1A 2DYOA 2LRUA 3T8MA 5E6NA 1I42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7Z A;  2LVQ A;  2KK8 A;  2KFJ A;  2KZR A;  2L0T A;  3ENE A;  4XZ4 A;  3JYU A;  4IUM B;  2Z0D B;  3M62 B;  3IVF A;  2JUO A;  3KUC B;  2LVO A;  4BKS D;  1WJU A;  4FA6 A;  3NHE B;  1ZGU B;  4W9J A;  3QCA A;  2FCQ A;  1YQB A;  3ZDT A;  2KMC A;  3ZDM C;  4IWP A;  3QQ8 B;  2I1J A;  1GJZ A;  1EUV B;  2KWC A;  2ZCB A;  3W1S A;  1WE6 A;  5LXH A;  2CS4 A;  1A5R A;  1UZX B;  4BKS A;  2KN5 A;  3DCG A;  3PLV A;  1EO6 A;  3AUL A;  2KC1 A;  2K39 A;  3Q3J A;  4ANU A;  1IPG A;  4MGI E;  1WGH A;  2ZVO A;  3GOE A;  2LI5 A;  3L16 A;  2MW5 A;  1WFY A;  2NBW B;  4DHZ B;  2JPH A;  4NAW B;  1QZE A;  2IO0 B;  2IO3 B;  4K81 A;  2MBH A;  4RMA A;  1E8W A;  2GBJ A;  3VTU A;  4JGH B;  3KUZ A;  2KJR A;  2R2Q A;  2BKF A;  2PE9 A;  1VCB A;  3MTN B;  5CTR C;  2DHZ A;  1KM7 A;  2R2O A;  3KW5 B;  1UBI A;  4DDI D;  3QAQ A;  4DXA B;  4BBN C;  2KD0 A;  2NPT B;  4ZDV A;  3V61 A;  1RAX A;  3KVF B;  3DBR I;  3WAM A;  2BWE S;  4WAA A;  1WMH A;  4WQO B;  4G11 A;  5DPW A;  2KHW B;  3H7S A;  3UIN B;  1LXD A;  2G45 B;  2GOW A;  3VTW A;  4EEW A;  4HDQ A;  4F1S A;  4NJ6 A;  4XX5 A;  1WR1 A;  3BIN A;  5J18 A;  2LAS A;  4EOY A;  2KTF A;  3U8Z A;  4GGQ A;  3KYD D;  3R7Q A;  4FN2 A;  2IO2 B;  3L13 A;  3VTV A;  4WJN A;  3NOB A;  4FJY A;  2EKE C;  1WYW B;  2MSE D;  4TQ0 A;  2NBV B;  4RM8 A;  3A33 B;  3ZTC A;  4I6L B;  3QK0 A;  3L17 A;  4KIK A;  1UGM A;  2CHX A;  3A1Q B;  2KDF B;  2LGD A;  3ML8 A;  3VAW A;  5CX3 A;  2L0F A;  4PS7 A;  4EZL A;  4IW0 A;  4PS8 A;  4BKT A;  4K1R B;  2KDI A;  2MBO A;  1C3T A;  3KYC D;  2DEN B;  3TL5 A;  4FJZ A;  4KZ0 A;  4FHJ A;  3ZNH B;  4N9F 4;  3AU5 A;  4JQW C;  4LCD E;  1F9J A;  5CHW A;  3T9L A;  1NDD A;  3HHM A;  3ZKJ C;  2M8S A;  4MGY E;  2V1Y A;  1PQS A;  4HJK A;  4A20 A;  5AZG A;  1C1Y B;  2AEH A;  4EFO A;  2KDE B;  4G0N B;  2IY0 B;  3CF6 E;  1FXT B;  3M3J A;  4JLC A;  5DPT A;  2JY6 A;  3TIX A;  3VUY A;  3ZNG C;  2KFK A;  2KTR A;  2NR2 A;  5J2R A;  4BVU C;  2V4L A;  2C7H A;  2BPS A;  2K6Q A;  2WYQ A;  5LXI B;  2HD5 B;  1TBE A;  2DZJ A;  2OOB B;  1E7U A;  3CST A;  5KHQ A;  2PEA A;  4AUQ C;  2L05 A;  2O6V A;  5J17 A;  4A3P A;  1J19 A;  3PPA A;  2K8C A;  3TMP B;  2RPQ A;  4A3O A;  5G55 A;  1EF1 A;  1E7V A;  2FIF A;  2KKC A;  3APC A;  3RZW C;  2KNB A;  2RGF A;  3UIP B;  4NQL B;  1YX6 B;  1WJN A;  2JWZ A;  3IHP C;  1K8R B;  3MHS D;  5CHV C;  1WZ0 A;  3VDZ A;  3PRP B;  1V5T A;  4HPL B;  1WXA A;  1CMX B;  3QHT A;  2ZZP B;  4JIO U;  3X23 A;  2HE7 A;  4KSL C;  2KXJ A;  4GDL B;  2D10 A;  2ZNV C;  4ZRK A;  3V60 A;  2JZZ A;  5AZF A;  2OJR A;  4B95 A;  2Z59 B;  4TUU A;  4BBN F;  4DBG A;  4LJO B;  3V6E B;  5C1Z A;  4ZRI A;  1UEL A;  1WF9 A;  5D6J B;  3VVW B;  3DDC B;  2L3Z A;  2L76 A;  1GNU A;  2PJH A;  4HCN B;  2L00 B;  4MJS B;  3APD A;  4PS3 A;  4HPM B;  1E8Y A;  2CHW A;  2LGX A;  3OLM D;  2D11 A;  2N4F A;  2WDT B;  4NQK E;  2W9N A;  1UH6 A;  4DHJ D;  3A9J A;  3ZO5 B;  4B6W A;  2IBI B;  2NPT A;  2Y5B B;  3NY5 A;  3CSF A;  2J0J A;  2BYV E;  4IM3 A;  4WJP A;  4II2 B;  4M8N A;  1AAR A;  1JRU A;  4E3C A;  4W9F A;  1R4M I;  4HCP B;  3DVG X;  1X1M A;  1WIA A;  2N9P C;  3JW0 X;  2A4Z A;  1WGD A;  3DOW A;  3UGB B;  2N9X A;  2KFK B;  2NS5 A;  3HIZ A;  1LM8 B;  4X57 B;  2MP2 A;  3RD2 A;  3SD5 A;  2MQJ A;  4ICV A;  2RR9 A;  3KUD B;  2LRW A;  3WAL A;  2I1K A;  1Z2M A;  1WXV A;  2DYM A;  3TCA A;  4E74 A;  2GMI C;  2IO1 B;  3VXW A;  4FHK A;  2A5U A;  2EMS A;  3H1U A;  1OEY J;  1IP9 A;  4W9H A;  4W9D A;  1V49 A;  4TQ1 A;  5JZE B;  3HM6 X;  2HTH A;  3PS6 A;  4HK2 A;  2UYZ B;  1KJT A;  4K7S A;  2LD9 A;  2RD0 A;  3PVL A;  2C60 A;  1OTR B;  2REX A;  1WGG A;  3QA8 A;  3RCZ A;  4GMV A;  2LXA A;  2K8B A;  1KLV A;  4K7U A;  2N9E B;  1NI2 A;  2Z0E B;  5BO4 B;  2XBB C;  4G3X B;  5L95 C;  2XK5 B;  2GBM A;  1WH3 A;  3O65 B;  3PT2 B;  3VUX A;  2KOX A;  3APF A;  3PSE B;  4BOZ B;  2NVU I;  4CYE A;  4AJW A;  4GDL A;  5GMV A;  4E71 A;  2C7M B;  2FAZ A;  4TV3 A;  2KAN A;  2ZNV B;  1GG3 A;  3QAR A;  3RUL A;  3ZTD A;  4IC7 B;  1L2N A;  1E8X A;  1WMH B;  3Q3F A;  3UIO B;  2XEW A;  2NCN A;  4OVV A;  2N7D A;  4ANV A;  4NJ7 A;  1WJ4 A;  3RZF A;  1Q0W B;  4RM9 A;  