2JUOA

Gabpa ost domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
89
structure length
89
Chain Sequence
b'MAECVSQAIDINEPIGNLKKLLEPRLQCSLDAHEICLQDIQLDPDRSLFDQGVKTDGTVQLSVQVISYQGMEPKLNILEIVKTAETVEW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GA-binding protein alpha chain
publication title Identification and structural characterization of a CBP/p300-binding domain from the ETS family transcription factor GABP alpha
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 14
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2007-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11620 GABP-alpha GA-binding protein alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2juoA00
2KWCA 2KXJA 4WJOA 2DZIA 3VAWA 3C0RB 4W9EA 2M8SA 2ZCBA 3PVLA 3L08A 4AJYB 2DAJA 2KLGA 4LCDE 4ZRKA 1WRDB 2O2VB 3HM6X 5L95C 4KV2A 4DDGD 3A9KA 3B1LX 3T9LA 2LGXA 5HKHA 2QHOA 4I6NB 4AP4C 2D07B 2JXXA 1GC6A 3OLMD 5AZHA 3W1SC 1EO6A 2K6QA 2DZKA 2V3SA 2LGYA 1X1MA 2IO2B 2IY1B 2L3ZA 2LWPA 2KKCA 4PS7A 2L7RA 4NAWB 3QWZB 2N7DA 4RM8A 3KUCB 3EFUA 2C5LC 2NBWB 4GXBA 3PT2B 1WXSA 2K1FA 4WJNA 3QIJA 1OEYA 3RCZA 2FCSA 2DZMA 3K9PB 1XQQA 1V86A 2CKHB 2CHXA 2L0FA 2CHZA 3O65B 2FNJB 3IFWB 2GOWA 4URKA 1GG3A 1I42A 2O2VA 2FIFA 1R4MI 1VD2A 2BYFA 3HHMA 1UELA 4GDKB 3M95A 2FCNA 3PLVA 5JHAA 3A1QB 3MJWA 3L17A 3P2BA 3VUYA 2NR2A 4ICVA 2KQ7A 3V61A 5CHWA 4F7ZA 3M3JA 2NCNA 2G45B 4NAWA 4LDTD 2JRIB 2KFKA 1D3ZA 4EFOA 1YIWA 3KUDB 3M62B 3Q3JA 3PTFC 3VH4B 4EEWA 2WX1A 4HPLB 2V1YA 3AU5A 3B0AA 2KOXA 1E90A 2BKRB 3PGEA 2JZZA 5EDSA 1LM8B 2MBHA 2C60A 2KDFB 3QQ8B 4FBJB 5DCNA 3H1UA 3AULA 3MHSD 2AL3A 4W9CA 3R66C 4M8NA 1I35A 4N9F4 1UBIA 2MQJA 4FJYA 1RAXA 2K6DB 1P3QU 3RD2A 2W9NA 3PZDA 4MM3A 4WQOB 1SGHA 4BKTA 3SHQA 3U7DA 1P9DU 3TL5A 5CHFA 4LJOB 3DPDA 1WFYA 3H7SA 3V60A 4EZJA 1V6EA 1ZW7A 1OQYA 1XD3B 3UQBA 5LXHA 3WAMA 3PRMB 2NBVB 2PE9A 2ZNVC 4BOSC 4MDKE 1F9JA 4DHJB 3N3KB 2XEWA 1E7UA 5BO4B 1NBFC 2KWUB 2DZJA 1UBQA 2WDTB 2LUEA 4TQ0A 2DHZA 2N4FA 1NI2A 3TBLD 1QZEA 1YX6B 5JZEB 5C1ZA 4BOZB 2KNBA 4JLCA 2D10A 1S3SG 3PHXB 3VTWA 4LJPB 2OOBB 3D32A 1UH6A 4KZCA 2G4DB 1ISNA 3CMMB 4W9IA 4WJQA 2MBEA 2ZPNA 2KX3A 2C7MB 3DBHI 2KK8A 2ZCCA 3V6EB 3QCAA 5D7GA 2HD5B 2M1MA 4KDLB 5AEKB 1TZ1A 3NHEB 2CU1A 3QC8B 4EOYA 1WGHA 4W9JA 3T8MA 3WANA 2IYDB 1L7YA 2L00B 3IVFA 4BKSD 1P1AA 1J0GA 2JZ3B 3PREA 3QHTA 5DPSA 3DVGY 4K7SA 2XBBC 4TV3A 4B9KA 4FA6A 2FAZA 5DPWA 4GIVA 1Z2MA 2HE7A 5JHBA 4W9GA 1NDDA 4I6LB 4GDLB 4II3B 2L05A 2CR5A 3LDZE 2LGDA 2KTRB 2LI5A 3H6NA 2I1KA 1V5TA 4X57B 3SDLC 2GBJA 3ECIA 2R2OA 3H7PA 3DCGA 3V62A 4HWIB 1KJTA 2CHWA 1UD7A 3UF8A 4ANVA 3PS6A 5AZFA 2M17A 2BYEA 2KMAA 2ZVOA 3DBLI 3BY4B 3VTVA 1T0YA 4YL8A 3UIPB 3JYUA 4WWPA 4AUQC 3MTNB 1E5WA 2BKFA 2KHWB 1K8RB 3L54A 3NS8A 1IPGA 3JVZX 2CS4A 2KJHB 3A4SC 4FJVB 4GDLA 2R2QA 1WYWB 3SD5A 2LASA 2KTRA 1KLVA 4B6WA 4DWFA 1HE8A 3APFA 4W9KA 2KJRA 4TQ1A 2MBBB 3NY5A 1KM7A 2KFKB 3WALA 3DDCB 3UGBB 2MX2A 4W9DA 2IZVB 2FUHB 2J0JA 4K81A 2KANA 1WJUA 2FCQA 5LXIB 1GJZA 3UIOB 2DENB 2L76A 1CMXB 5LLIA 2O6VD 2K25A 5D2MB 5D94A 2N9XA 4JQWC 1GNUA 2KC1A 2Y5BB 4BFRA 2UWQA 1YJ1A 4I6PA 2NPTA 3ZLZA 1WGDA 4M0WB 1VCBA 2OJRA 1V80A 3ZRFA 1FXTB 4FHKA 2DX5B 3APDA 4MH0E 1V9JA 2GBRA 2WX0A 2ZVNA 2IO0B 4HXDA 4E71A 4KDIC 3DBRI 2PE6B 4GMVA 4II2B 3U8ZA 4JGHB 2EMSA 1G6JA 4F8CB 2WYQA 2ZJDA 3ZUNA 3PLUA 3WAOA 5J18A 2JF5A 2RR9A 1WX9A 3CF6E 1WGRA 3HM3A 1WE6A 1ZKHA 2DAFA 2LZ6A 4PYUA 4HK2A 2BGFA 5DPTA 4NQLB 3S2AA 2IO3B 5C23A 4ANXA 3X23A 3AXCA 1WJ6A 4IM0A 2YLMA 4TKNA 3TMPB 2M4NA 4HDQA 4HCPB 2KMCA 2VRRB 4OVUA 4MSMB 1OEYJ 4MJSB 4XZ4A 3WIMA 5L83A 2ZZPB 5E6OA 3TIXA 3ZVVA 3DVNV 4ASWC 4EKUA 1TBEA 3W1SA 2KD0A 3VVWB 1WXVA 2JUOA 1JRUA 2V4LA 4FLHA 1V81A 4OVVA 5E6PA 1SE9A 1WMHA 5CX3A 3QX1A 2D3GA 5D6JB 4KIKA 4CYEA 1WZ0A 2KN5A 4K7UA 2YVCA 4FN2A 4MSQB 2KO3A 2LRUA 2AL6A 3OJ3A 3HK0A 4NQKE 1E7VA 2DYOA 3APCA 4IWQA 4NPNA 4RMAA 2BF8B 3ZTDA 3H7PB 2KZRA 4MJSA 1MG8A 4W9HA 1YQBA 2BWFA 3TCAA 2KDIA 5JH5C 2GBMA 3NZSA 1IP9A 3R7RA 2JT4B 4RM9A 2B3AA 3N30A 2MLBA 4DXAB 4FHJA 4BKGA 1A5RA 1P0RA 3PRZA 1Q1OA 4MGKE 1TGZB 5CHVC 3PPAA 4K1RB 3OAWA 2MBQA 1Q5WB 4LDTB 2MP2B 1WR1A 3VHTC 4KVGB 3JSVA 1WJ4A 2G4SA 1UZXB 2KJ6A 2KX0A 1EF5A 4XC2A 1WX7A 4ZRIA 3VDZA 5IAAC 3PHWB 3H9DA 2C7NB 4DHZB 4IC7B 4MEMA 4ANWA 2GBNA 2N7EA 4WWOA 3ZKJC 3L16A 1WY8A 3WAPA 1E8XA 4M8MA 4ZDVA 4BVUC 2HJ8A 3ONSA 2N1VA 1R4NI 3KYCD 4IW0A 3VUXA 2M0XA 1WF9A 4CHKA 2KFJA 2Z59B 4HVBA 4AWJA 2G3QB 4NJ7A 2MP2A 1J19A 3VXWA 3NZUA 2NPTB 4E3CA 3QA8A 2XK5A 3KYDD 2KTFA 3U30A 1V5OA 1WXAA 2NBUA 4BBNC 2LXAA 3N32A 4G3XB 3BINA 3IBEA 3RULA 3ML8A 3A9JB 3ML9A 3DOWA 3L13A 3DQVA 1KOTA 2PEAA 4GGQA 4HCNB 3GOEA 4GSWA 5G55A 4FADA 4DHZE 1WGGA 2N1WA 5CTRC 3ZNGC 2A5UA 1IYFA 4A3OA 1E8YA 2ASQA 3ALBA 3ZNID 4DHJD 2MRPA 4JL9A 1WX8A 2AEHA 2I1JA 4WWNA 2K8CA 2MW5A 3V6CB 2DYBA 2AWTA 2L0TA 2EKEC 1Y8RC 3UINB 4GB9A 4WJPA 4FJZA 2BWES 3DVNU 5DPRA 4B95A 3PRPB 4W9LA 4GN1A 2KQSA 2D2QA 1YX5B 2A4ZA 2KC2A 3A9JA 4HPMB 2FIDA 3KW5B 3PSEB 4GOCA 3L0WB 2DYMA 1H4RA 4PYZA 3RYTA 2AYOB 4F1SA 5FR6A 3ZTCA 1BT0A 1WJNA 2MBOA 3DBSA 4BBNF 3KUZA 4ZRJA 4G0NB 2K8HA 2FCMA 3QARA 3JW0X 3QJZA 2LJ5A 3R7QA 1WMHB 3RT3B 1WGYA 1C1YB 3VQIA 3QAQA 4KIKB 1S1QB 2BYVE 3AI5A 3ZDTA 1ZGUB 3A4RA 3K9OB 4IUMB 4ANUA 1LFDA 2MWSB 3CSFA 1SIFA 5E6NA 4BKSA 2RGFA 5J2RA 2KDBA 1AARA 2IBIB 2WWZA 4PS3A 3W1YA 3ENEA 3ZIMA 2KVRA 2J0KA 4J6IA 3DVGX 4HJKA 1RRBA 2LVPA 2MSED 1P98A 1EF1A 3VFKA 2ZEQA 2J0MA 3PV1A 5AZGA 5G2NA 2LVOA 3KVFB 4GDKA 3NOBA 4G11A 1WM3A 4ICUA 1Q0WB 4KZ0A 4MELA 1WM2A 4NY0A 3A1QA 2N9EB 2REXA 2JWZA 2EMTA 4JIOU 3JSVB 4TUUA 1WR6E 4GU2A 1H8CA 2UYZB 3ZNHB 1OTRB 2C9WB 2LD9A 4G50A 1U4AA 3VUWA 2Z0EB 2O6VB 3CSTA 4PS8A 2LXCA 4ZYNA 4A20A 1WZ3A 3HIZA 2JPHA 1L2NA 4IM3A 2JY6A 3ZO5B 3EHVA 1UGMA 3B08A 3L10B 3EECA 2RD0A 4WAAA 2MCNB 3GZNI 4KSKC 4KSLC 1RLFA 1XT9B 4XX5A 2RSUA 1WI0A 2ZNVB 4MGIE 3WA0A 4DBGA 4W9FA 5TR5A 3QK0A 2LRWA 1V2YA 3IHPC 5KHQA 3M63B 4FULA 3RZFA 3UQAA 3OJ4B 5J17A 1GC7A 4IWOA 2KWVB 2XK5B 1Z5SB 3RUIB 1OGWA 4AOFA 4NNJB 5IA7A 3I3TB 2MA9B 4AJWA 3AU4A 4P7IA 1RFAA 2IY0B 4HLEA 1LQBA 2NS5A 2O6VA 2PJHA 5GMVA 3KH0A 1PQSA 3ZW3A 5KHOA 3ZDMC 1M94A 1WE7A 1YD8U 4DDID 1TTNA 1V49A 2ZPYA 4HDOA 4IM2A 2C7HA 3VTUA 3R3MA 2LVQA 3EC8A 3ZNZB 2K39A 4A3PA 2PPHA 2N9PC 3VH3B 4NJ6A 4EUTA 4EZKA 4E74A 2K8BA 4IWPA 2IO1B 4K7WA 1EUVB 1E8ZA 3A9KB 3LJ3A 1LXDA 4MGZE 4CO7A 2KDEB 3A33B 4IG7B 4DK5A 2JRHA 2NVUI 2L8JA 2D11A 1E8WA 2JVCA 2GMIC 3ZRCA 1WIAA 4EZLA 2BPSA 2HTHA 3Q3FA 3SU8X 3RZWC 4MGYE 1WH3A 3X0WA 2GBKA 2KLCA 1WXMA 1C3TA 3IG3A 2Z0DB 1GUAB 1J8CA 2RPQA 3TJPA 2J7QB
chains in the Genus database with same CATH superfamily
1FRRA 4WJOA 2DZIA 3C0RB 4OHJA 3PVLA 3L08A 2DAJA 4LCDE 4ZRKA 3HM6X 5L95C 2INCC 3SFDB 3A9KA 2W3RA 2JXXA 5AZHA 2V3SA 2DZKA 2KVZA 4C4VA 1X1MA 2IO2B 3TEXA 3KUCB 3PT2B 1WXSA 4WJNA 3RCZA 1MJDA 1N5XA 1DOIA 2L0FA 1T0RC 3R8BA 2G1EA 3AE7B 2FIFA 1VD2A 2J52A 2BYFA 1UELA 1KF6B 5JHAA 3VUYA 2NCNA 3IAS1 3BK2A 3OG5A 3TSSA 4EFOA 1YIWA 4KGTA 3M62B 3VH4B 4EEWA 1T6BX 1VZ6A 4GLSC 2X38A 5EDSA 1LM8B 2W3SA 5DCNA 3ZXVA 1L0XB 1UUPA 4C80A 3R66C 1P3QU 3AEGB 4WQOB 4JPSA 1YOVB 1T5XD 2W82A 2UU7A 2ON8A 1V6EA 1XD3B 2ZNVC 4DXGA 2JYEA 4MDKE 1F9JA 1FCCC 3N3KB 2XEWA 2KWUB 2DZJA 2N4FA 2M0AA 1ZE3D 5C1ZA 4BOZB 1PFDA 1QOFA 2D10A 3IXSA 1TS5A 3PHXB 2OOBB 1UH6A 1CK1A 4RCOA 1ISNA 1YN5A 1JW9D 2MBEA 1KLGD 2ZCCA 2WP9B 1LO5D 2JSVX 4ZRPA 3VRBB 4XE0A 2WXFA 2BB5A 1P1AA 2OEDA 3QHTA 4K7SA 4FA6A 5DPWA 4W9GA 1L6UA 2L05A 2IGGA 3ECIA 1FPYA 2R2OA 1CQVA 2AQ3B 4HWIB 2K22A 3UF8A 5IO9A 4ANVA 1KFYB 3AV8A 1T0YA 2WXQA 3UIPB 3LYYA 4WWPA 2BS3B 3E9SA 2PTLA 2KHWB 2WNMA 3B2FA 3L54A 2KJHB 1WYWB 1YJJA 4PT5A 3MP9A 1PYWD 2KFKB 5C2TB 3DDCB 3UGBB 5LNK1 4W9DA 2IZVB 4K81A 2FCQA 4A90A 3UIOB 3FC4A 2L76A 1V97A 2K25A 1YJIA 2N9XA 1GNUA 2Y5BB 2UWQA 4A9AA 4MM3B 4C00A 3APDA 2WX0A 2ZVNA 4HXDA 4GMVA 4II2B 2KWDA 2WYQA 1TKYA 3PLUA 1WGRA 2DAFA 2LZ6A 4HK2A 2BGFA 4L2YA 4NQLB 4ANXA 3X23A 3Q8BA 4IM0A 4HDQA 2KMCA 1CZPA 3P4PB 4XZ4A 3WIMA 3ZVVA 1AN8A 4EKUA 1NI3A 3BVGA 3V05A 3VVWB 3NUHB 5FK9C 4OZCA 1WXVA 1SE9A 1HTQA 1C9FA 1L4DB 1I4GA 3W5VB 3P42A 1SSNA 4NQKE 4IWQA 2GRIA 3GP7A 2KZRA 2B76B 4W9HA 1HEZE 3Q69A 3TCAA 2QEJC 2RDHA 5JH5C 3NZSA 2WXJA 1STEA 1WRIA 1TGZB 4K1RB 3GE8C 1XLQA 4LDTB 2MP2B 1XF5L 1FCLA 1WJ4A 2KJ6A 3I5JC 5C3JB 1MI0A 2C7NB 4ANWA 2GBNA 1GB1A 1BMLC 3ZQ4A 2RMMA 1D5ZC 2M0XA 4YSXB 2LHDA 4AWJA 3SR6A 2MP2A 4E3CA 2NMQA 1JCKB 2IGHA 3RN9C 1V5OA 3N32A 1RWSA 3BYYB 2CU3A 3RULA 3ML8A 3Q8AA 1R4NB 3L13A 3DQVA 5HFYA 4DHZE 2N1WA 2K0PA 2JXTA 4DHJD 1KH0A 3FILB 3V6CB 1NYRA 2IDYA 4HKZE 4ZHOA 2BWES 1ACCA 4R3DA 2V0GA 4GN1A 2KQSA 4GOCA 2WXKA 3KW5B 4PYZA 3AE4B 1H4RA 2AYOB 1F52A 1AW7A 5FR6A 3ZTCA 3DBSA 2FCMA 3QARA 3JW0X 3U4EG 1WMHB 1TS2A 2WXGA 1C4AA 3N1ZC 5BYRA 4M02A 1F77A 3FILA 3KQ4A 2YEPB 1V1PA 1ZGUB 3K9OB 4IUMB 1SIFA 4N6EB 4BKSA 5J2RA 2KDBA 1BUIC 1TT5B 4JWUC 4PS3A 3W1YA 2XNAC 3DVGX 3RI7C 1RRBA 2MSED 2K5PA 1FNWA 3NOBA 4KZ0A 2K9XA 3C19A 4YSYB 3A1QA 3NS1A 2N9EB 2EMTA 3JSVB 4GU2A 1NENB 1ZOYB 2LD9A 1U4AA 4CQNA 2O6VB 1J7BA 2WDVB 2Y5CA 3CSTA 1N5WA 2JPHA 3GZNI 4KKJA 2WDQB 2FE8A 4ZOHC 4DBGA 5TR5A 4FULA 5J17A 1GC7A 3RUIB 5IA7A 4AOFA 5HG2A 2PKOA 2R61A 4P7IA 2IY0B 2NS5A 2O6VA 3KH0A 5KHOA 3ZDMC 4DDID 1TTNA 4IM2A 4XYCA 3R3MA 2FBWB 3BIID 2J4XA 2PPHA 1ESFA 4EUTA 1E8ZA 2LUMA 3LJ3A 1LXDA 4CO7A 4USAA 2KDEB 3A33B 1OQRA 3ZRCA 1WIAA 2BPSA 3LB8C 2HTHA 3X0WA 2GBKA 2KLCA 3ONSA 3TJPA 5HKHA 2KXJA 1R7SA 3MFGA 2BT6A 4W9EA 1WRDB 3AE8B 3T9LA 3RNEC 2IPKD 2D07B 1FO4A 2L3ZA 2KKCA 2N7DA 2C5LC 2L83A 2NBWB 1QOAA 4S17A 3QIJA 1OEYA 2DZMA 1V86A 2Q5WD 4WAFA 1TYGB 4XDCA 1TKEA 3EA6A 3MC8A 2GOWA 4LTUA 2LMCA 4GDKB 1R4MI 1D6EC 2FCNA 3MJWA 1QT9A 2NR2A 4ICVA 3V61A 3Q3NC 4J3OD 4F7ZA 3M3JA 4US9A 1WSPA 3KUDB 3Q3JA 1TY0A 2KOXA 5H92C 1E90A 2BKRB 1B9RA 2KDFB 4FBJB 1P7FA 4IDIA 3TEWA 1UBIA 1YQ4B 3Q8EA 3BVZA 1RAXA 4HEA1 3EFCA 2G9HD 3PZDA 1E7PB 4US8A 3SHQA 3U7DA 1FNVA 3TL5A 2HJ1A 4XGAB 3UI3A 4HKQA 3H7SA 3AE2B 3Q3MC 1ZW7A 5FR3A 1OQYA 3UQBA 3WAMA 1VR9A 5BO4B 1NBFC 1F2RC 4TQ0A 1NI2A 1WWTA 1QZEA 3TBLD 2HTME 4JLCA 1S3SG 3CMMB 3CWIA 4WJQA 2KX3A 1L6VA 2C7MB 4RGMA 5D7GA 2AQ2B 4KDLB 3Q6BA 2MH7A 2CU1A 4EOYA 1WGHA 2AQ1B 2W54A 3T8MA 1UGJA 3N9YC 1J0GA 3VR9B 2LGSA 4NAMA 2Y5PA 4B9KA 2HE7A 1NDDA 1FIQA 4II3B 4KKIA 3H6NA 2I1KA 1V5TA 3SDLC 2RDGA 3H7PA 4C4VB 4IOIE 3V62A 1KJTA 2BW2A 1UD7A 2CHWA 2D3AA 5AZFA 1HA5A 2M17A 3DBLI 4YL8A 4ZYSA 3JYUA 1JROA 2E3TA 2V3PA 2I38A 1SXTA 2CS4A 3A4SC 2R2QA 2D3BA 2N7JA 2FUG1 5TSSA 1E10A 3GE3C 4W9KA 4JWSC 4YXDB 2MX2A 3NVVA 1TJEA 1GJZA 1M4VA 2DENB 2KQ4X 3ZGZA 5D2MB 1EU3A 4JQWC 4BFRA 1EWCA 2NPTA 1HQRD 3ZLZA 2HDEA 5AUKA 2OJRA 3ZRFA 3B2GA 1SE4A 1V9JA 3DBRI 1NEKB 4JGHB 4C7YA 4F8CB 5J18A 3HM3A 5D3DA 1ZKHA 4PYUA 1V8CA 3AEAB 3S2AA 2IO3B 3T3OA 4TKNA 3TMPB 4A55A 4HCPB 1TS4A 2ZZPB 3TIXA 3DVNV 5E6JA 3BYTB 4AS1A 1JWMD 4FLHA 4OVVA 1IBXB 2D3GA 3DWGC 1FFUA 4FN2A 4MSQB 3HUIA 3ZTDA 2BF8B 4WH4A 1KTKA 2BB6A 2WXRA 1C78A 3NVYA 2KDIA 3BWUD 4FHJA 3ZXRA 3MC0B 1Q1OA 4MGKE 3PPAA 1IBXA 3HVDA 1WYGA 4N58A 4TSSA 1MPEA 4KVGB 3VHTC 3AE5B 2G4SA 3PZ8A 3VDZA 5IAAC 3N1XC 1J8CA 4DHZB 1C4CA 2Y3AA 5BYSA 4MEMA 2LGIA 2ZW0A 4LLGM 3ZKJC 3L16A 1WY8A 2VH1A 1SJED 4IW0A 4CHKA 2KFJA 1EU4A 2G3QB 4NJ7A 3AB5A 1J19A 1OFFA 3VXWA 1L5PA 1VJKA 4HPPA 2XK5A 1WXAA 1FXIA 4BBNC 1OQQA 2LXAA 2BQQA 2VH2A 4P6VF 3NVWA 3IBEA 3A9JB 3VR8B 1IUEA 1WGKA 4GGQA 4HCNB 4FADA 4NJCA 1SE3A 1ZPSA 1I4PA 2XN9C 1E6EB 2K8CA 1NVID 4XDDA 3DHHC 5BMIA 2MHJA 1A70A 4A6QA 2D2QA 1YX5B 5T8IA 2KAJA 3A9JA 4HPMB 4ITKA 4LNKA 2RPVA 1E9MA 4G0NB 1HZ5A 2MEKA 3RT3B 2ZW1A 2BYVE 3AI5A 3ZDTA 1LFDA 3CSFA 2KACA 1KLUD 1AARA 2WWZA 3ENEA 3P4QB 3VRAB 2KVRA 2J0KA 2WU5B 1P98A 1EF1A 5G2NA 2EELA 2PVGC 1PGAA 1WM3A 3L4PA 1Q0WB 4OW0A 1EM7A 1WM2A 1N63A 2JWZA 1RFKA 1QLBB 3ZNHB 1MFWA 2C9WB 1F2RI 4G50A 1JWAD 2BBCA 2WHIA 4ZYNA 4A20A 3CIRB 4YTPB 3B08A 2MCNB 4KSKC 3BVMA 5G5GA 1RLFA 2RSUA 2ZNVB 4MGIE 1DOXA 4W9FA 1V2YA 3M63B 3NJTA 1SE2A 1JALA 1Z5SB 1OGWA 3AEEB 5D3IB 4TMAB 1RFAA 3ZJVA 5GMVA 1PQSA 3GZNB 1YD8U 2ZPYA 4HDOA 4L1BA 2N9PC 2V3NA 4NJ6A 4EZKA 2K8BA 4WIPA 4MGZE 3AMZA 1TIFA 2L8JA 1E8WA 2GMIC 1VDVA 3RNFC 1WH3A 1WXMA 1C3TA 1GUAB 4LNIA 2J7QB 1JWBD 1I7HA 3VAWA 4YSZB 2ZCBA 3AE9B 4AJYB 2KLGA 3V3XA 2O2VB 1L4ZB 4KV2A 4DDGD 3B1LX 2QHOA 3SEBA 1GC6A 1V1PB 4NZLB 3W1SC 2LGYA 2IY1B 3P1MA 2CJOA 4PS7A 2L7RA 4NAWB 4RM8A 2H88B 2K1FA 1D5XC 1C79A 2EKIA 1I4QA 2CKHB 2CHXA 4S0RA 2CHZA 3O65B 2FNJB 4URKA 1GG3A 2O2VA 2QIEB 3A1QB 2KQ7A 5CHWA 3N1YC 2G45B 4NAWA 4LDTD 1D3ZA 2V4IB 3PTFC 3C8YA 2WX1A 4HPLB 3B0AA 2DLBA 2SEBD 3DHGC 2MBHA 2C60A 1R4MB 1F0ZA 4YTMB 3AULA 3MHSD 2AL3A 4W9CA 4M8NA 1I35A 4FJYA 1TS3A 1SGHA 4M0WA 1YN4A 5CHFA 3DPDA 2KYWA 2NBVB 2PE9A 2JYTA 1UBQA 1ENFA 1YX6B 5JZEB 1C77A 3WCQA 1FEHA 1GPXA 1ET6A 3VTWA 3D32A 3I57A 4KZCA 2G4DB 4YT0B 3DBHI 2KK8A 4Q2JA 1MG4A 5AEKB 4OZAA 1N61A 3NHEB 2KN4A 2IYDB 3AEBB 4C7ZA 4BKSD 3IT4B 2JZ3B 5FKAC 3DVGY 4WWMA 4A8XC 4GIVA 1Z2MA 2CR5A 2INPE 2LGDA 2KTRB 2LI5A 4X57B 1K50A 3AE3B 3DCGA 3ZYYX 5HHDG 2LHEA 3I9V1 2BYEA 3VTVA 3BY4B 3ZJUA 1JWUD 4LNOA 1E5WA 2QMTA 2JX5A 4B0EA 1GOZA 3FAHA 3JVZX 1UNSA 3R2IA 2D3CA 3SD5A 2KTRA 1KLVA 4B6WA 4DWFA 1HE8A 3APFA 2PMVA 3DBLB 4TQ1A 4QAYA 3E56A 1KM7A 3NY5A 3MHZA 2J0JA 2KANA 2BTEA 1WJUA 4RF1A 5LXIB 1ZXIA 1CMXB 5LLIA 2O6VD 1Q10A 2KC1A 1SJHD 4RGNA 2V9HA 4I6PA 2INNE 1WGDA 2JU6X 3DHIC 3AM9A 4O1NA 3EUB2 1V80A 1FXTB 4N59A 5BYQA 2WS3B 1YMHE 4BZAA 2EMSA 1AYFA 1B1ZA 2ZJDA 2RR9A 1WX9A 1WE6A 5DPTA 1D4BA 1WJ6A 4B0MA 2VRRB 2YEPF 1JQ4A 5L83A 3DBRB 2CJNA 5E6OA 1MVKA 3MJ5A 3W1SA 1XCTL 2KD0A 1FRDA 1SB3C 2JUOA 5CX3A 2DBYA 1XCQL 3QX1A 2TSSA 5D6JB 3IT6B 4KIKA 4CYEA 1RYJA 1WZ0A 4K7UA 2QCZA 1ZDXA 4LNNA 2KO3A 2LRUA 2WQYB 3OJ3A 1E7VA 3APCA 3P4SB 3HVZA 5MPOA 1DGJA 2L52A 3H7PB 1MG8A 3NZ3A 1IP9A 2JT4B 4RM9A 2B3AA 4BAXA 1MHXA 4DXAB 4BKGA 1A5RA 1P0RA 3PRZA 2BS2B 2I2YA 4LNFA 5CHVC 2N9KA 3OAWA 2MBQA 2WXPA 3RMKC 1LGRA 1SBBB 1T0SC 2KX0A 1EF5A 2BVCA 1WX7A 4ZRIA 2RDBC 2MJ3A 2N7EA 4WWOA 1T3QA 3WAPA 1E8XA 4M8MA 4ZDVA 2GLSA 4BVUC 2HJ8A 2N1VA 4HJGE 3VUXA 1TKGA 2Z59B 1FD6A 3NZUA 2NPTB 1F1HA 3KYDD 2KTFA 3U30A 2NBUA 5EE3A 2M56B 2QC8A 3RNBC 2OHFA 2PEAA 1WGGA 3ZNGC 1IYFA 1JRPA 3ZNID 5G5HA 2MRPA 2AEHA 1RM6C 2MW5A 2VZKB 4GB9A 4FJZA 1FXAA 2IGDA 3PRPB 4W9LA 2A4ZA 1KRHA 2SAKA 3PSEB 2FIDA 2DYMA 2MBOA 3GS2A 3KUZA 2K8HA 4REZA 1C1YB 3QAQA 1SEBD 1S1QB 3W5UB 2WGSA 4ANUA 2L32A 2W55A 2MWSB 5E6NA 5JXVA 2RGFA 3N20C 4OZBA 4H2AA 3AECB 2GI9A 3ZIMA 3I63C 3KLSX 4RFBA 2LVPA 1JMLA 2ZEQA 2J0MA 3PV1A 5AZGA 2LVOA 4MELA 3TUOA 1TY2A 5IN7A 3KWLA 1H8CA 2UYZB 4C56C 1OTRB 3URYA 5EE0A 2Z0EB 3VUWA 4PS8A 1N62A 2IJ0A 5GXGB 