2YVC A;  5DPS A;  4TKN A;  1RRB A;  2J0K A;  2LGY A;  5L83 A;  1KOT A;  4W9I A;  3VFK A;  2G4D B;  3VUW A;  2MBB B;  1OEY A;  2O6V B;  3A9K B;  5E6O A;  1UBQ A;  3R7R A;  1GC7 A;  2LJ5 A;  4JL9 A;  4W9K A;  2IY1 B;  4CO7 A;  1XT9 B;  2O2V A;  2M17 A;  4GU2 A;  3JSV B;  1WE7 A;  2L8J A;  4GOC A;  5JHB A;  3PRZ A;  4HXD A;  3PLU A;  5IA7 A;  2FUH B;  3ZIM A;  1J0G A;  2MLB A;  2KC2 A;  3B08 A;  5JHA A;  2G4S A;  2KTR B;  3ZNI D;  3BY4 B;  2IYD B;  2MWS B;  2LWP A;  3M95 A;  5D7G A;  3X0W A;  3V6C B;  1WGR A;  4WJQ A;  1OQY A;  4LJP B;  1SGH A;  3OJ4 B;  2KMA A;  2KLC A;  2JRH A;  2B3A A;  3PRM B;  4GDK A;  2MBQ A;  4MDK E;  4WWO A;  2WX1 A;  1XD3 B;  2DAF A;  1RLF A;  2J7Q B;  1BT0 A;  3W1Y A;  3DBL I;  3N3K B;  3UQA A;  4WWN A;  3U30 A;  2V3S A;  3AI5 A;  3EC8 A;  1VD2 A;  4HVB A;  3LDZ E;  1LQB A;  4MEM A;  4GXB A;  1WY8 A;  5G2N A;  5TR5 A;  2N1V A;  4GN1 A;  1T0Y A;  1ISN A;  2DZK A;  4AP4 C;  2DZI A;  5CHF A;  2DZM A;  2KQS A;  4MGK E;  4FLH A;  3VH4 B;  4F8C B;  2AL3 A;  2BKR B;  2FNJ B;  1E8Z A;  2K1F A;  3ZRC A;  2BGF A;  1Q5W B;  3CMM B;  2ASQ A;  2C9W B;  4ANX A;  4KVG B;  2KVR A;  3NZU A;  2KDB A;  1GUA B;  3GZN I;  1YJ1 A;  1P9D U;  2GBK A;  3LJ3 A;  3OAW A;  3U7D A;  2JZ3 B;  4FBJ B;  5EDS A;  1E5W A;  2IZV B;  1HE8 A;  1P0R A;  4AOF A;  2ZPY A;  2QHO A;  1D3Z A;  3RUI B;  3S2A A;  5HKH A;  3AU4 A;  2BYE A;  2D2Q A;  3PHX B;  3R66 C;  3W1S C;  3UF8 A;  3QC8 B;  2VRR B;  2JRI B;  2KX3 A;  5DCN A;  3L08 A;  1WR6 E;  2DX5 B;  3N30 A;  2BYF A;  3DVN V;  5AZH A;  2FCN A;  2ZVN A;  3JSV A;  5D94 A;  2O2V B;  4IWQ A;  4NNJ B;  1P1A A;  3PV1 A;  3SDL C;  4DWF A;  2MCN B;  2C7N B;  1WZ3 A;  4IM2 A;  5D2M B;  5FR6 A;  2MA9 B;  2D07 B;  2FID A;  2XK5 A;  1WX8 A;  1LFD A;  1WM3 A;  2CHZ A;  4WJO A;  3PRE A;  1WXM A;  2MBE A;  3WAO A;  3WIM A;  2PPH A;  1V86 A;  4IM0 A;  2KJ6 A;  1TTN A;  4WWP A;  2AYO B;  1M94 A;  2O6V D;  5E6P A;  3DBH I;  1UD7 A;  1P3Q U;  1ZKH A;  1TGZ B;  4EUT A;  1WRD B;  2KLG A;  2HJ8 A;  2LUE A;  2DYB A;  1H4R A;  2KO3 A;  3R3M A;  4KIK B;  4ANW A;  1XQQ A;  3ZUN A;  2EMT A;  4BFR A;  2WX0 A;  4IWO A;  2ZEQ A;  3QIJ A;  3L54 A;  2BWF A;  2KWV B;  3JVZ X;  4YL8 A;  4DHJ B;  4FJV B;  5LLI A;  1Q1O A;  4LDT D;  3A4R A;  4M8M A;  1GC6 A;  3ALB A;  3PHW B;  2MP2 B;  2M4N A;  4FAD A;  1RFA A;  2KJH B;  2G3Q B;  2MX2 A;  3SU8 X;  4DDG D;  3VH3 B;  4II3 B;  4BOS C;  2GBR A;  1E90 A;  2KX0 A;  4NPN A;  1NBF C;  1ZW7 A;  4ASW C;  2ZPN A;  3VQI A;  2LVP A;  4KDL B;  2L7R A;  3ZNZ B;  4HLE A;  4ICU A;  1OGW A;  3TBL D;  3ML9 A;  3QWZ B;  1SE9 A;  1WXS A;  4G50 A;  2WWZ A;  4NY0 A;  1S1Q B;  3ZLZ A;  3ZW3 A;  3PGE A;  1WX7 A;  3VHT C;  4W9C A;  4W9G A;  3ZRF A;  3DVG Y;  2K8H A;  4BKG A;  3H7P A;  4J6I A;  4KZC A;  4I6P A;  2CKH B;  2FCS A;  3B1L X;  2AWT A;  4GIV A;  2D3G A;  5KHO A;  3K9P B;  3A1Q A;  3C0R B;  2JXX A;  1SIF A;  3V62 A;  1WJ6 A;  3KH0 A;  4PYZ A;  4EZK A;  1G6J A;  1L7Y A;  4GSW A;  1EF5 A;  3IBE A;  4MM3 A;  3PZD A;  1P98 A;  2K25 A;  2DAJ A;  1R4N I;  4HDO A;  5JH5 C;  2KQ7 A;  3N32 A;  3WAN A;  5DPR A;  2JT4 B;  2ZCC A;  4AJY B;  4URK A;  4PYU A;  2MRP A;  2M0X A;  3ECI A;  2NBU A;  3A9J B;  1V80 A;  2RSU A;  3ONS A;  4AWJ A;  4KDI C;  3IG3 A;  1WGY A;  3TJP A;  2UWQ A;  2YLM A;  4DK5 A;  3SHQ A;  2N1W A;  3L10 B;  2LZ6 A;  2M1M A;  1Y8R C;  3NZS A;  1U4A A;  3DPD A;  3PTF C;  1YD8 U;  3WAP A;  4MH0 E;  4MJS A;  3L0W B;  1WX9 A;  4M0W B;  4MSM B;  3DVN U;  4B9K A;  2PE6 B;  4GDK B;  1MG8 A;  1I35 A;  4IG7 B;  4DHZ E;  3D32 A;  2GBN A;  2K6D B;  1V9J A;  2JVC A;  4MSQ B;  4HWI B;  4W9L A;  2JF5 A;  4KSK C;  1H8C A;  3B0A A;  4GB9 A;  2KWU B;  3NS8 A;  3OJ3 A;  4I6N B;  3DQV A;  5AEK B;  3QJZ A;  4P7I A;  4EZJ A;  3EEC A;  1V5O A;  3P2B A;  4NAW A;  3QX1 A;  3K9O B;  2ZJD A;  1V81 A;  3HK0 A;  3H7P B;  4XC2 A;  3UQB A;  1J8C A;  3EFU A;  3EHV A;  2N7E A;  1IYF A;  3M63 B;  2CU1 A;  1YIW A;  3A9K A;  2BF8 B;  4MGZ E;  1YX5 B;  4W9E A;  4ZRJ A;  3RT3 B;  3ZVV A;  1S3S G;  2J0M A;  4KV2 A;  2LXC A;  1WI0 A;  4CHK A;  3WA0 A;  4LDT B;  5IAA C;  3DBS A;  3HM3 A;  1Z5S B;  5C23 A;  2FCM A;  4EKU A;  3H9D A;  2C5L C;  3AXC A;  4MEL A;  4ZYN A;  2CR5 A;  3MJW A;  3A4S C;  3H6N A;  4K7W A;  3RYT A;  1V6E A;  3I3T B;  1WM2 A;  2AL6 A;  3IFW B;  4FUL A;  4OVU A;  1V2Y A;  1TZ1 A;  2DYO A;  2LRU A;  3T8M A;  5E6N A;  1I42 A; 