5IOIA 1L2NA 5AUIA 3L10B 1UGMA 2NTSA 2WDRB 4WAAA 1N60A 4KSLC 1XT9B 1WI0A 3RPFC 3WA0A 1L0VB 3FKYA 3QK0A 2WXHA 3RZFA 3UQAA 3P63A 4IWOA 2KWVB 1I4RA 2XK5B 3U52E 1QQRA 4NNJB 1FM0D 2J53A 3IAM1 4HLEA 3MC9A 1LQBA 3PZ7A 2VZKD 3J9CA 1WE7A 1WXQA 3VTUA 4FXCA 2IO1B 2X8XX 1XLPA 1J7CA 1XLOA 1K51A 4IG7B 4DK5A 2JVCA 2D11A 4EZLA 2JZPA 3Q8FA 1GAQB 1FNUA 1HTOA 3NVZA 1L0YB 4JX1C 3IG3A 2KWCA 2ACZB 2M8SA 3ETRA 2K3UA 5IKCM 2LGXA 4K3CA 2M19A 4I6NB 4AP4C 3OLMD 1UWMA 3P4RB 1EO6A 2K6QA 2LWPA 3QWZB 3AEFB 3SFEB 1P7EA 2QILA 3EFUA 4GXBA 4WURA 2FCSA 4KX6B 3K9PB 1XQQA 4OVZA 4WQMA 3AH7A 3BZDB 3IFWB 4MT5A 1I42A 3HHMA 3M95A 3PLVA 3L17A 3P2BA 4YTNB 1UF0A 2KMMA 2N0SB 4HRSA 2JRIB 2KFKA 1ROEA 3W9CB 2V1YA 3AU5A 5IP4D 3PGEA 2JZZA 3QQ8B 1I4XA 3H1UA 4N9F4 2N9LA 2MQJA 2WLBA 2K6DB 3RD2A 2W9NA 4MM3A 4BKTA 4AQ7A 1P9DU 2PVOD 4LJOB 1WFYA 4M00A 3V60A 1SIJA 4EZJA 1C4PA 4PK1A 3TEZA 5LXHA 3PRMB 4DQOC 3RFZB 2WXLA 3DWMA 4BOSC 4DHJB 1E7UA 1XO3A 2WDTB 2LUEA 1PGXA 2DHZA 2WXIA 2BYTA 2KNBA 2WU2B 4LJPB 3RNGC 4XWTA 4W9IA 5BMGA 2ZPNA 3V6EB 2QJLA 3QCAA 2HD5B 2M1MA 4RGOS 1TZ1A 3QC8B 2QDFA 4W9JA 3WANA 4XWWA 1L7YA 2L00B 3IVFA 2KT7A 3R2TA 3PREA 5DPSA 3DBHB 3PO0A 1D5MC 1BXTA 2XBBC 4TV3A 2FAZA 3NG0A 5JHBA 4I6LB 4GDLB 3LDZE 4YWGG 1DOYA 3RNCC 3U2SC 2GBJA 1J7AA 3Q14C 1IGCA 3PS6A 1PDXA 2KMAA 2ZVOA 1I4HA 1QOBA 3OWEB 2L1AA 1ET9A 3AEDB 4AUQC 1XXGA 3MTNB 1ZP0B 4JE3B 5EE1A 2BKFA 3ZJTA 1K8RB 3NS8A 1IPGA 1TZOA 4GDLA 4FJVB 3GB1A 2J42A 2LASA 4K3BA 2LEKA 2KJRA 2MBBB 3WALA 1PUTA 2FUHB 2QSDA 2LFIA 4MH8A 3EGRA 3AE1B 5D94A 3ABVB 3BK1A 4M01A 1YJ1A 5HI1A 5I4DA 3U7ZA 4M0WB 1VCBA 4FHKA 2DX5B 4MH0E 3AN1A 2GBRA 1FFVA 3LXFA 2IO0B 1CJEA 2GB1A 4E71A 4KDIC 1AWDA 2PE6B 3U8ZA 1G6JA 3ZUNA 3WAOA 1JWSD 2JF5A 3CF6E 1HZ6A 1XEEA 5C23A 4LK0M 3AXCA 2YLMA 3NRZA 2JQRB 2M4NA 4OVUA 4MSMB 1OEYJ 4MJSB 4RH6A 2PW9A 4MACA 4ASWC 1TBEA 1VLBA 4P16A 1VRAB 1JRUA 2V4LA 1V81A 5E6PA 4DXFA 1WMHA 4ARCA 3W2DA 2D5GA 2KN5A 2YVCA 1QF6A 2AL6A 3HK0A 2DYOA 4NPNA 4RMAA 4MJSA 1FMAD 2JWUA 1YQBA 2BWFA 1ZXHA 2GBMA 3HRDD 3R7RA 2KDMA 2DWQA 3N30A 2MLBA 3RNAC 4D2KA 4P1BC 1Q5WB 2MJEA 1WR1A 1QILA 3JSVA 3Q8CA 1UZXB 3Q2AC 4XC2A 3T3NA 4RNAA 2INDC 3PHWB 3H9DA 4L23A 4IC7B 4ZRQA 1YN3A 4ARIA 4HROA 1R4NI 3KYCD 4IKGA 1N6ZA 1WF9A 4HVBA 4P1CC 1XLNA 3QA8A 2OJWA 3Q3OC 1YNTE 4G3XB 2ONQA 3BINA 1T0QC 3ML9A 3DOWA 1VZ8A 2MJDA 1KOTA 2DNFA 3GOEA 4GSWA 5G55A 2Z8LA 5CTRC 2A5UA 2E6XA 4A3OA 1E8YA 2ASQA 3ALBA 2BS4B 2WXMA 1K52A 4JL9A 1WX8A 1GB4A 2I1JA 4WWNA 2H89B 2DYBA 2AWTA 2L0TA 2EKEC 1Y8RC 3UINB 1NYQA 4WJPA 3DVNU 5DPRA 4B95A 2KC2A 1MHHE 4F1SA 3L0WB 4RGTA 3RYTA 4BBNF 1BT0A 1WJNA 4ZRJA 3QJZA 2LJ5A 3R7QA 3KWVA 1IGDA 1WGYA 1PGBA 5BMHA 3VQIA 4KIKB 1UWXA 1Y56A 3A4RA 4KGRA 1DYQA 2IBIB 5H8YE 2WXOA 3O13A 4RF0A 4J6IA 4HJKA 3VFKA 3KVFB 4GDKA 4G11A 1E0ZA 4ICUA 4NY0A 2REXA 4JIOU 4TUUA 1C76A 1WR6E 1HXYD 2ICIA 2LXCA 4EE2A 1WZ3A 3HIZA 4ZHPA 2NTTA 5EE9A 4IM3A 2JY6A 3ZO5B 3EHVA 3EECA 2RD0A 3B9JA 4UDUC 3AE6B 1ZUD2 4XX5A 1ZDVA 4KGSA 1V1OA 2LRWA 3IHPC 5KHQA 3TEYA 1EWYC 3OJ4B 3I3TB 2MA9B 2LJIA 4ACFA 4AJWA 3AU4A 2WXNA 2PJHA 3ZW3A 1M94A 1V49A 1YQ3B 1SF0A 2C7HA 2LVQA 3EC8A 3ZNZB 2K39A 4A3PA 3VH3B 4E74A 4IWPA 4K7WA 1EUVB 3A9KB 1K53A 3H8HA 2JRHA 2NVUI 3Q3FA 3SU8X 1VZ7A 3RZWC 4MGYE 2AX5A 1QKZA 1QOGA 2Z0DB 2PLPA 2PIAA 2RPQA
chains in the Genus database with same CATH topology
2KWCA 2KXJA 4WJOA 2DZIA 3VAWA 3C0RB 4W9EA 2M8SA 2ZCBA 3PVLA 3L08A 4AJYB 2DAJA 2KLGA 4LCDE 4ZRKA 1WRDB 2O2VB 3HM6X 5L95C 4KV2A 4DDGD 3A9KA 3B1LX 3T9LA 2LGXA 5HKHA 2QHOA 4I6NB 4AP4C 2D07B 2JXXA 1GC6A 3OLMD 5AZHA 3W1SC 1EO6A 2K6QA 2DZKA 2V3SA 2LGYA 1X1MA 2IO2B 2IY1B 2L3ZA 2LWPA 2KKCA 4PS7A 2L7RA 4NAWB 3QWZB 2N7DA 4RM8A 3KUCB 3EFUA 2C5LC 2NBWB 4GXBA 3PT2B 1WXSA 2K1FA 4WJNA 3QIJA 1OEYA 3RCZA 2FCSA 2DZMA 3K9PB 1XQQA 1V86A 2CKHB 2CHXA 2L0FA 2CHZA 3O65B 2FNJB 3IFWB 2GOWA 4URKA 1GG3A 1I42A 2O2VA 2FIFA 1R4MI 1VD2A 2BYFA 3HHMA 1UELA 4GDKB 3M95A 2FCNA 3PLVA 5JHAA 3A1QB 3MJWA 3L17A 3P2BA 3VUYA 2NR2A 4ICVA 2KQ7A 3V61A 5CHWA 4F7ZA 3M3JA 2NCNA 2G45B 4NAWA 4LDTD 2JRIB 2KFKA 1D3ZA 4EFOA 1YIWA 3KUDB 3M62B 3Q3JA 3PTFC 3VH4B 4EEWA 2WX1A 4HPLB 2V1YA 3AU5A 3B0AA 2KOXA 1E90A 2BKRB 3PGEA 2JZZA 5EDSA 1LM8B 2MBHA 2C60A 2KDFB 3QQ8B 4FBJB 5DCNA 3H1UA 3AULA 3MHSD 2AL3A 4W9CA 3R66C 4M8NA 1I35A 4N9F4 1UBIA 2MQJA 4FJYA 1RAXA 2K6DB 1P3QU 3RD2A 2W9NA 3PZDA 4MM3A 4WQOB 1SGHA 4BKTA 3SHQA 3U7DA 1P9DU 3TL5A 5CHFA 4LJOB 3DPDA 1WFYA 3H7SA 3V60A 4EZJA 1V6EA 1ZW7A 1OQYA 1XD3B 3UQBA 5LXHA 3WAMA 3PRMB 2NBVB 2PE9A 2ZNVC 4BOSC 4MDKE 1F9JA 4DHJB 3N3KB 2XEWA 1E7UA 5BO4B 1NBFC 2KWUB 2DZJA 1UBQA 2WDTB 2LUEA 4TQ0A 2DHZA 2N4FA 1NI2A 3TBLD 1QZEA 1YX6B 5JZEB 5C1ZA 4BOZB 2KNBA 4JLCA 2D10A 1S3SG 3PHXB 3VTWA 4LJPB 2OOBB 3D32A 1UH6A 4KZCA 2G4DB 1ISNA 3CMMB 4W9IA 4WJQA 2MBEA 2ZPNA 2KX3A 2C7MB 3DBHI 2KK8A 2ZCCA 3V6EB 3QCAA 5D7GA 2HD5B 2M1MA 4KDLB 5AEKB 1TZ1A 3NHEB 2CU1A 3QC8B 4EOYA 1WGHA 4W9JA 3T8MA 3WANA 2IYDB 1L7YA 2L00B 3IVFA 4BKSD 1P1AA 1J0GA 2JZ3B 3PREA 3QHTA 5DPSA 3DVGY 4K7SA 2XBBC 4TV3A 4B9KA 4FA6A 2FAZA 5DPWA 4GIVA 1Z2MA 2HE7A 5JHBA 4W9GA 1NDDA 4I6LB 4GDLB 4II3B 2L05A 2CR5A 3LDZE 2LGDA 2KTRB 2LI5A 3H6NA 2I1KA 1V5TA 4X57B 3SDLC 2GBJA 3ECIA 2R2OA 3H7PA 3DCGA 3V62A 4HWIB 1KJTA 2CHWA 1UD7A 3UF8A 4ANVA 3PS6A 5AZFA 2M17A 2BYEA 2KMAA 2ZVOA 3DBLI 3BY4B 3VTVA 1T0YA 4YL8A 3UIPB 3JYUA 4WWPA 4AUQC 3MTNB 1E5WA 2BKFA 2KHWB 1K8RB 3L54A 3NS8A 1IPGA 3JVZX 2CS4A 2KJHB 3A4SC 4FJVB 4GDLA 2R2QA 1WYWB 3SD5A 2LASA 2KTRA 1KLVA 4B6WA 4DWFA 1HE8A 3APFA 4W9KA 2KJRA 4TQ1A 2MBBB 3NY5A 1KM7A 2KFKB 3WALA 3DDCB 3UGBB 2MX2A 4W9DA 2IZVB 2FUHB 2J0JA 4K81A 2KANA 1WJUA 2FCQA 5LXIB 1GJZA 3UIOB 2DENB 2L76A 1CMXB 5LLIA 2O6VD 2K25A 5D2MB 5D94A 2N9XA 4JQWC 1GNUA 2KC1A 2Y5BB 4BFRA 2UWQA 1YJ1A 4I6PA 2NPTA 3ZLZA 1WGDA 4M0WB 1VCBA 2OJRA 1V80A 3ZRFA 1FXTB 4FHKA 2DX5B 3APDA 4MH0E 1V9JA 2GBRA 2WX0A 2ZVNA 2IO0B 4HXDA 4E71A 4KDIC 3DBRI 2PE6B 4GMVA 4II2B 3U8ZA 4JGHB 2EMSA 1G6JA 4F8CB 2WYQA 2ZJDA 3ZUNA 3PLUA 3WAOA 5J18A 2JF5A 2RR9A 1WX9A 3CF6E 1WGRA 3HM3A 1WE6A 1ZKHA 2DAFA 2LZ6A 4PYUA 4HK2A 2BGFA 5DPTA 4NQLB 3S2AA 2IO3B 5C23A 4ANXA 3X23A 3AXCA 1WJ6A 4IM0A 2YLMA 4TKNA 3TMPB 2M4NA 4HDQA 4HCPB 2KMCA 2VRRB 4OVUA 4MSMB 1OEYJ 4MJSB 4XZ4A 3WIMA 5L83A 2ZZPB 5E6OA 3TIXA 3ZVVA 3DVNV 4ASWC 4EKUA 1TBEA 3W1SA 2KD0A 3VVWB 1WXVA 2JUOA 1JRUA 2V4LA 4FLHA 1V81A 4OVVA 5E6PA 1SE9A 1WMHA 5CX3A 3QX1A 2D3GA 5D6JB 4KIKA 4CYEA 1WZ0A 2KN5A 4K7UA 2YVCA 4FN2A 4MSQB 2KO3A 2LRUA 2AL6A 3OJ3A 3HK0A 4NQKE 1E7VA 2DYOA 3APCA 4IWQA 4NPNA 4RMAA 2BF8B 3ZTDA 3H7PB 2KZRA 4MJSA 1MG8A 4W9HA 1YQBA 2BWFA 3TCAA 2KDIA 5JH5C 2GBMA 3NZSA 1IP9A 3R7RA 2JT4B 4RM9A 2B3AA 3N30A 2MLBA 4DXAB 4FHJA 4BKGA 1A5RA 1P0RA 3PRZA 1Q1OA 4MGKE 1TGZB 5CHVC 3PPAA 4K1RB 3OAWA 2MBQA 1Q5WB 4LDTB 2MP2B 1WR1A 3VHTC 4KVGB 3JSVA 1WJ4A 2G4SA 1UZXB 2KJ6A 2KX0A 1EF5A 4XC2A 1WX7A 4ZRIA 3VDZA 5IAAC 3PHWB 3H9DA 2C7NB 4DHZB 4IC7B 4MEMA 4ANWA 2GBNA 2N7EA 4WWOA 3ZKJC 3L16A 1WY8A 3WAPA 1E8XA 4M8MA 4ZDVA 4BVUC 2HJ8A 3ONSA 2N1VA 1R4NI 3KYCD 4IW0A 3VUXA 2M0XA 1WF9A 4CHKA 2KFJA 2Z59B 4HVBA 4AWJA 2G3QB 4NJ7A 2MP2A 1J19A 3VXWA 3NZUA 2NPTB 4E3CA 3QA8A 2XK5A 3KYDD 2KTFA 3U30A 1V5OA 1WXAA 2NBUA 4BBNC 2LXAA 3N32A 4G3XB 3BINA 3IBEA 3RULA 3ML8A 3A9JB 3ML9A 3DOWA 3L13A 3DQVA 1KOTA 2PEAA 4GGQA 4HCNB 3GOEA 4GSWA 5G55A 4FADA 4DHZE 1WGGA 2N1WA 5CTRC 3ZNGC 2A5UA 1IYFA 4A3OA 1E8YA 2ASQA 3ALBA 3ZNID 4DHJD 2MRPA 4JL9A 1WX8A 2AEHA 2I1JA 4WWNA 2K8CA 2MW5A 3V6CB 2DYBA 2AWTA 2L0TA 2EKEC 1Y8RC 3UINB 4GB9A 4WJPA 4FJZA 2BWES 3DVNU 5DPRA 4B95A 3PRPB 4W9LA 4GN1A 2KQSA 2D2QA 1YX5B 2A4ZA 2KC2A 3A9JA 4HPMB 2FIDA 3KW5B 3PSEB 4GOCA 3L0WB 2DYMA 1H4RA 4PYZA 3RYTA 2AYOB 4F1SA 5FR6A 3ZTCA 1BT0A 1WJNA 2MBOA 3DBSA 4BBNF 3KUZA 4ZRJA 4G0NB 2K8HA 2FCMA 3QARA 3JW0X 3QJZA 2LJ5A 3R7QA 1WMHB 3RT3B 1WGYA 1C1YB 3VQIA 3QAQA 4KIKB 1S1QB 2BYVE 3AI5A 3ZDTA 1ZGUB 3A4RA 3K9OB 4IUMB 4ANUA 1LFDA 2MWSB 3CSFA 1SIFA 5E6NA 4BKSA 2RGFA 5J2RA 2KDBA 1AARA 2IBIB 2WWZA 4PS3A 3W1YA 3ENEA 3ZIMA 2KVRA 2J0KA 4J6IA 3DVGX 4HJKA 1RRBA 2LVPA 2MSED 1P98A 1EF1A 3VFKA 2ZEQA 2J0MA 3PV1A 5AZGA 5G2NA 2LVOA 3KVFB 4GDKA 3NOBA 4G11A 1WM3A 4ICUA 1Q0WB 4KZ0A 4MELA 1WM2A 4NY0A 3A1QA 2N9EB 2REXA 2JWZA 2EMTA 4JIOU 3JSVB 4TUUA 1WR6E 4GU2A 1H8CA 2UYZB 3ZNHB 1OTRB 2C9WB 2LD9A 4G50A 1U4AA 3VUWA 2Z0EB 2O6VB 3CSTA 4PS8A 2LXCA 4ZYNA 4A20A 1WZ3A 3HIZA 2JPHA 1L2NA 4IM3A 2JY6A 3ZO5B 3EHVA 1UGMA 3B08A 3L10B 3EECA 2RD0A 4WAAA 2MCNB 3GZNI 4KSKC 4KSLC 1RLFA 1XT9B 4XX5A 2RSUA 1WI0A 2ZNVB 4MGIE 3WA0A 4DBGA 4W9FA 5TR5A 3QK0A 2LRWA 1V2YA 3IHPC 5KHQA 3M63B 4FULA 3RZFA 3UQAA 3OJ4B 5J17A 1GC7A 4IWOA 2KWVB 2XK5B 1Z5SB 3RUIB 1OGWA 4AOFA 4NNJB 5IA7A 3I3TB 2MA9B 4AJWA 3AU4A 4P7IA 1RFAA 2IY0B 4HLEA 1LQBA 2NS5A 2O6VA 2PJHA 5GMVA 3KH0A 1PQSA 3ZW3A 5KHOA 3ZDMC 1M94A 1WE7A 1YD8U 4DDID 1TTNA 1V49A 2ZPYA 4HDOA 4IM2A 2C7HA 3VTUA 3R3MA 2LVQA 3EC8A 3ZNZB 2K39A 4A3PA 2PPHA 2N9PC 3VH3B 4NJ6A 4EUTA 4EZKA 4E74A 2K8BA 4IWPA 2IO1B 4K7WA 1EUVB 1E8ZA 3A9KB 3LJ3A 1LXDA 4MGZE 4CO7A 2KDEB 3A33B 4IG7B 4DK5A 2JRHA 2NVUI 2L8JA 2D11A 1E8WA 2JVCA 2GMIC 3ZRCA 1WIAA 4EZLA 2BPSA 2HTHA 3Q3FA 3SU8X 3RZWC 4MGYE 1WH3A 3X0WA 2GBKA 2KLCA 1WXMA 1C3TA 3IG3A 2Z0DB 1GUAB 1J8CA 2RPQA 3TJPA 2J7QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KWC A;  2KXJ A;  4WJO A;  2DZI A;  3VAW A;  3C0R B;  4W9E A;  2M8S A;  2ZCB A;  3PVL A;  3L08 A;  4AJY B;  2DAJ A;  2KLG A;  4LCD E;  4ZRK A;  1WRD B;  2O2V B;  3HM6 X;  5L95 C;  4KV2 A;  4DDG D;  3A9K A;  3B1L X;  3T9L A;  2LGX A;  5HKH A;  2QHO A;  4I6N B;  4AP4 C;  2D07 B;  2JXX A;  1GC6 A;  3OLM D;  5AZH A;  3W1S C;  1EO6 A;  2K6Q A;  2DZK A;  2V3S A;  2LGY A;  1X1M A;  2IO2 B;  2IY1 B;  2L3Z A;  2LWP A;  2KKC A;  4PS7 A;  2L7R A;  4NAW B;  3QWZ B;  2N7D A;  4RM8 A;  3KUC B;  3EFU A;  2C5L C;  2NBW B;  4GXB A;  3PT2 B;  1WXS A;  2K1F A;  4WJN A;  3QIJ A;  1OEY A;  3RCZ A;  2FCS A;  2DZM A;  3K9P B;  1XQQ A;  1V86 A;  2CKH B;  2CHX A;  2L0F A;  2CHZ A;  3O65 B;  2FNJ B;  3IFW B;  2GOW A;  4URK A;  1GG3 A;  1I42 A;  2O2V A;  2FIF A;  1R4M I;  1VD2 A;  2BYF A;  3HHM A;  1UEL A;  4GDK B;  3M95 A;  2FCN A;  3PLV A;  5JHA A;  3A1Q B;  3MJW A;  3L17 A;  3P2B A;  3VUY A;  2NR2 A;  4ICV A;  2KQ7 A;  3V61 A;  5CHW A;  4F7Z A;  3M3J A;  2NCN A;  2G45 B;  4NAW A;  4LDT D;  2JRI B;  2KFK A;  1D3Z A;  4EFO A;  1YIW A;  3KUD B;  3M62 B;  3Q3J A;  3PTF C;  3VH4 B;  4EEW A;  2WX1 A;  4HPL B;  2V1Y A;  3AU5 A;  3B0A A;  2KOX A;  1E90 A;  2BKR B;  3PGE A;  2JZZ A;  5EDS A;  1LM8 B;  2MBH A;  2C60 A;  2KDF B;  3QQ8 B;  4FBJ B;  5DCN A;  3H1U A;  3AUL A;  3MHS D;  2AL3 A;  4W9C A;  3R66 C;  4M8N A;  1I35 A;  4N9F 4;  1UBI A;  2MQJ A;  4FJY A;  1RAX A;  2K6D B;  1P3Q U;  3RD2 A;  2W9N A;  3PZD A;  4MM3 A;  4WQO B;  1SGH A;  4BKT A;  3SHQ A;  3U7D A;  1P9D U;  3TL5 A;  5CHF A;  4LJO B;  3DPD A;  1WFY A;  3H7S A;  3V60 A;  4EZJ A;  1V6E A;  1ZW7 A;  1OQY A;  1XD3 B;  3UQB A;  5LXH A;  3WAM A;  3PRM B;  2NBV B;  2PE9 A;  2ZNV C;  4BOS C;  4MDK E;  1F9J A;  4DHJ B;  3N3K B;  2XEW A;  1E7U A;  5BO4 B;  1NBF C;  2KWU B;  2DZJ A;  1UBQ A;  2WDT B;  2LUE A;  4TQ0 A;  2DHZ A;  2N4F A;  1NI2 A;  3TBL D;  1QZE A;  1YX6 B;  5JZE B;  5C1Z A;  4BOZ B;  2KNB A;  4JLC A;  2D10 A;  1S3S G;  3PHX B;  3VTW A;  4LJP B;  2OOB B;  3D32 A;  1UH6 A;  4KZC A;  2G4D B;  1ISN A;  3CMM B;  4W9I A;  4WJQ A;  2MBE A;  2ZPN A;  2KX3 A;  2C7M B;  3DBH I;  2KK8 A;  2ZCC A;  3V6E B;  3QCA A;  5D7G A;  2HD5 B;  2M1M A;  4KDL B;  5AEK B;  1TZ1 A;  3NHE B;  2CU1 A;  3QC8 B;  4EOY A;  1WGH A;  4W9J A;  3T8M A;  3WAN A;  2IYD B;  1L7Y A;  2L00 B;  3IVF A;  4BKS D;  1P1A A;  1J0G A;  2JZ3 B;  3PRE A;  3QHT A;  5DPS A;  3DVG Y;  4K7S A;  2XBB C;  4TV3 A;  4B9K A;  4FA6 A;  2FAZ A;  5DPW A;  4GIV A;  1Z2M A;  2HE7 A;  5JHB A;  4W9G A;  1NDD A;  4I6L B;  4GDL B;  4II3 B;  2L05 A;  2CR5 A;  3LDZ E;  2LGD A;  2KTR B;  2LI5 A;  3H6N A;  2I1K A;  1V5T A;  4X57 B;  3SDL C;  2GBJ A;  3ECI A;  2R2O A;  3H7P A;  3DCG A;  3V62 A;  4HWI B;  1KJT A;  2CHW A;  1UD7 A;  3UF8 A;  4ANV A;  3PS6 A;  5AZF A;  2M17 A;  2BYE A;  2KMA A;  2ZVO A;  3DBL I;  3BY4 B;  3VTV A;  1T0Y A;  4YL8 A;  3UIP B;  3JYU A;  4WWP A;  4AUQ C;  3MTN B;  1E5W A;  2BKF A;  2KHW B;  1K8R B;  3L54 A;  3NS8 A;  1IPG A;  3JVZ X;  2CS4 A;  2KJH B;  3A4S C;  4FJV B;  4GDL A;  2R2Q A;  1WYW B;  3SD5 A;  2LAS A;  2KTR A;  1KLV A;  4B6W A;  4DWF A;  1HE8 A;  3APF A;  4W9K A;  2KJR A;  4TQ1 A;  2MBB B;  3NY5 A;  1KM7 A;  2KFK B;  3WAL A;  3DDC B;  3UGB B;  2MX2 A;  4W9D A;  2IZV B;  2FUH B;  2J0J A;  4K81 A;  2KAN A;  1WJU A;  2FCQ A;  5LXI B;  1GJZ A;  3UIO B;  2DEN B;  2L76 A;  1CMX B;  5LLI A;  2O6V D;  2K25 A;  5D2M B;  5D94 A;  2N9X A;  4JQW C;  1GNU A;  2KC1 A;  2Y5B B;  4BFR A;  2UWQ A;  1YJ1 A;  4I6P A;  2NPT A;  3ZLZ A;  1WGD A;  4M0W B;  1VCB A;  2OJR A;  1V80 A;  3ZRF A;  1FXT B;  4FHK A;  2DX5 B;  3APD A;  4MH0 E;  1V9J A;  2GBR A;  2WX0 A;  2ZVN A;  2IO0 B;  4HXD A;  4E71 A;  4KDI C;  3DBR I;  2PE6 B;  4GMV A;  4II2 B;  3U8Z A;  4JGH B;  2EMS A;  1G6J A;  4F8C B;  2WYQ A;  2ZJD A;  3ZUN A;  3PLU A;  3WAO A;  5J18 A;  2JF5 A;  2RR9 A;  1WX9 A;  3CF6 E;  1WGR A;  3HM3 A;  1WE6 A;  1ZKH A;  2DAF A;  2LZ6 A;  4PYU A;  4HK2 A;  2BGF A;  5DPT A;  4NQL B;  3S2A A;  2IO3 B;  5C23 A;  4ANX A;  3X23 A;  3AXC A;  1WJ6 A;  4IM0 A;  2YLM A;  4TKN A;  3TMP B;  2M4N A;  4HDQ A;  4HCP B;  2KMC A;  2VRR B;  4OVU A;  4MSM B;  1OEY J;  4MJS B;  4XZ4 A;  3WIM A;  5L83 A;  2ZZP B;  5E6O A;  3TIX A;  3ZVV A;  3DVN V;  4ASW C;  4EKU A;  1TBE A;  3W1S A;  2KD0 A;  3VVW B;  1WXV A;  2JUO A;  1JRU A;  2V4L A;  4FLH A;  1V81 A;  4OVV A;  5E6P A;  1SE9 A;  1WMH A;  5CX3 A;  3QX1 A;  2D3G A;  5D6J B;  4KIK A;  4CYE A;  1WZ0 A;  2KN5 A;  4K7U A;  2YVC A;  4FN2 A;  4MSQ B;  2KO3 A;  2LRU A;  2AL6 A;  3OJ3 A;  3HK0 A;  4NQK E;  1E7V A;  2DYO A;  3APC A;  4IWQ A;  4NPN A;  4RMA A;  2BF8 B;  3ZTD A;  3H7P B;  2KZR A;  4MJS A;  1MG8 A;  4W9H A;  1YQB A;  2BWF A;  3TCA A;  2KDI A;  5JH5 C;  2GBM A;  3NZS A;  1IP9 A;  3R7R A;  2JT4 B;  4RM9 A;  2B3A A;  3N30 A;  2MLB A;  4DXA B;  4FHJ A;  4BKG A;  1A5R A;  1P0R A;  3PRZ A;  1Q1O A;  4MGK E;  1TGZ B;  5CHV C;  3PPA A;  4K1R B;  3OAW A;  2MBQ A;  1Q5W B;  4LDT B;  2MP2 B;  1WR1 A;  3VHT C;  4KVG B;  3JSV A;  1WJ4 A;  2G4S A;  1UZX B;  2KJ6 A;  2KX0 A;  1EF5 A;  4XC2 A;  1WX7 A;  4ZRI A;  3VDZ A;  5IAA C;  3PHW B;  3H9D A;  2C7N B;  4DHZ B;  4IC7 B;  4MEM A;  4ANW A;  2GBN A;  2N7E A;  4WWO A;  3ZKJ C;  