#chains in the Genus database with same CATH topology
 4F7Z A;  3TEW A;  1VZ8 A;  2KK8 A;  2L0T A;  3AB5 A;  2JUO A;  1WJU A;  3NHE B;  1T0R C;  1ZGU B;  3QCA A;  2FCQ A;  2W55 A;  4IWP A;  2QIE B;  4C56 C;  1WE6 A;  4BKS A;  3DCG A;  4ANU A;  3AUL A;  4MM3 B;  3IT4 B;  5E6J A;  1JQ4 A;  4NAM A;  2NBW B;  1QZE A;  2G9H D;  3KLS X;  2MBH A;  4C7Z A;  2JXT A;  3ZXV A;  1ZOY B;  2DHZ A;  1DYQ A;  2ACZ B;  1KM7 A;  1UNS A;  2R2O A;  4BBN C;  4ZDV A;  4OW0 A;  3V61 A;  3DBR I;  3WAM A;  4HJG E;  2KHW B;  2GOW A;  3VTW A;  4EEW A;  4NJ6 A;  5J18 A;  2WDR B;  2LAS A;  2ONQ A;  4EOY A;  3U8Z A;  2IO2 B;  4WJN A;  3NOB A;  2QMT A;  4RM8 A;  3QK0 A;  1UGM A;  2Z8L A;  2KDF B;  2WXQ A;  2L0F A;  4IW0 A;  4PS8 A;  1QKZ A;  2LMC A;  4IKG A;  3AU5 A;  4LCD E;  3T9L A;  1NDD A;  2M8S A;  1PQS A;  4KGT A;  4HJK A;  2AEH A;  5DPT A;  4JLC A;  2JY6 A;  4HKQ A;  3ZNG C;  2KFK A;  2KTR A;  2NR2 A;  5J2R A;  2N7J A;  3AEC B;  4KX6 B;  3J9C A;  3Q8C A;  2BPS A;  2DZJ A;  2OOB B;  2PW9 A;  2L05 A;  1QOF A;  1SJH D;  3MC9 A;  1J19 A;  2K8C A;  1RM6 C;  3FKY A;  3RZW C;  1V1O A;  2KNB A;  4HEA 1;  3VDZ A;  1V5T A;  2WHI A;  1CMX B;  2HE7 A;  2ZNV C;  4TUU A;  4BBN F;  4DBG A;  2J53 A;  1DOI A;  4ZRI A;  4HKZ E;  3DDC B;  2L3Z A;  1N63 A;  1FNW A;  2ZW0 A;  2RDH A;  4AQ7 A;  1V8C A;  3ZJT A;  4DHJ D;  1A70 A;  2PIA A;  2J0J A;  2BYT A;  1HEZ E;  4IM3 A;  4WJP A;  4E3C A;  2PVO D;  4HCP B;  1C4A A;  2OHF A;  4XWW A;  1E10 A;  4D2K A;  1WIA A;  3NS1 A;  1UWM A;  4X57 B;  3SD5 A;  4ICV A;  2RR9 A;  2LRW A;  3WAL A;  2I1K A;  1Z2M A;  1WXV A;  3TCA A;  2IO1 B;  2A5U A;  4WIP A;  4W9D A;  3PS6 A;  1YQ3 B;  2ZW1 A;  1OTR B;  1TKY A;  1YMH E;  2LXA A;  2NTS A;  2ICI A;  4K7U A;  1JCK B;  2XBB C;  4G3X B;  3HVZ A;  5L95 C;  1Q10 A;  2WXI A;  2GBM A;  2XK5 B;  4JPS A;  1WH3 A;  3EUB 2;  3PT2 B;  3APF A;  1N5X A;  1B1Z A;  2FAZ A;  3AMZ A;  4TV3 A;  2RPV A;  1GG3 A;  1QF6 A;  1L2N A;  3Q3F A;  2XEW A;  4OVV A;  1P7F A;  2N7D A;  3ZXR A;  4ANV A;  3IT6 B;  3RZF A;  4RM9 A;  2YVC A;  4TKN A;  1UWX A;  2GRI A;  1BXT A;  3AEB B;  1E0Z A;  1TY0 A;  1JWS D;  1F2R C;  2LJ5 A;  4C80 A;  2M17 A;  3Q8B A;  1WE7 A;  2D5G A;  4TSS A;  2KTR B;  3BY4 B;  5D7G A;  3BVG A;  3FIL B;  3V6C B;  1WGR A;  2JQR B;  2KN4 A;  2KMA A;  2WQY B;  2MBQ A;  4MDK E;  4WWO A;  4C7Y A;  2DAF A;  2J7Q B;  3DBL I;  3N3K B;  1F1H A;  3UQA A;  2V3S A;  3AI5 A;  3LDZ E;  4MEM A;  2LHD A;  2G1E A;  5G2N A;  2DZK A;  4AP4 C;  2NMQ A;  3NJT A;  4FLH A;  2BKR B;  2K1F A;  2WXR A;  2VZK B;  3CMM B;  3AE7 B;  3P4P B;  1EWY C;  1D6E C;  1PGX A;  4YT0 B;  3KQ4 A;  3LJ3 A;  3EGR A;  1XF5 L;  2WXM A;  3N9Y C;  5IO9 A;  5EDS A;  2IZV B;  2ZPY A;  2QHO A;  4NZL B;  1QOG A;  3AU4 A;  2D2Q A;  4CQN A;  3UF8 A;  4US8 A;  2JRI B;  3L08 A;  4C00 A;  5AZH A;  1DOY A;  3JSV A;  4IWQ A;  4NNJ B;  1C77 A;  2NTT A;  5FR6 A;  2MA9 B;  1L6U A;  1D4B A;  1WM3 A;  3PRE A;  4WAF A;  1R4M B;  2MBE A;  1V86 A;  5IP4 D;  1F0Z A;  4WWP A;  3ABV B;  1TZO A;  1P3Q U;  3C8Y A;  2JZP A;  3R3M A;  1H4R A;  4KIK B;  1PDX A;  3ZUN A;  1TS4 A;  2EMT A;  2WX0 A;  4IWO A;  2OJW A;  4YXD B;  4FJV B;  4O1N A;  4LDT D;  2J42 A;  2MX2 A;  1HTQ A;  1MHH E;  1FCC C;  3GP7 A;  4S17 A;  3E9S A;  1SIJ A;  1FMA D;  2QJL A;  3MP9 A;  3CWI A;  3DHG C;  3O13 A;  2ON8 A;  4RF1 A;  2M19 A;  3HVD A;  1FIQ A;  1EWC A;  3TBL D;  3QWZ B;  4LNF A;  2WWZ A;  3ZLZ A;  4WQM A;  2V4I B;  1I4G A;  3BWU D;  1NI3 A;  3DVG Y;  2K8H A;  2B76 B;  2IDY A;  4KKJ A;  2D3G A;  3A1Q A;  1E7P B;  1B9R A;  3MJ5 A;  1WJ6 A;  3KH0 A;  4EZK A;  4L23 A;  5LNK 1;  3RNB C;  1R4N I;  5DPR A;  3T3O A;  1XLP A;  1V80 A;  2RSU A;  3GE8 C;  2WLB A;  2YLM A;  4DK5 A;  1K53 A;  2WXN A;  3AE2 B;  1Y8R C;  3NZS A;  4MSM B;  3DVN U;  4GDK B;  4DHZ E;  3D32 A;  3RFZ B;  2YEP B;  3IXS A;  2JF5 A;  2DBY A;  1R7S A;  2KWU B;  3OJ3 A;  5GXG B;  3P1M A;  2GI9 A;  1V1P B;  2N7E A;  1IYF A;  2IPK D;  1K50 A;  3CIR B;  2INN E;  1YIW A;  3A9K A;  2BF8 B;  4MGZ E;  1YX5 B;  3UI3 A;  