3L16 A;  1WY8 A;  3WAP A;  1E8X A;  4M8M A;  4ZDV A;  4BVU C;  2HJ8 A;  3ONS A;  2N1V A;  1R4N I;  3KYC D;  4IW0 A;  3VUX A;  2M0X A;  1WF9 A;  4CHK A;  2KFJ A;  2Z59 B;  4HVB A;  4AWJ A;  2G3Q B;  4NJ7 A;  2MP2 A;  1J19 A;  3VXW A;  3NZU A;  2NPT B;  4E3C A;  3QA8 A;  2XK5 A;  3KYD D;  2KTF A;  3U30 A;  1V5O A;  1WXA A;  2NBU A;  4BBN C;  2LXA A;  3N32 A;  4G3X B;  3BIN A;  3IBE A;  3RUL A;  3ML8 A;  3A9J B;  3ML9 A;  3DOW A;  3L13 A;  3DQV A;  1KOT A;  2PEA A;  4GGQ A;  4HCN B;  3GOE A;  4GSW A;  5G55 A;  4FAD A;  4DHZ E;  1WGG A;  2N1W A;  5CTR C;  3ZNG C;  2A5U A;  1IYF A;  4A3O A;  1E8Y A;  2ASQ A;  3ALB A;  3ZNI D;  4DHJ D;  2MRP A;  4JL9 A;  1WX8 A;  2AEH A;  2I1J A;  4WWN A;  2K8C A;  2MW5 A;  3V6C B;  2DYB A;  2AWT A;  2L0T A;  2EKE C;  1Y8R C;  3UIN B;  4GB9 A;  4WJP A;  4FJZ A;  2BWE S;  3DVN U;  5DPR A;  4B95 A;  3PRP B;  4W9L A;  4GN1 A;  2KQS A;  2D2Q A;  1YX5 B;  2A4Z A;  2KC2 A;  3A9J A;  4HPM B;  2FID A;  3KW5 B;  3PSE B;  4GOC A;  3L0W B;  2DYM A;  1H4R A;  4PYZ A;  3RYT A;  2AYO B;  4F1S A;  5FR6 A;  3ZTC A;  1BT0 A;  1WJN A;  2MBO A;  3DBS A;  4BBN F;  3KUZ A;  4ZRJ A;  4G0N B;  2K8H A;  2FCM A;  3QAR A;  3JW0 X;  3QJZ A;  2LJ5 A;  3R7Q A;  1WMH B;  3RT3 B;  1WGY A;  1C1Y B;  3VQI A;  3QAQ A;  4KIK B;  1S1Q B;  2BYV E;  3AI5 A;  3ZDT A;  1ZGU B;  3A4R A;  3K9O B;  4IUM B;  4ANU A;  1LFD A;  2MWS B;  3CSF A;  1SIF A;  5E6N A;  4BKS A;  2RGF A;  5J2R A;  2KDB A;  1AAR A;  2IBI B;  2WWZ A;  4PS3 A;  3W1Y A;  3ENE A;  3ZIM A;  2KVR A;  2J0K A;  4J6I A;  3DVG X;  4HJK A;  1RRB A;  2LVP A;  2MSE D;  1P98 A;  1EF1 A;  3VFK A;  2ZEQ A;  2J0M A;  3PV1 A;  5AZG A;  5G2N A;  2LVO A;  3KVF B;  4GDK A;  3NOB A;  4G11 A;  1WM3 A;  4ICU A;  1Q0W B;  4KZ0 A;  4MEL A;  1WM2 A;  4NY0 A;  3A1Q A;  2N9E B;  2REX A;  2JWZ A;  2EMT A;  4JIO U;  3JSV B;  4TUU A;  1WR6 E;  4GU2 A;  1H8C A;  2UYZ B;  3ZNH B;  1OTR B;  2C9W B;  2LD9 A;  4G50 A;  1U4A A;  3VUW A;  2Z0E B;  2O6V B;  3CST A;  4PS8 A;  2LXC A;  4ZYN A;  4A20 A;  1WZ3 A;  3HIZ A;  2JPH A;  1L2N A;  4IM3 A;  2JY6 A;  3ZO5 B;  3EHV A;  1UGM A;  3B08 A;  3L10 B;  3EEC A;  2RD0 A;  4WAA A;  2MCN B;  3GZN I;  4KSK C;  4KSL C;  1RLF A;  1XT9 B;  4XX5 A;  2RSU A;  1WI0 A;  2ZNV B;  4MGI E;  3WA0 A;  4DBG A;  4W9F A;  5TR5 A;  3QK0 A;  2LRW A;  1V2Y A;  3IHP C;  5KHQ A;  3M63 B;  4FUL A;  3RZF A;  3UQA A;  3OJ4 B;  5J17 A;  1GC7 A;  4IWO A;  2KWV B;  2XK5 B;  1Z5S B;  3RUI B;  1OGW A;  4AOF A;  4NNJ B;  5IA7 A;  3I3T B;  2MA9 B;  4AJW A;  3AU4 A;  4P7I A;  1RFA A;  2IY0 B;  4HLE A;  1LQB A;  2NS5 A;  2O6V A;  2PJH A;  5GMV A;  3KH0 A;  1PQS A;  3ZW3 A;  5KHO A;  3ZDM C;  1M94 A;  1WE7 A;  1YD8 U;  4DDI D;  1TTN A;  1V49 A;  2ZPY A;  4HDO A;  4IM2 A;  2C7H A;  3VTU A;  3R3M A;  2LVQ A;  3EC8 A;  3ZNZ B;  2K39 A;  4A3P A;  2PPH A;  2N9P C;  3VH3 B;  4NJ6 A;  4EUT A;  4EZK A;  4E74 A;  2K8B A;  4IWP A;  2IO1 B;  4K7W A;  1EUV B;  1E8Z A;  3A9K B;  3LJ3 A;  1LXD A;  4MGZ E;  4CO7 A;  2KDE B;  3A33 B;  4IG7 B;  4DK5 A;  2JRH A;  2NVU I;  2L8J A;  2D11 A;  1E8W A;  2JVC A;  2GMI C;  3ZRC A;  1WIA A;  4EZL A;  2BPS A;  2HTH A;  3Q3F A;  3SU8 X;  3RZW C;  4MGY E;  1WH3 A;  3X0W A;  2GBK A;  2KLC A;  1WXM A;  1C3T A;  3IG3 A;  2Z0D B;  1GUA B;  1J8C A;  2RPQ A;  3TJP A;  2J7Q B; 
#chains in the Genus database with same CATH topology
 1FRR A;  4WJO A;  2DZI A;  3C0R B;  4OHJ A;  3PVL A;  3L08 A;  2DAJ A;  4LCD E;  4ZRK A;  3HM6 X;  5L95 C;  2INC C;  3SFD B;  3A9K A;  2W3R A;  2JXX A;  5AZH A;  2V3S A;  2DZK A;  2KVZ A;  4C4V A;  1X1M A;  2IO2 B;  3TEX A;  3KUC B;  3PT2 B;  1WXS A;  4WJN A;  3RCZ A;  1MJD A;  1N5X A;  1DOI A;  2L0F A;  1T0R C;  3R8B A;  2G1E A;  3AE7 B;  2FIF A;  1VD2 A;  2J52 A;  2BYF A;  1UEL A;  1KF6 B;  5JHA A;  3VUY A;  2NCN A;  3IAS 1;  3BK2 A;  3OG5 A;  3TSS A;  4EFO A;  1YIW A;  4KGT A;  3M62 B;  3VH4 B;  4EEW A;  1T6B X;  1VZ6 A;  4GLS C;  2X38 A;  5EDS A;  1LM8 B;  2W3S A;  5DCN A;  3ZXV A;  1L0X B;  1UUP A;  4C80 A;  3R66 C;  1P3Q U;  3AEG B;  4WQO B;  4JPS A;  1YOV B;  1T5X D;  2W82 A;  2UU7 A;  2ON8 A;  1V6E A;  1XD3 B;  2ZNV C;  4DXG A;  2JYE A;  4MDK E;  1F9J A;  1FCC C;  3N3K B;  2XEW A;  2KWU B;  2DZJ A;  2N4F A;  2M0A A;  1ZE3 D;  5C1Z A;  4BOZ B;  1PFD A;  1QOF A;  2D10 A;  3IXS A;  1TS5 A;  3PHX B;  2OOB B;  1UH6 A;  1CK1 A;  4RCO A;  1ISN A;  1YN5 A;  1JW9 D;  2MBE A;  1KLG D;  2ZCC A;  2WP9 B;  1LO5 D;  2JSV X;  4ZRP A;  3VRB B;  4XE0 A;  2WXF A;  2BB5 A;  1P1A A;  2OED A;  3QHT A;  4K7S A;  4FA6 A;  5DPW A;  4W9G A;  1L6U A;  2L05 A;  2IGG A;  3ECI A;  1FPY A;  2R2O A;  1CQV A;  2AQ3 B;  4HWI B;  2K22 A;  3UF8 A;  5IO9 A;  4ANV A;  1KFY B;  3AV8 A;  1T0Y A;  2WXQ A;  3UIP B;  3LYY A;  4WWP A;  2BS3 B;  3E9S A;  2PTL A;  2KHW B;  2WNM A;  3B2F A;  3L54 A;  2KJH B;  1WYW B;  1YJJ A;  4PT5 A;  3MP9 A;  1PYW D;  2KFK B;  5C2T B;  3DDC B;  3UGB B;  5LNK 1;  4W9D A;  2IZV B;  4K81 A;  2FCQ A;  4A90 A;  3UIO B;  3FC4 A;  2L76 A;  1V97 A;  2K25 A;  1YJI A;  2N9X A;  1GNU A;  2Y5B B;  2UWQ A;  4A9A A;  4MM3 B;  4C00 A;  3APD A;  2WX0 A;  2ZVN A;  4HXD A;  4GMV A;  4II2 B;  2KWD A;  2WYQ A;  1TKY A;  3PLU A;  1WGR A;  2DAF A;  2LZ6 A;  4HK2 A;  2BGF A;  4L2Y A;  4NQL B;  4ANX A;  3X23 A;  3Q8B A;  4IM0 A;  4HDQ A;  2KMC A;  1CZP A;  3P4P B;  4XZ4 A;  3WIM A;  3ZVV A;  1AN8 A;  4EKU A;  1NI3 A;  3BVG A;  3V05 A;  3VVW B;  3NUH B;  5FK9 C;  4OZC A;  1WXV A;  1SE9 A;  1HTQ A;  1C9F A;  1L4D B;  1I4G A;  3W5V B;  3P42 A;  1SSN A;  4NQK E;  4IWQ A;  2GRI A;  3GP7 A;  2KZR A;  2B76 B;  4W9H A;  1HEZ E;  3Q69 A;  3TCA A;  2QEJ C;  2RDH A;  5JH5 C;  3NZS A;  2WXJ A;  1STE A;  1WRI A;  1TGZ B;  4K1R B;  3GE8 C;  1XLQ A;  4LDT B;  2MP2 B;  1XF5 L;  1FCL A;  1WJ4 A;  2KJ6 A;  3I5J C;  5C3J B;  1MI0 A;  2C7N B;  4ANW A;  2GBN A;  1GB1 A;  1BML C;  3ZQ4 A;  2RMM A;  1D5Z C;  2M0X A;  4YSX B;  2LHD A;  4AWJ A;  3SR6 A;  2MP2 A;  4E3C A;  2NMQ A;  1JCK B;  2IGH A;  3RN9 C;  1V5O A;  3N32 A;  1RWS A;  3BYY B;  2CU3 A;  3RUL A;  3ML8 A;  3Q8A A;  1R4N B;  3L13 A;  3DQV A;  5HFY A;  4DHZ E;  2N1W A;  2K0P A;  2JXT A;  4DHJ D;  1KH0 A;  3FIL B;  3V6C B;  1NYR A;  2IDY A;  4HKZ E;  4ZHO A;  2BWE S;  1ACC A;  4R3D A;  2V0G A;  4GN1 A;  2KQS A;  4GOC A;  2WXK A;  3KW5 B;  4PYZ A;  3AE4 B;  1H4R A;  2AYO B;  1F52 A;  1AW7 A;  5FR6 A;  3ZTC A;  3DBS A;  2FCM A;  3QAR A;  3JW0 X;  3U4E G;  1WMH B;  1TS2 A;  2WXG A;  1C4A A;  3N1Z C;  5BYR A;  4M02 A;  1F77 A;  3FIL A;  3KQ4 A;  2YEP B;  1V1P A;  1ZGU B;  3K9O B;  4IUM B;  1SIF A;  4N6E B;  4BKS A;  5J2R A;  2KDB A;  1BUI C;  1TT5 B;  4JWU C;  4PS3 A;  3W1Y A;  2XNA C;  3DVG X;  3RI7 C;  1RRB A;  2MSE D;  2K5P A;  1FNW A;  3NOB A;  4KZ0 A;  2K9X A;  3C19 A;  4YSY B;  3A1Q A;  3NS1 A;  2N9E B;  2EMT A;  3JSV B;  4GU2 A;  1NEN B;  1ZOY B;  2LD9 A;  1U4A A;  4CQN A;  2O6V B;  1J7B A;  2WDV B;  2Y5C A;  3CST A;  1N5W A;  2JPH A;  3GZN I;  4KKJ A;  2WDQ B;  2FE8 A;  4ZOH C;  4DBG A;  5TR5 A;  4FUL A;  5J17 A;  1GC7 A;  3RUI B;  5IA7 A;  4AOF A;  5HG2 A;  2PKO A;  2R61 A;  4P7I A;  2IY0 B;  2NS5 A;  2O6V A;  3KH0 A;  5KHO A;  3ZDM C;  4DDI D;  1TTN A;  4IM2 A;  4XYC A;  3R3M A;  2FBW B;  3BII D;  2J4X A;  2PPH A;  1ESF A;  4EUT A;  1E8Z A;  2LUM A;  3LJ3 A;  1LXD A;  4CO7 A;  4USA A;  2KDE B;  3A33 B;  1OQR A;  3ZRC A;  1WIA A;  2BPS A;  3LB8 C;  2HTH A;  3X0W A;  2GBK A;  2KLC A;  3ONS A;  3TJP A;  5HKH A;  2KXJ A;  1R7S A;  3MFG A;  2BT6 A;  4W9E A;  1WRD B;  3AE8 B;  3T9L A;  3RNE C;  2IPK D;  2D07 B;  1FO4 A;  2L3Z A;  2KKC A;  2N7D A;  2C5L C;  2L83 A;  2NBW B;  1QOA A;  4S17 A;  3QIJ A;  1OEY A;  2DZM A;  1V86 A;  2Q5W D;  4WAF A;  1TYG B;  4XDC A;  1TKE A;  3EA6 A;  3MC8 A;  2GOW A;  4LTU A;  2LMC A;  4GDK B;  1R4M I;  1D6E C;  2FCN A;  3MJW A;  1QT9 A;  2NR2 A;  4ICV A;  3V61 A;  3Q3N C;  4J3O D;  4F7Z A;  3M3J A;  4US9 A;  1WSP A;  3KUD B;  3Q3J A;  1TY0 A;  2KOX A;  5H92 C;  1E90 A;  2BKR B;  1B9R A;  2KDF B;  4FBJ B;  1P7F A;  4IDI A;  3TEW A;  1UBI A;  1YQ4 B;  3Q8E A;  3BVZ A;  1RAX A;  4HEA 1;  3EFC A;  2G9H D;  3PZD A;  1E7P B;  4US8 A;  3SHQ A;  3U7D A;  1FNV A;  3TL5 A;  2HJ1 A;  4XGA B;  3UI3 A;  4HKQ A;  3H7S A;  3AE2 B;  3Q3M C;  1ZW7 A;  5FR3 A;  1OQY A;  3UQB A;  3WAM A;  1VR9 A;  5BO4 B;  1NBF C;  1F2R C;  4TQ0 A;  1NI2 A;  1WWT A;  1QZE A;  3TBL D;  2HTM E;  4JLC A;  1S3S G;  3CMM B;  3CWI A;  4WJQ A;  2KX3 A;  1L6V A;  2C7M B;  4RGM A;  5D7G A;  2AQ2 B;  4KDL B;  3Q6B A;  2MH7 A;  2CU1 A;  4EOY A;  1WGH A;  2AQ1 B;  2W54 A;  3T8M A;  1UGJ A;  3N9Y C;  1J0G A;  3VR9 B;  2LGS A;  4NAM A;  2Y5P A;  4B9K A;  2HE7 A;  1NDD A;  1FIQ A;  4II3 B;  4KKI A;  3H6N A;  2I1K A;  1V5T A;  3SDL C;  2RDG A;  3H7P A;  4C4V B;  4IOI E;  3V62 A;  1KJT A;  2BW2 A;  1UD7 A;  2CHW A;  2D3A A;  5AZF A;  1HA5 A;  2M17 A;  3DBL I;  4YL8 A;  4ZYS A;  3JYU A;  1JRO A;  2E3T A;  2V3P A;  2I38 A;  1SXT A;  2CS4 A;  3A4S C;  2R2Q A;  2D3B A;  2N7J A;  2FUG 1;  5TSS A;  1E10 A;  3GE3 C;  4W9K A;  4JWS C;  4YXD B;  2MX2 A;  3NVV A;  1TJE A;  1GJZ A;  1M4V A;  2DEN B;  2KQ4 X;  3ZGZ A;  5D2M B;  1EU3 A;  4JQW C;  4BFR A;  1EWC A;  2NPT A;  1HQR D;  3ZLZ A;  2HDE A;  5AUK A;  2OJR A;  3ZRF A;  3B2G A;  1SE4 A;  1V9J A;  3DBR I;  1NEK B;  4JGH B;  4C7Y A;  4F8C B;  5J18 A;  3HM3 A;  5D3D A;  1ZKH A;  4PYU A;  1V8C A;  3AEA B;  3S2A A;  2IO3 B;  3T3O A;  4TKN A;  3TMP B;  4A55 A;  4HCP B;  1TS4 A;  2ZZP B;  3TIX A;  3DVN V;  5E6J A;  3BYT B;  4AS1 A;  1JWM D;  4FLH A;  4OVV A;  1IBX B;  2D3G A;  3DWG C;  1FFU A;  4FN2 A;  4MSQ B;  3HUI A;  3ZTD A;  2BF8 B;  4WH4 A;  1KTK A;  2BB6 A;  2WXR A;  1C78 A;  3NVY A;  2KDI A;  3BWU D;  4FHJ A;  3ZXR A;  3MC0 B;  1Q1O A;  4MGK E;  3PPA A;  1IBX A;  3HVD A;  1WYG A;  4N58 A;  4TSS A;  1MPE A;  4KVG B;  3VHT C;  3AE5 B;  2G4S A;  3PZ8 A;  3VDZ A;  5IAA C;  3N1X C;  1J8C A;  4DHZ B;  1C4C A;  2Y3A A;  5BYS A;  4MEM A;  2LGI A;  2ZW0 A;  4LLG M;  3ZKJ C;  3L16 A;  1WY8 A;  2VH1 A;  1SJE D;  4IW0 A;  4CHK A;  2KFJ A;  1EU4 A;  2G3Q B;  4NJ7 A;  3AB5 A;  1J19 A;  1OFF A;  3VXW A;  1L5P A;  1VJK A;  4HPP A;  2XK5 A;  1WXA A;  1FXI A;  4BBN C;  1OQQ A;  2LXA A;  2BQQ A;  2VH2 A;  4P6V F;  3NVW A;  3IBE A;  3A9J B;  3VR8 B;  1IUE A;  1WGK A;  4GGQ A;  4HCN B;  4FAD A;  4NJC A;  1SE3 A;  1ZPS A;  1I4P A;  2XN9 C;  1E6E B;  2K8C A;  1NVI D;  4XDD A;  3DHH C;  5BMI A;  2MHJ A;  1A70 A;  4A6Q A;  2D2Q A;  1YX5 B;  5T8I A;  2KAJ A;  3A9J A;  4HPM B;  4ITK A;  4LNK A;  2RPV A;  1E9M A;  4G0N B;  1HZ5 A;  2MEK A;  3RT3 B;  2ZW1 A;  2BYV E;  3AI5 A;  3ZDT A;  1LFD A;  3CSF A;  2KAC A;  1KLU D;  1AAR A;  2WWZ A;  3ENE A;  3P4Q B;  3VRA B;  2KVR A;  2J0K A;  2WU5 B;  1P98 A;  1EF1 A;  5G2N A;  2EEL A;  2PVG C;  1PGA A;  1WM3 A;  3L4P A;  1Q0W B;  4OW0 A;  1EM7 A;  1WM2 A;  1N63 A;  2JWZ A;  1RFK A;  1QLB B;  3ZNH B;  1MFW A;  2C9W B;  1F2R I;  4G50 A;  1JWA D;  2BBC A;  2WHI A;  4ZYN A;  4A20 A;  3CIR B;  4YTP B;  3B08 A;  2MCN B;  4KSK C;  3BVM A;  5G5G A;  1RLF A;  2RSU A;  2ZNV B;  4MGI E;  1DOX A;  4W9F A;  1V2Y A;  3M63 B;  3NJT A;  1SE2 A;  1JAL A;  1Z5S B;  1OGW A;  3AEE B;  5D3I B;  4TMA B;  1RFA A;  3ZJV A;  5GMV A;  1PQS A;  3GZN B;  1YD8 U;  2ZPY A;  4HDO A;  4L1B A;  2N9P C;  2V3N A;  4NJ6 A;  4EZK A;  2K8B A;  4WIP A;  4MGZ E;  3AMZ A;  1TIF A;  2L8J A;  1E8W A;  2GMI C;  1VDV A;  3RNF C;  1WH3 A;  1WXM A;  1C3T A;  1GUA B;  4LNI A;  2J7Q B;  1JWB D;  1I7H A;  3VAW A;  4YSZ B;  2ZCB A;  3AE9 B;  4AJY B;  2KLG A;  3V3X A;  2O2V B;  1L4Z B;  4KV2 A;  4DDG D;  3B1L X;  2QHO A;  3SEB A;  1GC6 A;  1V1P B;  4NZL B;  3W1S C;  2LGY A;  2IY1 B;  3P1M A;  2CJO A;  4PS7 A;  2L7R A;  4NAW B;  4RM8 A;  2H88 B;  2K1F A;  1D5X C;  1C79 A;  2EKI A;  1I4Q A;  2CKH B;  2CHX A;  4S0R A;  2CHZ A;  3O65 B;  2FNJ B;  4URK A;  1GG3 A;  2O2V A;  2QIE B;  3A1Q B;  2KQ7 A;  5CHW A;  3N1Y C;  2G45 B;  4NAW A;  4LDT D;  1D3Z A;  2V4I B;  3PTF C;  3C8Y A;  2WX1 A;  4HPL B;  3B0A A;  2DLB A;  2SEB D;  3DHG C;  2MBH A;  2C60 A;  1R4M B;  1F0Z A;  4YTM B;  3AUL A;  3MHS D;  2AL3 A;  4W9C A;  4M8N A;  1I35 A;  4FJY A;  1TS3 A;  1SGH A;  4M0W A;  1YN4 A;  5CHF A;  3DPD A;  2KYW A;  2NBV B;  2PE9 A;  2JYT A;  1UBQ A;  1ENF A;  1YX6 B;  5JZE B;  1C77 A;  3WCQ A;  1FEH A;  1GPX A;  1ET6 A;  3VTW A;  3D32 A;  3I57 A;  4KZC A;  2G4D B;  4YT0 B;  3DBH I;  2KK8 A;  4Q2J A;  1MG4 A;  5AEK B;  4OZA A;  1N61 A;  3NHE B;  2KN4 A;  2IYD B;  3AEB B;  4C7Z A;  4BKS D;  3IT4 B;  2JZ3 B;  5FKA C;  3DVG Y;  4WWM A;  4A8X C;  4GIV A;  1Z2M A;  2CR5 A;  2INP E;  2LGD A;  2KTR B;  2LI5 A;  4X57 B;  1K50 A;  3AE3 B;  3DCG A;  3ZYY X;  5HHD G;  2LHE A;  3I9V 1;  2BYE A;  3VTV A;  3BY4 B;  3ZJU A;  1JWU D;  4LNO A;  1E5W A;  2QMT A;  2JX5 A;  4B0E A;  1GOZ A;  3FAH A;  3JVZ X;  1UNS A;  3R2I A;  2D3C A;  3SD5 A;  2KTR A;  1KLV A;  4B6W A;  4DWF A;  1HE8 A;  3APF A;  2PMV A;  3DBL B;  4TQ1 A;  4QAY A;  3E56 A;  1KM7 A;  3NY5 A;  3MHZ A;  2J0J A;  2KAN A;  2BTE A;  1WJU A;  4RF1 A;  5LXI B;  1ZXI A;  1CMX B;  5LLI A;  2O6V D;  1Q10 A;  2KC1 A;  1SJH D;  4RGN A;  2V9H A;  4I6P A;  2INN E;  1WGD A;  2JU6 X;  3DHI C;  3AM9 A;  4O1N A;  3EUB 2;  1V80 A;  1FXT B;  4N59 A;  5BYQ A;  2WS3 B;  1YMH E;  4BZA A;  2EMS A;  1AYF A;  1B1Z A;  2ZJD A;  2RR9 A;  1WX9 A;  1WE6 A;  5DPT A;  1D4B A;  1WJ6 A;  4B0M A;  2VRR B;  2YEP F;  1JQ4 A;  5L83 A;  3DBR B;  2CJN A;  5E6O A;  1MVK A;  3MJ5 A;  3W1S A;  1XCT L;  2KD0 A;  1FRD A;  1SB3 C;  2JUO A;  5CX3 A;  2DBY A;  1XCQ L;  3QX1 A;  2TSS A;  5D6J B;  3IT6 B;  4KIK A;  4CYE A;  1RYJ A;  1WZ0 A;  4K7U A;  2QCZ A;  1ZDX A;  4LNN A;  2KO3 A;  2LRU A;  2WQY B;  3OJ3 A;  1E7V A;  3APC A;  3P4S B;  3HVZ A;  5MPO A;  1DGJ A;  2L52 A;  3H7P B;  1MG8 A;  3NZ3 A;  1IP9 A;  2JT4 B;  4RM9 A;  2B3A A;  4BAX A;  1MHX A;  4DXA B;  4BKG A;  1A5R A;  1P0R A;  3PRZ A;  2BS2 B;  2I2Y A;  4LNF A;  5CHV C;  2N9K A;  3OAW A;  2MBQ A;  2WXP A;  3RMK C;  1LGR A;  1SBB B;  1T0S C;  2KX0 A;  1EF5 A;  2BVC A;  1WX7 A;  4ZRI A;  2RDB C;  2MJ3 A;  2N7E A;  4WWO A;  1T3Q A;  3WAP A;  1E8X A;  4M8M A;  4ZDV A;  2GLS A;  4BVU C;  2HJ8 A;  2N1V A;  4HJG E;  3VUX A;  1TKG A;  2Z59 B;  1FD6 A;  3NZU A;  2NPT B;  1F1H A;  3KYD D;  2KTF A;  