4ZRJ A;  4XE0 A;  4KV2 A;  4OZA A;  3WA0 A;  4LDT B;  3DBS A;  3HM3 A;  5C23 A;  4ZYN A;  3MJW A;  3AEF B;  1JRO A;  1V6E A;  2AL6 A;  1TS3 A;  1TZ1 A;  2DYO A;  3N1Y C;  2PMV A;  2INP E;  3JYU A;  2Z0D B;  2DNF A;  2N0S B;  2WXL A;  3KUC B;  2LVO A;  3T3N A;  4W9J A;  2KMC A;  3ZDM C;  1AYF A;  1GJZ A;  4JX1 C;  3P4S B;  1J7A A;  4ITK A;  1UZX B;  2AQ1 B;  3PLV A;  2XNA C;  2KC1 A;  3Q3J A;  1NVI D;  1WFY A;  2UU7 A;  3P42 A;  4NAW B;  2YEP F;  2IO0 B;  4ZOH C;  3SFE B;  4K3B A;  1YNT E;  3KUZ A;  2BKF A;  3GE3 C;  2AQ2 B;  3NRZ A;  2MEK A;  2JYE A;  4DDI D;  4YSY B;  2BWE S;  4WAA A;  3W5V B;  2M0A A;  5DPW A;  3H7S A;  4HDQ A;  3BIN A;  2KTF A;  4FN2 A;  3L13 A;  4JE3 B;  2EKE C;  1XEE A;  3NVW A;  2LGD A;  3P4Q B;  1L4Z B;  2KDI A;  2MBO A;  3HUI A;  3TL5 A;  4FJZ A;  3DBH B;  4FHJ A;  1KLG D;  3ZNH B;  1FRD A;  4C4V A;  1F9J A;  1T0Q C;  2LFI A;  2V1Y A;  2KMM A;  5AZG A;  1C1Y B;  2KDE B;  2W54 A;  2IY0 B;  3CF6 E;  1KTK A;  3SEB A;  2CU3 A;  1I4X A;  1IBX B;  4Q2J A;  4LK0 M;  4RGO S;  1K51 A;  3P4R B;  3Q8A A;  3CST A;  1ET6 A;  5KHQ A;  2PEA A;  4AUQ C;  3E56 A;  5JXV A;  2W3R A;  4A3P A;  2RPQ A;  2HJ1 A;  5G55 A;  2FIF A;  3APC A;  2FBW B;  2RGF A;  1T5X D;  1WGK A;  4NQL B;  1YX6 B;  5CHV C;  4HPL B;  2R61 A;  2PTL A;  3LYY A;  2D10 A;  4ZRK A;  4WUR A;  4N59 A;  4B95 A;  5D6J B;  4HCN B;  3PZ7 A;  1SJE D;  1FNV A;  1N61 A;  3EA6 A;  3OLM D;  2LHE A;  4GLS C;  5EE9 A;  4MT5 A;  3ZO5 B;  1KFY B;  3NY5 A;  3CSF A;  2BYV E;  1MJD A;  4XWT A;  1JRU A;  3BZD B;  3Q3N C;  1OQR A;  3JW0 X;  1YQ4 B;  1IGC A;  2NS5 A;  3DWM A;  1LM8 B;  3RD2 A;  2MQJ A;  3KUD B;  1T3Q A;  5EE3 A;  3RPF C;  2DYM A;  3VXW A;  1V1P A;  3AEG B;  4W9H A;  1V49 A;  2FE8 A;  1ZP0 B;  1KJT A;  2RD0 A;  2C60 A;  1KLV A;  2K8B A;  1KLU D;  2LGS A;  2N9E B;  5BO4 B;  3VRB B;  2I2Y A;  3VUX A;  4AJW A;  5GMV A;  4E71 A;  1JWA D;  4IC7 B;  1E8X A;  3UIO B;  1N62 A;  1D5M C;  2NCN A;  4J3O D;  2J0K A;  2LGY A;  5L83 A;  1KOT A;  4P1B C;  2BW2 A;  2G4D B;  3VUW A;  1JWU D;  4RFB A;  1XT9 B;  2O2V A;  4KGR A;  3TUO A;  2V3P A;  4GU2 A;  3PRZ A;  1LGR A;  2FUH B;  3V3X A;  3B08 A;  5H8Y E;  2G4S A;  1IBX A;  3ZNI D;  4M01 A;  4PT5 A;  2LWP A;  3X0W A;  3NZ3 A;  1YN4 A;  4N6E B;  1T6B X;  4RCO A;  2WX1 A;  2K5P A;  3RNG C;  1RLF A;  1SXT A;  1FEH A;  1GAQ B;  5TR5 A;  2N1V A;  4GN1 A;  1T0Y A;  2DZI A;  1QT9 A;  3Q3O C;  5CHF A;  4MGK E;  2AL3 A;  4RGM A;  2D3C A;  3MFG A;  5EE0 A;  3NUH B;  3ZRC A;  2BGF A;  2MH7 A;  1Q5W B;  2ASQ A;  2C9W B;  5D3I B;  1VZ7 A;  2KVR A;  3GZN I;  5IKC M;  3BII D;  1P9D U;  2GBK A;  3Q8F A;  4FBJ B;  1FFU A;  3I57 A;  2Y5P A;  3VR8 B;  5HKH A;  3R66 C;  4ARI A;  2VRR B;  4A6Q A;  2KX3 A;  1F52 A;  1WR6 E;  3N30 A;  1TKE A;  2ZVN A;  4ZYS A;  2BVC A;  1PFD A;  1L0Y B;  2MCN B;  1SF0 A;  5D2M B;  4IM2 A;  2FID A;  5HG2 A;  2MJD A;  2CHZ A;  4WJO A;  1QOB A;  1MI0 A;  2AYO B;  2IJ0 A;  2O6V D;  3AE4 B;  1WRD B;  2KLG A;  2LUE A;  2DYB A;  2E3T A;  4ANW A;  1N60 A;  2WXJ A;  2BWF A;  3JVZ X;  1Q1O A;  3DHI C;  1GC6 A;  4A8X C;  2MP2 B;  2M4N A;  2WS3 B;  4FAD A;  1WRI A;  5BMI A;  3SU8 X;  3TSS A;  1RYJ A;  1GOZ A;  1LO5 D;  4H2A A;  4NPN A;  3VQI A;  2LVP A;  4KDL B;  1P7E A;  3ZYY X;  4DXF A;  4XGA B;  4G50 A;  4NY0 A;  3PGE A;  1WX7 A;  3RNE C;  2BS3 B;  2KT7 A;  4W9G A;  3MHZ A;  4KZC A;  1UGJ A;  1STE A;  2CKH B;  2K3U A;  4BAX A;  4GIV A;  1HTO A;  3C0R B;  2JXX A;  1SIF A;  3V62 A;  5BYR A;  3ZGZ A;  1WWT A;  1GPX A;  4RGT A;  1K52 A;  1OQQ A;  2KQ7 A;  3N32 A;  2MRP A;  2M0X A;  2NBU A;  3ONS A;  4KDI C;  1WGY A;  1L0V B;  2N1W A;  3DPD A;  3PTF C;  1E6E B;  2WU5 B;  1YD8 U;  2RDB C;  4DXG A;  4M0W B;  3N1Z C;  1VR9 A;  3FAH A;  5C2T B;  2N9K A;  2PE6 B;  1F2R I;  1I35 A;  2K6D B;  1V9J A;  2JVC A;  4MSQ B;  2RMM A;  4I6N B;  5AEK B;  1WYG A;  3EEC A;  1V5O A;  4NAW A;  1L5P A;  3QX1 A;  1J8C A;  3EFU A;  2GB1 A;  1HZ6 A;  1KH0 A;  2VH2 A;  3RT3 B;  4FXC A;  4AS1 A;  5IN7 A;  4R3D A;  1XLO A;  4P6V F;  4CHK A;  3Q2A C;  3B2G A;  3MC0 B;  1R4N B;  2KAJ A;  2D3B A;  2C5L C;  3AXC A;  3A4S C;  3H6N A;  3RYT A;  3I3T B;  1WM2 A;  4OVU A;  2L1A A;  2LRU A;  2LGI A;  3T8M A;  1I42 A;  2WXP A;  2KFJ A;  2KZR A;  1HQR D;  4IUM B;  3M62 B;  4IDI A;  3IVF A;  3N20 C;  4B0E A;  4BKS D;  4L2Y A;  4FA6 A;  1SE4 A;  1OFF A;  4OZC A;  3ETR A;  1MHX A;  4M02 A;  2KWC A;  1SBB B;  2ZCB A;  3RNC C;  2GLS A;  1NEK B;  3W1S A;  1A5R A;  1ZXI A;  2CS4 A;  3WCQ A;  1EO6 A;  3RN9 C;  2K39 A;  2VZK D;  1IPG A;  1MPE A;  2ZVO A;  3SFD B;  3L16 A;  2LI5 A;  2MW5 A;  4DHZ B;  2JPH A;  3AED B;  3W9C B;  1SSN A;  4S0R A;  2KJR A;  2R2Q A;  3MTN B;  2VH1 A;  4OVZ A;  2KD0 A;  3KVF B;  4MAC A;  5HFY A;  1WMH A;  4WQO B;  1FCL A;  4G11 A;  3UIN B;  1LXD A;  4XX5 A;  2LUM A;  5C3J B;  4GGQ A;  3KYD D;  3AE8 B;  3VTV A;  1DGJ A;  4FJY A;  2MSE D;  4C4V B;  3A33 B;  3ZTC A;  4KIK A;  2CHX A;  4PS7 A;  4EZL A;  4BKT A;  4LNO A;  4KZ0 A;  3P63 A;  4LNN A;  3OWE B;  4N9F 4;  4JQW C;  1SE3 A;  1XLN A;  3ZKJ C;  4MGY E;  3Q3M C;  3VR9 B;  3M3J A;  2V4L A;  2C7H A;  2K6Q A;  2WYQ A;  3URY A;  2HD5 B;  1TBE A;  1ZDV A;  2O6V A;  3TMP B;  2W3S A;  1AW7 A;  1EF1 A;  2KKC A;  2WXK A;  4US9 A;  1WJN A;  2JWZ A;  1WZ0 A;  5D3D A;  3QHT A;  4JIO U;  3X23 A;  4KSL C;  2KXJ A;  3V60 A;  2JZZ A;  5AZF A;  2OJR A;  2Z59 B;  3V6E B;  4K3C A;  5C1Z A;  2I38 A;  1WF9 A;  5FR3 A;  2PJH A;  4MJS B;  4PS3 A;  4HPM B;  1E8Y A;  2L83 A;  4JWU C;  2LGX A;  5BMG A;  3I5J C;  1ZXH A;  1JAL A;  2N4F A;  4YSX B;  3RMK C;  2W9N A;  5HI1 A;  2LEK A;  3DBR B;  1ROE A;  4B6W A;  2NPT A;  2Y5B B;  1GB4 A;  3AM9 A;  3GS2 A;  4II2 B;  4M8N A;  1EM7 A;  1R4M I;  3DVG X;  4BZA A;  1X1M A;  2N9P C;  3BVZ A;  2A4Z A;  1WGD A;  3TEX A;  3UGB B;  1HZ5 A;  2KFK B;  3HIZ A;  4E74 A;  2BBC A;  2N9L A;  3H1U A;  1IP9 A;  4OHJ A;  1UF0 A;  4TQ1 A;  1AN8 A;  4HK2 A;  1I4H A;  1JWM D;  4XYC A;  3RCZ A;  1MG4 A;  2Q5W D;  5BMH A;  1NI2 A;  1ENF A;  1ESF A;  3O65 B;  2V0G A;  3PSE B;  4BOZ B;  2NVU I;  2C7M B;  2Y3A A;  2KAN A;  3QAR A;  2BQQ A;  1WMH B;  4NJ7 A;  1XLQ A;  2KQ4 X;  3C19 A;  1OEY A;  2O6V B;  3A9K B;  5E6O A;  1GC7 A;  4JL9 A;  1PYW D;  3R2T A;  2WXH A;  1JML A;  2L8J A;  4HRS A;  1YN3 A;  4GOC A;  5JHB A;  1J0G A;  1GB1 A;  5IA7 A;  2MLB A;  1FD6 A;  3NVV A;  2KC2 A;  1FRR A;  1T0S C;  2W82 A;  4N58 A;  3HRD D;  1QIL A;  2MWS B;  2HTM E;  1OQY A;  3MC8 A;  2KLC A;  2JRH A;  2B3A A;  3NG0 A;  3W1Y A;  1BML C;  4HPP A;  1V97 A;  4YTP B;  3U30 A;  1LQB A;  4GXB A;  3AH7 A;  2X8X X;  2DZM A;  2KQS A;  3VH4 B;  1XO3 A;  1E8Z A;  3FIL A;  1VJK A;  5BYQ A;  2JX5 A;  1C78 A;  2V3N A;  4YWG G;  2JZ3 B;  1FFV A;  2DWQ A;  4IOI E;  1TKG A;  5EE1 A;  3S2A A;  1QLB B;  2BYE A;  4WH4 A;  3W1S C;  3QC8 B;  2D3A A;  5DCN A;  2DX5 B;  2BYF A;  1NYQ A;  2FCN A;  3SDL C;  4YSZ B;  4DWF A;  2C7N B;  2D07 B;  1F77 A;  1WX8 A;  1LFD A;  3AEE B;  3BK2 A;  1WXM A;  3EFC A;  1CK1 A;  2KJ6 A;  1TTN A;  1YJJ A;  1M94 A;  3DBH I;  1UD7 A;  3R2I A;  4HRO A;  1TGZ B;  4XDC A;  2BT6 A;  2KO3 A;  1XQQ A;  2ZEQ A;  3QIJ A;  2KWV B;  1C76 A;  2AX5 A;  5LLI A;  3U52 E;  3ALB A;  3PHW B;  4QAY A;  2KJH B;  1QOA A;  2CJO A;  2FUG 1;  2MJ3 A;  4DDG D;  1JRP A;  3VH3 B;  1RWS A;  2LJI A;  3IAM 1;  2GBR A;  4L1B A;  2KX0 A;  3RNA C;  1NBF C;  2X38 A;  3BYY B;  4REZ A;  4ICU A;  2L32 A;  4XDD A;  1SE9 A;  1WXS A;  5BYS A;  3ZW3 A;  3VHT C;  2KDM A;  4ZHP A;  2BB6 A;  4BKG A;  3H7P A;  5KHO A;  3K9P B;  5G5H A;  3IAS 1;  1G6J A;  1L7Y A;  4MH8 A;  4MM3 A;  3DHH C;  3IBE A;  2DAJ A;  5JH5 C;  4M0W A;  2ZCC A;  4AJY B;  2DLB A;  4PYU A;  3ECI A;  1TY2 A;  4UDU C;  3A9J B;  4AWJ A;  2EKI A;  4USA A;  2UWQ A;  3SHQ A;  3L10 B;  2LZ6 A;  5H92 C;  2M1M A;  2QEJ C;  1U4A A;  4WWM A;  3RI7 C;  4MH0 E;  3L0W B;  1AWD A;  1TJE A;  1RFK A;  1IUE A;  1WSP A;  1MG8 A;  2IGD A;  3ZJV A;  4KSK C;  3DWG C;  4B0M A;  1CZP A;  3NS8 A;  4GB9 A;  1XCQ L;  4EZJ A;  1J7B A;  3P2B A;  1ZE3 D;  4KKI A;  3K9O B;  1V81 A;  3H7P B;  4XC2 A;  3UQB A;  4EE2 A;  1PUT A;  3M63 B;  2CU1 A;  4OZB A;  1YOV B;  4W9E A;  2WXO A;  3ZVV A;  1ZPS A;  1S3S G;  1WI0 A;  4P1C C;  1XXG A;  1Z5S B;  2FCM A;  4EKU A;  3W5U B;  4MEL A;  1FXI A;  1M4V A;  1DOX A;  3AE1 B;  3ZJU A;  2LVQ A;  5FKA C;  2Y5C A;  3ENE A;  4XZ4 A;  2JWU A;  1YQB A;  4P16 A;  3ZDT A;  3QQ8 B;  2I1J A;  1EUV B;  3B2F A;  1PGB