3U30 A;  2NBU A;  5EE3 A;  2M56 B;  2QC8 A;  3RNB C;  2OHF A;  2PEA A;  1WGG A;  3ZNG C;  1IYF A;  1JRP A;  3ZNI D;  5G5H A;  2MRP A;  2AEH A;  1RM6 C;  2MW5 A;  2VZK B;  4GB9 A;  4FJZ A;  1FXA A;  2IGD A;  3PRP B;  4W9L A;  2A4Z A;  1KRH A;  2SAK A;  3PSE B;  2FID A;  2DYM A;  2MBO A;  3GS2 A;  3KUZ A;  2K8H A;  4REZ A;  1C1Y B;  3QAQ A;  1SEB D;  1S1Q B;  3W5U B;  2WGS A;  4ANU A;  2L32 A;  2W55 A;  2MWS B;  5E6N A;  5JXV A;  2RGF A;  3N20 C;  4OZB A;  4H2A A;  3AEC B;  2GI9 A;  3ZIM A;  3I63 C;  3KLS X;  4RFB A;  2LVP A;  1JML A;  2ZEQ A;  2J0M A;  3PV1 A;  5AZG A;  2LVO A;  4MEL A;  3TUO A;  1TY2 A;  5IN7 A;  3KWL A;  1H8C A;  2UYZ B;  4C56 C;  1OTR B;  3URY A;  5EE0 A;  2Z0E B;  3VUW A;  4PS8 A;  1N62 A;  2IJ0 A;  5GXG B;  5IOI A;  1L2N A;  5AUI A;  3L10 B;  1UGM A;  2NTS A;  2WDR B;  4WAA A;  1N60 A;  4KSL C;  1XT9 B;  1WI0 A;  3RPF C;  3WA0 A;  1L0V B;  3FKY A;  3QK0 A;  2WXH A;  3RZF A;  3UQA A;  3P63 A;  4IWO A;  2KWV B;  1I4R A;  2XK5 B;  3U52 E;  1QQR A;  4NNJ B;  1FM0 D;  2J53 A;  3IAM 1;  4HLE A;  3MC9 A;  1LQB A;  3PZ7 A;  2VZK D;  3J9C A;  1WE7 A;  1WXQ A;  3VTU A;  4FXC A;  2IO1 B;  2X8X X;  1XLP A;  1J7C A;  1XLO A;  1K51 A;  4IG7 B;  4DK5 A;  2JVC A;  2D11 A;  4EZL A;  2JZP A;  3Q8F A;  1GAQ B;  1FNU A;  1HTO A;  3NVZ A;  1L0Y B;  4JX1 C;  3IG3 A;  2KWC A;  2ACZ B;  2M8S A;  3ETR A;  2K3U A;  5IKC M;  2LGX A;  4K3C A;  2M19 A;  4I6N B;  4AP4 C;  3OLM D;  1UWM A;  3P4R B;  1EO6 A;  2K6Q A;  2LWP A;  3QWZ B;  3AEF B;  3SFE B;  1P7E A;  2QIL A;  3EFU A;  4GXB A;  4WUR A;  2FCS A;  4KX6 B;  3K9P B;  1XQQ A;  4OVZ A;  4WQM A;  3AH7 A;  3BZD B;  3IFW B;  4MT5 A;  1I42 A;  3HHM A;  3M95 A;  3PLV A;  3L17 A;  3P2B A;  4YTN B;  1UF0 A;  2KMM A;  2N0S B;  4HRS A;  2JRI B;  2KFK A;  1ROE A;  3W9C B;  2V1Y A;  3AU5 A;  5IP4 D;  3PGE A;  2JZZ A;  3QQ8 B;  1I4X A;  3H1U A;  4N9F 4;  2N9L A;  2MQJ A;  2WLB A;  2K6D B;  3RD2 A;  2W9N A;  4MM3 A;  4BKT A;  4AQ7 A;  1P9D U;  2PVO D;  4LJO B;  1WFY A;  4M00 A;  3V60 A;  1SIJ A;  4EZJ A;  1C4P A;  4PK1 A;  3TEZ A;  5LXH A;  3PRM B;  4DQO C;  3RFZ B;  2WXL A;  3DWM A;  4BOS C;  4DHJ B;  1E7U A;  1XO3 A;  2WDT B;  2LUE A;  1PGX A;  2DHZ A;  2WXI A;  2BYT A;  2KNB A;  2WU2 B;  4LJP B;  3RNG C;  4XWT A;  4W9I A;  5BMG A;  2ZPN A;  3V6E B;  2QJL A;  3QCA A;  2HD5 B;  2M1M A;  4RGO S;  1TZ1 A;  3QC8 B;  2QDF A;  4W9J A;  3WAN A;  4XWW A;  1L7Y A;  2L00 B;  3IVF A;  2KT7 A;  3R2T A;  3PRE A;  5DPS A;  3DBH B;  3PO0 A;  1D5M C;  1BXT A;  2XBB C;  4TV3 A;  2FAZ A;  3NG0 A;  5JHB A;  4I6L B;  4GDL B;  3LDZ E;  4YWG G;  1DOY A;  3RNC C;  3U2S C;  2GBJ A;  1J7A A;  3Q14 C;  1IGC A;  3PS6 A;  1PDX A;  2KMA A;  2ZVO A;  1I4H A;  1QOB A;  3OWE B;  2L1A A;  1ET9 A;  3AED B;  4AUQ C;  1XXG A;  3MTN B;  1ZP0 B;  4JE3 B;  5EE1 A;  2BKF A;  3ZJT A;  1K8R B;  3NS8 A;  1IPG A;  1TZO A;  4GDL A;  4FJV B;  3GB1 A;  2J42 A;  2LAS A;  4K3B A;  2LEK A;  2KJR A;  2MBB B;  3WAL A;  1PUT A;  2FUH B;  2QSD A;  2LFI A;  4MH8 A;  3EGR A;  3AE1 B;  5D94 A;  3ABV B;  3BK1 A;  4M01 A;  1YJ1 A;  5HI1 A;  5I4D A;  3U7Z A;  4M0W B;  1VCB A;  4FHK A;  2DX5 B;  4MH0 E;  3AN1 A;  2GBR A;  1FFV A;  3LXF A;  2IO0 B;  1CJE A;  2GB1 A;  4E71 A;  4KDI C;  1AWD A;  2PE6 B;  3U8Z A;  1G6J A;  3ZUN A;  3WAO A;  1JWS D;  2JF5 A;  3CF6 E;  1HZ6 A;  1XEE A;  5C23 A;  4LK0 M;  3AXC A;  2YLM A;  3NRZ A;  2JQR B;  2M4N A;  4OVU A;  4MSM B;  1OEY J;  4MJS B;  4RH6 A;  2PW9 A;  4MAC A;  4ASW C;  1TBE A;  1VLB A;  4P16 A;  1VRA B;  1JRU A;  2V4L A;  1V81 A;  5E6P A;  4DXF A;  1WMH A;  4ARC A;  3W2D A;  2D5G A;  2KN5 A;  2YVC A;  1QF6 A;  2AL6 A;  3HK0 A;  2DYO A;  4NPN A;  4RMA A;  4MJS A;  1FMA D;  2JWU A;  1YQB A;  2BWF A;  1ZXH A;  2GBM A;  3HRD D;  3R7R A;  2KDM A;  2DWQ A;  3N30 A;  2MLB A;  3RNA C;  4D2K A;  4P1B C;  1Q5W B;  2MJE A;  1WR1 A;  1QIL A;  3JSV A;  3Q8C A;  1UZX B;  3Q2A C;  4XC2 A;  3T3N A;  4RNA A;  2IND C;  3PHW B;  3H9D A;  4L23 A;  4IC7 B;  4ZRQ A;  1YN3 A;  4ARI A;  4HRO A;  1R4N I;  3KYC D;  4IKG A;  1N6Z A;  1WF9 A;  4HVB A;  4P1C C;  1XLN A;  3QA8 A;  2OJW A;  3Q3O C;  1YNT E;  4G3X B;  2ONQ A;  3BIN A;  1T0Q C;  3ML9 A;  3DOW A;  1VZ8 A;  2MJD A;  1KOT A;  2DNF A;  3GOE A;  4GSW A;  5G55 A;  2Z8L A;  5CTR C;  2A5U A;  2E6X A;  4A3O A;  1E8Y A;  2ASQ A;  3ALB A;  2BS4 B;  2WXM A;  1K52 A;  4JL9 A;  1WX8 A;  1GB4 A;  2I1J A;  4WWN A;  2H89 B;  2DYB A;  2AWT A;  2L0T A;  2EKE C;  1Y8R C;  3UIN B;  1NYQ A;  4WJP A;  3DVN U;  5DPR A;  4B95 A;  2KC2 A;  1MHH E;  4F1S A;  3L0W B;  4RGT A;  3RYT A;  4BBN F;  1BT0 A;  1WJN A;  4ZRJ A;  3QJZ A;  2LJ5 A;  3R7Q A;  3KWV A;  1IGD A;  1WGY A;  1PGB A;  5BMH A;  3VQI A;  4KIK B;  1UWX A;  1Y56 A;  3A4R A;  4KGR A;  1DYQ A;  2IBI B;  5H8Y E;  2WXO A;  3O13 A;  4RF0 A;  4J6I A;  4HJK A;  3VFK A;  3KVF B;  4GDK A;  4G11 A;  1E0Z A;  4ICU A;  4NY0 A;  2REX A;  4JIO U;  4TUU A;  1C76 A;  1WR6 E;  1HXY D;  2ICI A;  2LXC A;  4EE2 A;  1WZ3 A;  3HIZ A;  4ZHP A;  2NTT A;  5EE9 A;  4IM3 A;  2JY6 A;  3ZO5 B;  3EHV A;  3EEC A;  2RD0 A;  3B9J A;  4UDU C;  3AE6 B;  1ZUD 2;  4XX5 A;  1ZDV A;  4KGS A;  1V1O A;  2LRW A;  3IHP C;  5KHQ A;  3TEY A;  1EWY C;  3OJ4 B;  3I3T B;  2MA9 B;  2LJI A;  4ACF A;  4AJW A;  3AU4 A;  2WXN A;  2PJH A;  3ZW3 A;  1M94 A;  1V49 A;  1YQ3 B;  1SF0 A;  2C7H A;  2LVQ A;  3EC8 A;  3ZNZ B;  2K39 A;  4A3P A;  3VH3 B;  4E74 A;  4IWP A;  4K7W A;  1EUV B;  3A9K B;  1K53 A;  3H8H A;  2JRH A;  2NVU I;  3Q3F A;  3SU8 X;  1VZ7 A;  3RZW C;  4MGY E;  2AX5 A;  1QKZ A;  1QOG A;  2Z0D B;  2PLP A;  2PIA A;  2RPQ A; 
#chains in the Genus database with same CATH homology
 2KWC A;  2KXJ A;  4WJO A;  2DZI A;  3VAW A;  3C0R B;  4W9E A;  2M8S A;  2ZCB A;  3PVL A;  3L08 A;  4AJY B;  2DAJ A;  2KLG A;  4LCD E;  4ZRK A;  1WRD B;  2O2V B;  3HM6 X;  5L95 C;  4KV2 A;  4DDG D;  3A9K A;  3B1L X;  3T9L A;  2LGX A;  5HKH A;  2QHO A;  4I6N B;  4AP4 C;  2D07 B;  2JXX A;  1GC6 A;  3OLM D;  5AZH A;  3W1S C;  1EO6 A;  2K6Q A;  2DZK A;  2V3S A;  2LGY A;  1X1M A;  2IO2 B;  2IY1 B;  2L3Z A;  2LWP A;  2KKC A;  4PS7 A;  2L7R A;  4NAW B;  3QWZ B;  2N7D A;  4RM8 A;  3KUC B;  3EFU A;  2C5L C;  2NBW B;  4GXB A;  3PT2 B;  1WXS A;  2K1F A;  4WJN A;  3QIJ A;  1OEY A;  3RCZ A;  2FCS A;  2DZM A;  3K9P B;  1XQQ A;  1V86 A;  2CKH B;  2CHX A;  2L0F A;  2CHZ A;  3O65 B;  2FNJ B;  3IFW B;  2GOW A;  4URK A;  1GG3 A;  1I42 A;  2O2V A;  2FIF A;  1R4M I;  1VD2 A;  2BYF A;  3HHM A;  1UEL A;  4GDK B;  3M95 A;  2FCN A;  3PLV A;  5JHA A;  3A1Q B;  3MJW A;  3L17 A;  3P2B A;  3VUY A;  2NR2 A;  4ICV A;  2KQ7 A;  3V61 A;  5CHW A;  4F7Z A;  3M3J A;  2NCN A;  2G45 B;  4NAW A;  4LDT D;  2JRI B;  2KFK A;  1D3Z A;  4EFO A;  1YIW A;  3KUD B;  3M62 B;  3Q3J A;  3PTF C;  3VH4 B;  4EEW A;  2WX1 A;  4HPL B;  2V1Y A;  3AU5 A;  3B0A A;  2KOX A;  1E90 A;  2BKR B;  3PGE A;  2JZZ A;  5EDS A;  1LM8 B;  2MBH A;  2C60 A;  2KDF B;  3QQ8 B;  4FBJ B;  5DCN A;  3H1U A;  3AUL A;  3MHS D;  2AL3 A;  4W9C A;  3R66 C;  4M8N A;  1I35 A;  4N9F 4;  1UBI A;  2MQJ A;  4FJY A;  1RAX A;  2K6D B;  1P3Q U;  3RD2 A;  2W9N A;  3PZD A;  4MM3 A;  