A;  5LXH A;  2KN5 A;  3H8H A;  2KYW A;  5IOI A;  4MGI E;  3FC4 A;  1WGH A;  2H89 B;  2AQ3 B;  3GOE A;  1I7H A;  2IO3 B;  4K81 A;  4A90 A;  4RMA A;  1E8W A;  2GBJ A;  3VTU A;  4JGH B;  3BYT B;  2PE9 A;  1VCB A;  5CTR C;  1N5W A;  2PLP A;  3N1X C;  3Q14 C;  3KW5 B;  5AUK A;  2JYT A;  1UBI A;  3QAQ A;  4DXA B;  2NPT B;  1RAX A;  2J52 A;  2G45 B;  4F1S A;  1WR1 A;  4ZRQ A;  2KWD A;  2MHJ A;  2WDV B;  3V05 A;  3R7Q A;  3U4E G;  1WYW B;  4TQ0 A;  2NBV B;  3W2D A;  4I6L B;  3L17 A;  3VAW A;  3A1Q B;  3ML8 A;  5CX3 A;  4RNA A;  2L52 A;  4K1R B;  1C3T A;  3KYC D;  2WXG A;  2DEN B;  1HA5 A;  2JSV X;  5CHW A;  2INC C;  3HHM A;  3SR6 A;  4A20 A;  1CJE A;  4EFO A;  4G0N B;  1FXT B;  3TIX A;  3VUY A;  1D5Z C;  4JWS C;  1N6Z A;  1JWB D;  4BVU C;  4RF0 A;  5LXI B;  1L6V A;  1YJI A;  1E7U A;  4LTU A;  1SB3 C;  5J17 A;  3Q8E A;  3PPA A;  4A3O A;  1E7V A;  3DBL B;  3UIP B;  3IHP C;  1K8R B;  3MHS D;  3PRP B;  3PO0 A;  2WNM A;  1WXA A;  2ZZP B;  1FPY A;  4GDL B;  2BTE A;  3AE3 B;  4LJO B;  1UEL A;  3VVW B;  2L76 A;  1GNU A;  2H88 B;  2L00 B;  3APD A;  2CHW A;  4M00 A;  1ZUD 2;  3AE5 B;  2D11 A;  2QIL A;  1FM0 D;  3KWV A;  2RDG A;  2WDT B;  4NQK E;  1UH6 A;  3A9J A;  2IBI B;  1PGA A;  1AAR A;  1Y56 A;  3GB1 A;  4W9F A;  4YTN B;  3RNF C;  2MJE A;  3DOW A;  4PK1 A;  2N9X A;  1J7C A;  4YTM B;  1L4D B;  1EU4 A;  2MP2 A;  2SEB D;  2GMI C;  1IGD A;  2K22 A;  2EMS A;  4FHK A;  1OEY J;  1HXY D;  5AUI A;  2V9H A;  5JZE B;  3HM6 X;  2HTH A;  2UYZ B;  2K0P A;  4K7S A;  2LD9 A;  3PVL A;  2REX A;  1WGG A;  3QA8 A;  2J4X A;  4GMV A;  3LXF A;  3Q6B A;  1MFW A;  1VRA B;  2EEL A;  2Z0E B;  2BS2 B;  1I4Q A;  2KOX A;  4CYE A;  4GDL A;  1BUI C;  2ZNV B;  1JW9 D;  3LB8 C;  3RUL A;  3ZTD A;  1WJ4 A;  1Q0W B;  5DPS A;  4ZRP A;  1RRB A;  1FO4 A;  4W9I A;  3VFK A;  2MBB B;  1KF6 B;  3R7R A;  1UBQ A;  4TMA B;  2IY1 B;  4W9K A;  4CO7 A;  3AE6 B;  3AEA B;  3L4P A;  3JSV B;  4HXD A;  3PLU A;  3ZIM A;  2OED A;  2WXF A;  5JHA A;  2IYD B;  3M95 A;  4WJQ A;  1TIF A;  4LJP B;  2WDQ B;  1SGH A;  3OJ4 B;  3PRM B;  4GDK A;  3NVZ A;  1C79 A;  1XD3 B;  5HHD G;  1BT0 A;  4WWN A;  5I4D A;  3EC8 A;  1VD2 A;  4HVB A;  2IGH A;  1C9F A;  1WY8 A;  1E9M A;  3ZQ4 A;  1I4R A;  1ISN A;  4F8C B;  1C4C A;  4A9A A;  4DQO C;  2FNJ B;  3R8B A;  1L0X B;  4ANX A;  1UUP A;  4KVG B;  3U7Z A;  2K9X A;  3NZU A;  2KDB A;  1GUA B;  4KGS A;  1YJ1 A;  1TS5 A;  3OAW A;  3U7D A;  1E5W A;  4ARC A;  1HE8 A;  1MVK A;  1P0R A;  4AOF A;  1D3Z A;  3GZN B;  3RUI B;  3PHX B;  4ACF A;  4RGN A;  1VZ6 A;  3U2S C;  3NVY A;  3DVN V;  5D94 A;  2O2V B;  1P1A A;  3PV1 A;  3AV8 A;  1WZ3 A;  1NYR A;  2XK5 A;  3Q69 A;  3WAO A;  3WIM A;  2PPH A;  4IM0 A;  5E6P A;  1ZKH A;  4EUT A;  2BS4 B;  1CQV A;  2HJ8 A;  3BVM A;  3OG5 A;  2XN9 C;  4BFR A;  3L54 A;  5G5G A;  4YL8 A;  4DHJ B;  4NJC A;  3A4R A;  2M56 B;  4M8M A;  5T8I A;  1RFA A;  2G3Q B;  4II3 B;  4BOS C;  1E90 A;  1ZW7 A;  1VLB A;  4ASW C;  2ZPN A;  2CJN A;  2IND C;  5FK9 C;  2L7R A;  3ZNZ B;  4HLE A;  1OGW A;  3ML9 A;  2E6X A;  1VDV A;  1TS2 A;  2QCZ A;  1S1Q B;  4LNI A;  4W9C A;  1YN5 A;  3ZRF A;  4J6I A;  3B9J A;  2JU6 X;  4I6P A;  4ZHO A;  2FCS A;  3B1L X;  2AWT A;  3AE9 B;  4RH6 A;  3KWL A;  1NEN B;  4PYZ A;  3VRA B;  2TSS A;  4GSW A;  1FXA A;  3I9V 1;  1EF5 A;  2SAK A;  3PZD A;  1P98 A;  2K25 A;  1SE2 A;  1EU3 A;  3PZ8 A;  4HDO A;  1ACC A;  3WAN A;  1I4P A;  2JT4 B;  4URK A;  2BB5 A;  3IG3 A;  3BK1 A;  3TJP A;  2IGG A;  4A55 A;  1XCT L;  3AN1 A;  5TSS A;  3WAP A;  4MJS A;  2PVG C;  1WX9 A;  2QC8 A;  3I63 C;  2WP9 B;  4B9K A;  1TT5 B;  4IG7 B;  2GBN A;  5MPO A;  4HWI B;  4W9L A;  1ZDX A;  4LNK A;  1H8C A;  3B0A A;  3DQV A;  3QJZ A;  4P7I A;  1C4P A;  2ZJD A;  2HDE A;  3HK0 A;  1SEB D;  3EHV A;  4LLG M;  2QDF A;  1FNU A;  2WU2 B;  2J0M A;  2LXC A;  1KRH A;  5IAA C;  2WGS A;  3TEY A;  1QQR A;  3H9D A;  2KAC A;  2KVZ A;  1WXQ A;  2CR5 A;  4K7W A;  1D5X C;  3TEZ A;  2PKO A;  3IFW B;  4FUL A;  1V2Y A;  2QSD A;  1TYG B;  5E6N A;  1ET9 A; 
#chains in the Genus database with same CATH homology
 4F7Z A;  2LVQ A;  2KK8 A;  2KFJ A;  2KZR A;  2L0T A;  3ENE A;  4XZ4 A;  3JYU A;  4IUM B;  2Z0D B;  3M62 B;  3IVF A;  2JUO A;  3KUC B;  2LVO A;  4BKS D;  1WJU A;  4FA6 A;  3NHE B;  1ZGU B;  4W9J A;  3QCA A;  2FCQ A;  1YQB A;  3ZDT A;  2KMC A;  3ZDM C;  4IWP A;  3QQ8 B;  2I1J A;  1GJZ A;  1EUV B;  2KWC A;  2ZCB A;  3W1S A;  1WE6 A;  5LXH A;  2CS4 A;  1A5R A;  1UZX B;  4BKS A;  2KN5 A;  3DCG A;  3PLV A;  1EO6 A;  3AUL A;  2KC1 A;  2K39 A;  3Q3J A;  4ANU A;  1IPG A;  4MGI E;  1WGH A;  2ZVO A;  3GOE A;  2LI5 A;  3L16 A;  2MW5 A;  1WFY A;  2NBW B;  4DHZ B;  2JPH A;  4NAW B;  1QZE A;  2IO0 B;  2IO3 B;  4K81 A;  2MBH A;  4RMA A;  1E8W A;  2GBJ A;  3VTU A;  4JGH B;  3KUZ A;  2KJR A;  2R2Q A;  2BKF A;  2PE9 A;  1VCB A;  3MTN B;  5CTR C;  2DHZ A;  1KM7 A;  2R2O A;  3KW5 B;  1UBI A;  4DDI D;  3QAQ A;  4DXA B;  4BBN C;  2KD0 A;  2NPT B;  4ZDV A;  3V61 A;  1RAX A;  3KVF B;  3DBR I;  3WAM A;  2BWE S;  4WAA A;  1WMH A;  4WQO B;  4G11 A;  5DPW A;  2KHW B;  3H7S A;  3UIN B;  1LXD A;  2G45 B;  2GOW A;  3VTW A;  4EEW A;  4HDQ A;  4F1S A;  4NJ6 A;  4XX5 A;  1WR1 A;  3BIN A;  5J18 A;  2LAS A;  4EOY A;  2KTF A;  3U8Z A;  4GGQ A;  3KYD D;  3R7Q A;  4FN2 A;  2IO2 B;  3L13 A;  3VTV A;  4WJN A;  3NOB A;  4FJY A;  2EKE C;  1WYW B;  2MSE D;  4TQ0 A;  2NBV B;  4RM8 A;  3A33 B;  3ZTC A;  4I6L B;  3QK0 A;  3L17 A;  4KIK A;  1UGM A;  2CHX A;  3A1Q B;  2KDF B;  2LGD A;  3ML8 A;  3VAW A;  5CX3 A;  2L0F A;  4PS7 A;  4EZL A;  4IW0 A;  4PS8 A;  4BKT A;  4K1R B;  2KDI A;  2MBO A;  1C3T A;  3KYC D;  2DEN B;  3TL5 A;  4FJZ A;  4KZ0 A;  4FHJ A;  3ZNH B;  4N9F 4;  3AU5 A;  4JQW C;  4LCD E;  1F9J A;  5CHW A;  3T9L A;  1NDD A;  3HHM A;  3ZKJ C;  2M8S A;  4MGY E;  2V1Y A;  1PQS A;  4HJK A;  4A20 A;  5AZG A;  1C1Y B;  2AEH A;  4EFO A;  2KDE B;  4G0N B;  2IY0 B;  3CF6 E;  1FXT B;  3M3J A;  4JLC A;  5DPT A;  2JY6 A;  3TIX A;  3VUY A;  3ZNG C;  2KFK A;  2KTR A;  2NR2 A;  5J2R A;  4BVU C;  2V4L A;  2C7H A;  2BPS A;  2K6Q A;  2WYQ A;  5LXI B;  2HD5 B;  1TBE A;  2DZJ A;  2OOB B;  1E7U A;  3CST A;  5KHQ A;  2PEA A;  4AUQ C;  2L05 A;  2O6V A;  5J17 A;  4A3P A;  1J19 A;  3PPA A;  2K8C A;  3TMP B;  2RPQ A;  4A3O A;  5G55 A;  1EF1 A;  1E7V A;  2FIF A;  2KKC A;  3APC A;  3RZW C;  2KNB A;  2RGF A;  3UIP B;  4NQL B;  1YX6 B;  1WJN A;  2JWZ A;  3IHP C;  1K8R B;  3MHS D;  5CHV C;  1WZ0 A;  3VDZ A;  3PRP B;  1V5T A;  4HPL B;  1WXA A;  1CMX B;  3QHT A;  2ZZP B;  4JIO U;  3X23 A;  2HE7 A;  4KSL C;  2KXJ A;  4GDL B;  2D10 A;  2ZNV C;  4ZRK A;  3V60 A;  2JZZ A;  5AZF A;  2OJR A;  4B95 A;  2Z59 B;  4TUU A;  4BBN F;  4DBG A;  4LJO B;  3V6E B;  5C1Z A;  4ZRI A;  1UEL A;  1WF9 A;  5D6J B;  3VVW B;  3DDC B;  2L3Z A;  2L76 A;  1GNU A;  2PJH A;  4HCN B;  2L00 B;  4MJS B;  3APD A;  4PS3 A;  4HPM B;  1E8Y A;  2CHW A;  2LGX A;  3OLM D;  2D11 A;  2N4F A;  2WDT B;  4NQK E;  2W9N A;  1UH6 A;  4DHJ D;  3A9J A;  3ZO5 B;  4B6W A;  2IBI B;  2NPT A;  2Y5B B;  3NY5 A;  3CSF A;  2J0J A;  2BYV E;  4IM3 A;  4WJP A;  4II2 B;  4M8N A;  1AAR A;  1JRU A;  4E3C A;  4W9F A;  1R4M I;  4HCP B;  3DVG X;  1X1M A;  1WIA A;  2N9P C;  3JW0 X;  2A4Z A;  1WGD A;  3DOW A;  3UGB B;  2N9X A;  2KFK B;  2NS5 A;  3HIZ A;  1LM8 B;  4X57 B;  2MP2 A;  3RD2 A;  3SD5 A;  2MQJ A;  4ICV A;  2RR9 A;  3KUD B;  2LRW A;  3WAL A;  2I1K A;  1Z2M A;  1WXV A;  2DYM A;  3TCA A;  4E74 A;  2GMI C;  2IO1 B;  3VXW A;  4FHK A;  2A5U A;  2EMS A;  3H1U A;  1OEY J;  1IP9 A;  4W9H A;  4W9D A;  1V49 A;  4TQ1 A;  5JZE B;  3HM6 X;  2HTH A;  3PS6 A;  4HK2 A;  2UYZ B;  1KJT A;  4K7S A;  2LD9 A;  2RD0 A;  3PVL A;  2C60 A;  1OTR B;  2REX A;  1WGG A;  3QA8 A;  3RCZ A;  4GMV A;  2LXA A;  2K8B A;  1KLV A;  4K7U A;  2N9E B;  1NI2 A;  2Z0E B;  5BO4 B;  2XBB C;  4G3X B;  5L95 C;  2XK5 B;  2GBM A;  1WH3 A;  3O65 B;  3PT2 B;  3VUX A;  2KOX A;  3APF A;  3PSE B;  4BOZ B;  2NVU I;  4CYE A;  4AJW A;  4GDL A;  5GMV A;  4E71 A;  2C7M B;  2FAZ A;  4TV3 A;  2KAN A;  2ZNV B;  1GG3 A;  3QAR A;  3RUL A;  3ZTD A;  4IC7 B;  1L2N A;  1E8X A;  1WMH B;  3Q3F A;  3UIO B;  2XEW A;  2NCN A;  4OVV A;  2N7D A;  4ANV A;  4NJ7 A;  1WJ4 A;  3RZF A;  1Q0W B;  4RM9 A;  2YVC A;  5DPS A;  4TKN A;  1RRB A;  2J0K A;  2LGY A;  5L83 A;  1KOT A;  4W9I A;  3VFK A;  2G4D B;  3VUW A;  2MBB B;  1OEY A;  2O6V B;  3A9K B;  5E6O A;  1UBQ A;  3R7R A;  1GC7 A;  2LJ5 A;  4JL9 A;  4W9K A;  2IY1 B;  4CO7 