4WQO B;  1SGH A;  4BKT A;  3SHQ A;  3U7D A;  1P9D U;  3TL5 A;  5CHF A;  4LJO B;  3DPD A;  1WFY A;  3H7S A;  3V60 A;  4EZJ A;  1V6E A;  1ZW7 A;  1OQY A;  1XD3 B;  3UQB A;  5LXH A;  3WAM A;  3PRM B;  2NBV B;  2PE9 A;  2ZNV C;  4BOS C;  4MDK E;  1F9J A;  4DHJ B;  3N3K B;  2XEW A;  1E7U A;  5BO4 B;  1NBF C;  2KWU B;  2DZJ A;  1UBQ A;  2WDT B;  2LUE A;  4TQ0 A;  2DHZ A;  2N4F A;  1NI2 A;  3TBL D;  1QZE A;  1YX6 B;  5JZE B;  5C1Z A;  4BOZ B;  2KNB A;  4JLC A;  2D10 A;  1S3S G;  3PHX B;  3VTW A;  4LJP B;  2OOB B;  3D32 A;  1UH6 A;  4KZC A;  2G4D B;  1ISN A;  3CMM B;  4W9I A;  4WJQ A;  2MBE A;  2ZPN A;  2KX3 A;  2C7M B;  3DBH I;  2KK8 A;  2ZCC A;  3V6E B;  3QCA A;  5D7G A;  2HD5 B;  2M1M A;  4KDL B;  5AEK B;  1TZ1 A;  3NHE B;  2CU1 A;  3QC8 B;  4EOY A;  1WGH A;  4W9J A;  3T8M A;  3WAN A;  2IYD B;  1L7Y A;  2L00 B;  3IVF A;  4BKS D;  1P1A A;  1J0G A;  2JZ3 B;  3PRE A;  3QHT A;  5DPS A;  3DVG Y;  4K7S A;  2XBB C;  4TV3 A;  4B9K A;  4FA6 A;  2FAZ A;  5DPW A;  4GIV A;  1Z2M A;  2HE7 A;  5JHB A;  4W9G A;  1NDD A;  4I6L B;  4GDL B;  4II3 B;  2L05 A;  2CR5 A;  3LDZ E;  2LGD A;  2KTR B;  2LI5 A;  3H6N A;  2I1K A;  1V5T A;  4X57 B;  3SDL C;  2GBJ A;  3ECI A;  2R2O A;  3H7P A;  3DCG A;  3V62 A;  4HWI B;  1KJT A;  2CHW A;  1UD7 A;  3UF8 A;  4ANV A;  3PS6 A;  5AZF A;  2M17 A;  2BYE A;  2KMA A;  2ZVO A;  3DBL I;  3BY4 B;  3VTV A;  1T0Y A;  4YL8 A;  3UIP B;  3JYU A;  4WWP A;  4AUQ C;  3MTN B;  1E5W A;  2BKF A;  2KHW B;  1K8R B;  3L54 A;  3NS8 A;  1IPG A;  3JVZ X;  2CS4 A;  2KJH B;  3A4S C;  4FJV B;  4GDL A;  2R2Q A;  1WYW B;  3SD5 A;  2LAS A;  2KTR A;  1KLV A;  4B6W A;  4DWF A;  1HE8 A;  3APF A;  4W9K A;  2KJR A;  4TQ1 A;  2MBB B;  3NY5 A;  1KM7 A;  2KFK B;  3WAL A;  3DDC B;  3UGB B;  2MX2 A;  4W9D A;  2IZV B;  2FUH B;  2J0J A;  4K81 A;  2KAN A;  1WJU A;  2FCQ A;  5LXI B;  1GJZ A;  3UIO B;  2DEN B;  2L76 A;  1CMX B;  5LLI A;  2O6V D;  2K25 A;  5D2M B;  5D94 A;  2N9X A;  4JQW C;  1GNU A;  2KC1 A;  2Y5B B;  4BFR A;  2UWQ A;  1YJ1 A;  4I6P A;  2NPT A;  3ZLZ A;  1WGD A;  4M0W B;  1VCB A;  2OJR A;  1V80 A;  3ZRF A;  1FXT B;  4FHK A;  2DX5 B;  3APD A;  4MH0 E;  1V9J A;  2GBR A;  2WX0 A;  2ZVN A;  2IO0 B;  4HXD A;  4E71 A;  4KDI C;  3DBR I;  2PE6 B;  4GMV A;  4II2 B;  3U8Z A;  4JGH B;  2EMS A;  1G6J A;  4F8C B;  2WYQ A;  2ZJD A;  3ZUN A;  3PLU A;  3WAO A;  5J18 A;  2JF5 A;  2RR9 A;  1WX9 A;  3CF6 E;  1WGR A;  3HM3 A;  1WE6 A;  1ZKH A;  2DAF A;  2LZ6 A;  4PYU A;  4HK2 A;  2BGF A;  5DPT A;  4NQL B;  3S2A A;  2IO3 B;  5C23 A;  4ANX A;  3X23 A;  3AXC A;  1WJ6 A;  4IM0 A;  2YLM A;  4TKN A;  3TMP B;  2M4N A;  4HDQ A;  4HCP B;  2KMC A;  2VRR B;  4OVU A;  4MSM B;  1OEY J;  4MJS B;  4XZ4 A;  3WIM A;  5L83 A;  2ZZP B;  5E6O A;  3TIX A;  3ZVV A;  3DVN V;  4ASW C;  4EKU A;  1TBE A;  3W1S A;  2KD0 A;  3VVW B;  1WXV A;  2JUO A;  1JRU A;  2V4L A;  4FLH A;  1V81 A;  4OVV A;  5E6P A;  1SE9 A;  1WMH A;  5CX3 A;  3QX1 A;  2D3G A;  5D6J B;  4KIK A;  4CYE A;  1WZ0 A;  2KN5 A;  4K7U A;  2YVC A;  4FN2 A;  4MSQ B;  2KO3 A;  2LRU A;  2AL6 A;  3OJ3 A;  3HK0 A;  4NQK E;  1E7V A;  2DYO A;  3APC A;  4IWQ A;  4NPN A;  4RMA A;  2BF8 B;  3ZTD A;  3H7P B;  2KZR A;  4MJS A;  1MG8 A;  4W9H A;  1YQB A;  2BWF A;  3TCA A;  2KDI A;  5JH5 C;  2GBM A;  3NZS A;  1IP9 A;  3R7R A;  2JT4 B;  4RM9 A;  2B3A A;  3N30 A;  2MLB A;  4DXA B;  4FHJ A;  4BKG A;  1A5R A;  1P0R A;  3PRZ A;  1Q1O A;  4MGK E;  1TGZ B;  5CHV C;  3PPA A;  4K1R B;  3OAW A;  2MBQ A;  1Q5W B;  4LDT B;  2MP2 B;  1WR1 A;  3VHT C;  4KVG B;  3JSV A;  1WJ4 A;  2G4S A;  1UZX B;  2KJ6 A;  2KX0 A;  1EF5 A;  4XC2 A;  1WX7 A;  4ZRI A;  3VDZ A;  5IAA C;  3PHW B;  3H9D A;  2C7N B;  4DHZ B;  4IC7 B;  4MEM A;  4ANW A;  2GBN A;  2N7E A;  4WWO A;  3ZKJ C;  3L16 A;  1WY8 A;  3WAP A;  1E8X A;  4M8M A;  4ZDV A;  4BVU C;  2HJ8 A;  3ONS A;  2N1V A;  1R4N I;  3KYC D;  4IW0 A;  3VUX A;  2M0X A;  1WF9 A;  4CHK A;  2KFJ A;  2Z59 B;  4HVB A;  4AWJ A;  2G3Q B;  4NJ7 A;  2MP2 A;  1J19 A;  3VXW A;  3NZU A;  2NPT B;  4E3C A;  3QA8 A;  2XK5 A;  3KYD D;  2KTF A;  3U30 A;  1V5O A;  1WXA A;  2NBU A;  4BBN C;  2LXA A;  3N32 A;  4G3X B;  3BIN A;  3IBE A;  3RUL A;  3ML8 A;  3A9J B;  3ML9 A;  3DOW A;  3L13 A;  3DQV A;  1KOT A;  2PEA A;  4GGQ A;  4HCN B;  3GOE A;  4GSW A;  5G55 A;  4FAD A;  4DHZ E;  1WGG A;  2N1W A;  5CTR C;  3ZNG C;  2A5U A;  1IYF A;  4A3O A;  1E8Y A;  2ASQ A;  3ALB A;  3ZNI D;  4DHJ D;  2MRP A;  4JL9 A;  1WX8 A;  2AEH A;  2I1J A;  4WWN A;  2K8C A;  2MW5 A;  3V6C B;  2DYB A;  2AWT A;  2L0T A;  2EKE C;  1Y8R C;  3UIN B;  4GB9 A;  4WJP A;  4FJZ A;  2BWE S;  3DVN U;  5DPR A;  4B95 A;  3PRP B;  4W9L A;  4GN1 A;  2KQS A;  2D2Q A;  1YX5 B;  2A4Z A;  2KC2 A;  3A9J A;  4HPM B;  2FID A;  3KW5 B;  3PSE B;  4GOC A;  3L0W B;  2DYM A;  1H4R A;  4PYZ A;  3RYT A;  2AYO B;  4F1S A;  5FR6 A;  3ZTC A;  1BT0 A;  1WJN A;  2MBO A;  3DBS A;  4BBN F;  3KUZ A;  4ZRJ A;  4G0N B;  2K8H A;  2FCM A;  3QAR A;  3JW0 X;  3QJZ A;  2LJ5 A;  3R7Q A;  1WMH B;  3RT3 B;  1WGY A;  1C1Y B;  3VQI A;  3QAQ A;  4KIK B;  1S1Q B;  2BYV E;  3AI5 A;  3ZDT A;  1ZGU B;  3A4R A;  3K9O B;  4IUM B;  4ANU A;  1LFD A;  2MWS B;  3CSF A;  1SIF A;  5E6N A;  4BKS A;  2RGF A;  5J2R A;  2KDB A;  1AAR A;  2IBI B;  2WWZ A;  4PS3 A;  3W1Y A;  3ENE A;  3ZIM A;  2KVR A;  2J0K A;  4J6I A;  3DVG X;  4HJK A;  1RRB A;  2LVP A;  2MSE D;  1P98 A;  1EF1 A;  3VFK A;  2ZEQ A;  2J0M A;  3PV1 A;  5AZG A;  5G2N A;  2LVO A;  3KVF B;  4GDK A;  3NOB A;  4G11 A;  1WM3 A;  4ICU A;  1Q0W B;  4KZ0 A;  4MEL A;  1WM2 A;  4NY0 A;  3A1Q A;  2N9E B;  2REX A;  2JWZ A;  2EMT A;  4JIO U;  3JSV B;  4TUU A;  1WR6 E;  4GU2 A;  1H8C A;  2UYZ B;  3ZNH B;  1OTR B;  2C9W B;  2LD9 A;  4G50 A;  1U4A A;  3VUW A;  2Z0E B;  2O6V B;  3CST A;  4PS8 A;  2LXC A;  4ZYN A;  4A20 A;  1WZ3 A;  3HIZ A;  2JPH A;  1L2N A;  4IM3 A;  2JY6 A;  3ZO5 B;  3EHV A;  1UGM A;  3B08 A;  3L10 B;  3EEC A;  2RD0 A;  4WAA A;  2MCN B;  3GZN I;  4KSK C;  4KSL C;  1RLF A;  1XT9 B;  4XX5 A;  2RSU A;  1WI0 A;  2ZNV B;  4MGI E;  3WA0 A;  4DBG A;  4W9F A;  5TR5 A;  3QK0 A;  2LRW A;  1V2Y A;  3IHP C;  5KHQ A;  3M63 B;  4FUL A;  3RZF A;  3UQA A;  3OJ4 B;  5J17 A;  1GC7 A;  4IWO A;  2KWV B;  2XK5 B;  1Z5S B;  3RUI B;  1OGW A;  4AOF A;  4NNJ B;  5IA7 A;  3I3T B;  2MA9 B;  4AJW A;  3AU4 A;  4P7I A;  1RFA A;  2IY0 B;  4HLE A;  1LQB A;  2NS5 A;  2O6V A;  2PJH A;  5GMV A;  3KH0 A;  1PQS A;  3ZW3 A;  5KHO A;  3ZDM C;  1M94 A;  1WE7 A;  1YD8 U;  4DDI D;  1TTN A;  1V49 A;  2ZPY A;  4HDO A;  4IM2 A;  2C7H A;  3VTU A;  3R3M A;  2LVQ A;  3EC8 A;  3ZNZ B;  2K39 A;  4A3P A;  2PPH A;  2N9P C;  3VH3 B;  4NJ6 A;  4EUT A;  4EZK A;  4E74 A;  2K8B A;  4IWP A;  2IO1 B;  4K7W A;  1EUV B;  1E8Z A;  3A9K B;  3LJ3 A;  1LXD A;  4MGZ E;  4CO7 A;  2KDE B;  3A33 B;  4IG7 B;  4DK5 A;  2JRH A;  2NVU I;  2L8J A;  2D11 A;  1E8W A;  2JVC A;  2GMI C;  3ZRC A;  1WIA A;  4EZL A;  2BPS A;  2HTH A;  3Q3F A;  3SU8 X;  3RZW C;  4MGY E;  1WH3 A;  3X0W A;  2GBK A;  2KLC A;  1WXM A;  1C3T A;  3IG3 A;  2Z0D B;  1GUA B;  1J8C A;  2RPQ A;  3TJP A;  2J7Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...