A;  1XT9 B;  2O2V A;  2M17 A;  4GU2 A;  3JSV B;  1WE7 A;  2L8J A;  4GOC A;  5JHB A;  3PRZ A;  4HXD A;  3PLU A;  5IA7 A;  2FUH B;  3ZIM A;  1J0G A;  2MLB A;  2KC2 A;  3B08 A;  5JHA A;  2G4S A;  2KTR B;  3ZNI D;  3BY4 B;  2IYD B;  2MWS B;  2LWP A;  3M95 A;  5D7G A;  3X0W A;  3V6C B;  1WGR A;  4WJQ A;  1OQY A;  4LJP B;  1SGH A;  3OJ4 B;  2KMA A;  2KLC A;  2JRH A;  2B3A A;  3PRM B;  4GDK A;  2MBQ A;  4MDK E;  4WWO A;  2WX1 A;  1XD3 B;  2DAF A;  1RLF A;  2J7Q B;  1BT0 A;  3W1Y A;  3DBL I;  3N3K B;  3UQA A;  4WWN A;  3U30 A;  2V3S A;  3AI5 A;  3EC8 A;  1VD2 A;  4HVB A;  3LDZ E;  1LQB A;  4MEM A;  4GXB A;  1WY8 A;  5G2N A;  5TR5 A;  2N1V A;  4GN1 A;  1T0Y A;  1ISN A;  2DZK A;  4AP4 C;  2DZI A;  5CHF A;  2DZM A;  2KQS A;  4MGK E;  4FLH A;  3VH4 B;  4F8C B;  2AL3 A;  2BKR B;  2FNJ B;  1E8Z A;  2K1F A;  3ZRC A;  2BGF A;  1Q5W B;  3CMM B;  2ASQ A;  2C9W B;  4ANX A;  4KVG B;  2KVR A;  3NZU A;  2KDB A;  1GUA B;  3GZN I;  1YJ1 A;  1P9D U;  2GBK A;  3LJ3 A;  3OAW A;  3U7D A;  2JZ3 B;  4FBJ B;  5EDS A;  1E5W A;  2IZV B;  1HE8 A;  1P0R A;  4AOF A;  2ZPY A;  2QHO A;  1D3Z A;  3RUI B;  3S2A A;  5HKH A;  3AU4 A;  2BYE A;  2D2Q A;  3PHX B;  3R66 C;  3W1S C;  3UF8 A;  3QC8 B;  2VRR B;  2JRI B;  2KX3 A;  5DCN A;  3L08 A;  1WR6 E;  2DX5 B;  3N30 A;  2BYF A;  3DVN V;  5AZH A;  2FCN A;  2ZVN A;  3JSV A;  5D94 A;  2O2V B;  4IWQ A;  4NNJ B;  1P1A A;  3PV1 A;  3SDL C;  4DWF A;  2MCN B;  2C7N B;  1WZ3 A;  4IM2 A;  5D2M B;  5FR6 A;  2MA9 B;  2D07 B;  2FID A;  2XK5 A;  1WX8 A;  1LFD A;  1WM3 A;  2CHZ A;  4WJO A;  3PRE A;  1WXM A;  2MBE A;  3WAO A;  3WIM A;  2PPH A;  1V86 A;  4IM0 A;  2KJ6 A;  1TTN A;  4WWP A;  2AYO B;  1M94 A;  2O6V D;  5E6P A;  3DBH I;  1UD7 A;  1P3Q U;  1ZKH A;  1TGZ B;  4EUT A;  1WRD B;  2KLG A;  2HJ8 A;  2LUE A;  2DYB A;  1H4R A;  2KO3 A;  3R3M A;  4KIK B;  4ANW A;  1XQQ A;  3ZUN A;  2EMT A;  4BFR A;  2WX0 A;  4IWO A;  2ZEQ A;  3QIJ A;  3L54 A;  2BWF A;  2KWV B;  3JVZ X;  4YL8 A;  4DHJ B;  4FJV B;  5LLI A;  1Q1O A;  4LDT D;  3A4R A;  4M8M A;  1GC6 A;  3ALB A;  3PHW B;  2MP2 B;  2M4N A;  4FAD A;  1RFA A;  2KJH B;  2G3Q B;  2MX2 A;  3SU8 X;  4DDG D;  3VH3 B;  4II3 B;  4BOS C;  2GBR A;  1E90 A;  2KX0 A;  4NPN A;  1NBF C;  1ZW7 A;  4ASW C;  2ZPN A;  3VQI A;  2LVP A;  4KDL B;  2L7R A;  3ZNZ B;  4HLE A;  4ICU A;  1OGW A;  3TBL D;  3ML9 A;  3QWZ B;  1SE9 A;  1WXS A;  4G50 A;  2WWZ A;  4NY0 A;  1S1Q B;  3ZLZ A;  3ZW3 A;  3PGE A;  1WX7 A;  3VHT C;  4W9C A;  4W9G A;  3ZRF A;  3DVG Y;  2K8H A;  4BKG A;  3H7P A;  4J6I A;  4KZC A;  4I6P A;  2CKH B;  2FCS A;  3B1L X;  2AWT A;  4GIV A;  2D3G A;  5KHO A;  3K9P B;  3A1Q A;  3C0R B;  2JXX A;  1SIF A;  3V62 A;  1WJ6 A;  3KH0 A;  4PYZ A;  4EZK A;  1G6J A;  1L7Y A;  4GSW A;  1EF5 A;  3IBE A;  4MM3 A;  3PZD A;  1P98 A;  2K25 A;  2DAJ A;  1R4N I;  4HDO A;  5JH5 C;  2KQ7 A;  3N32 A;  3WAN A;  5DPR A;  2JT4 B;  2ZCC A;  4AJY B;  4URK A;  4PYU A;  2MRP A;  2M0X A;  3ECI A;  2NBU A;  3A9J B;  1V80 A;  2RSU A;  3ONS A;  4AWJ A;  4KDI C;  3IG3 A;  1WGY A;  3TJP A;  2UWQ A;  2YLM A;  4DK5 A;  3SHQ A;  2N1W A;  3L10 B;  2LZ6 A;  2M1M A;  1Y8R C;  3NZS A;  1U4A A;  3DPD A;  3PTF C;  1YD8 U;  3WAP A;  4MH0 E;  4MJS A;  3L0W B;  1WX9 A;  4M0W B;  4MSM B;  3DVN U;  4B9K A;  2PE6 B;  4GDK B;  1MG8 A;  1I35 A;  4IG7 B;  4DHZ E;  3D32 A;  2GBN A;  2K6D B;  1V9J A;  2JVC A;  4MSQ B;  4HWI B;  4W9L A;  2JF5 A;  4KSK C;  1H8C A;  3B0A A;  4GB9 A;  2KWU B;  3NS8 A;  3OJ3 A;  4I6N B;  3DQV A;  5AEK B;  3QJZ A;  4P7I A;  4EZJ A;  3EEC A;  1V5O A;  3P2B A;  4NAW A;  3QX1 A;  3K9O B;  2ZJD A;  1V81 A;  3HK0 A;  3H7P B;  4XC2 A;  3UQB A;  1J8C A;  3EFU A;  3EHV A;  2N7E A;  1IYF A;  3M63 B;  2CU1 A;  1YIW A;  3A9K A;  2BF8 B;  4MGZ E;  1YX5 B;  4W9E A;  4ZRJ A;  3RT3 B;  3ZVV A;  1S3S G;  2J0M A;  4KV2 A;  2LXC A;  1WI0 A;  4CHK A;  3WA0 A;  4LDT B;  5IAA C;  3DBS A;  3HM3 A;  1Z5S B;  5C23 A;  2FCM A;  4EKU A;  3H9D A;  2C5L C;  3AXC A;  4MEL A;  4ZYN A;  2CR5 A;  3MJW A;  3A4S C;  3H6N A;  4K7W A;  3RYT A;  1V6E A;  3I3T B;  1WM2 A;  2AL6 A;  3IFW B;  4FUL A;  4OVU A;  1V2Y A;  1TZ1 A;  2DYO A;  2LRU A;  3T8M A;  5E6N A;  1I42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...