2JV2A

Solution structure of the n-terminal domain of ph1500
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
76
structure length
76
Chain Sequence
EGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLVTHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Solution Structure of Ph1500-N
rcsb
source organism Pyrococcus horikoshii
molecule tags Unknown function
molecule keywords Putative uncharacterized protein PH1500
total genus 12
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2jv2A00
5B6CA 1CZ4A 1S3SA 1QDNA 1CR5A 3HU3A 2PJHB 3TIWA 4KDLA 4KDIA 5DYIA 3QWZA 5FTJA 5DYGA 4KODA 5FTMA 3QC8A 1R7RA 5FTLA 3CF2A 2YUJA 5C1BA 3QQ7A 5EPPA 5C18A 3HU1A 2JV2A 1ZC1A 1QCSA 3HU2A 4KO8A 4KLNA 5FTKA 5GLFA 3QQ8A 5FTNA 1E32A 1CZ5A 1WLFA 4RV0A
chains in the Genus database with same CATH superfamily
5B6CA 2Q19X 2YVLA 5EQJB 4KDLA 2GF7A 2GFAA 3ZJUA 1R7RA 3QC8A 5FTLA 4UC4A 5C1BA 2MM0A 2KY9A 4AS1A 3HU1A 4CQNA 2JV2A 2QQSA 4KLNA 4FIBA 2PWYA 1CZ5A 3FPUA 1S3SA 4AQ7A 4KDIA 5DYIA 2MM2A 5FTJA 5ERGB 2YUJA 2Q1DX 3QQ7A 5C18A 5D6XA 1ZC1A 1QCSA 3QQ8A 5D6WA 1E32A 5D6YA 1CZ4A 1QDNA 3BQBA 5CCXA 3QWZA 5FTMA 3LGAA 2Q18X 3ZJVA 1O54A 3LHDA 5CCBA 3FPRA 5GLFA 5EPPA 4ARIA 1WLFA 1CR5A 3HU3A 2PJHB 3TIWA 2Q1CX 2LW6A 5DYGA 4KODA 3CF2A 3FPTA 2QQRA 1I9GA 2XDPA 5CD1A 2Q1AX 3HU2A 3MB5A 5FTKA 5FTNA 3ZJTA 4ARCA 4KO8A 3ZGZA 2B25A 4RV0A
chains in the Genus database with same CATH topology
5B6CA 2Q19X 2YVLA 5EQJB 4KDLA 2GF7A 2GFAA 3ZJUA 1R7RA 3QC8A 5FTLA 4UC4A 5C1BA 2MM0A 2KY9A 4AS1A 3HU1A 4CQNA 2JV2A 2QQSA 4KLNA 4FIBA 2PWYA 1CZ5A 3FPUA 1S3SA 4AQ7A 4KDIA 5DYIA 2MM2A 5FTJA 5ERGB 2YUJA 2Q1DX 3QQ7A 5C18A 5D6XA 1ZC1A 1QCSA 3QQ8A 5D6WA 1E32A 5D6YA 1CZ4A 1QDNA 3BQBA 5CCXA 3QWZA 5FTMA 3LGAA 2Q18X 3ZJVA 1O54A 3LHDA 5CCBA 3FPRA 5GLFA 5EPPA 4ARIA 1WLFA 1CR5A 3HU3A 2PJHB 3TIWA 2Q1CX 2LW6A 5DYGA 4KODA 3CF2A 3FPTA 2QQRA 1I9GA 2XDPA 5CD1A 2Q1AX 3HU2A 3MB5A 5FTKA 5FTNA 3ZJTA 4ARCA 4KO8A 3ZGZA 2B25A 4RV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B6C A;  1CZ4 A;  1S3S A;  1QDN A;  1CR5 A;  3HU3 A;  2PJH B;  3TIW A;  4KDL A;  4KDI A;  5DYI A;  3QWZ A;  5FTJ A;  5DYG A;  4KOD A;  5FTM A;  3QC8 A;  1R7R A;  5FTL A;  3CF2 A;  2YUJ A;  5C1B A;  3QQ7 A;  5EPP A;  5C18 A;  3HU1 A;  2JV2 A;  1ZC1 A;  1QCS A;  3HU2 A;  4KO8 A;  4KLN A;  5FTK A;  5GLF A;  3QQ8 A;  5FTN A;  1E32 A;  1CZ5 A;  1WLF A;  4RV0 A; 
#chains in the Genus database with same CATH topology
 5B6C A;  2Q19 X;  2YVL A;  5EQJ B;  4KDL A;  2GF7 A;  2GFA A;  3ZJU A;  1R7R A;  3QC8 A;  5FTL A;  4UC4 A;  5C1B A;  2MM0 A;  2KY9 A;  4AS1 A;  3HU1 A;  4CQN A;  2JV2 A;  2QQS A;  4KLN A;  4FIB A;  2PWY A;  1CZ5 A;  3FPU A;  1S3S A;  4AQ7 A;  4KDI A;  5DYI A;  2MM2 A;  5FTJ A;  5ERG B;  2YUJ A;  2Q1D X;  3QQ7 A;  5C18 A;  5D6X A;  1ZC1 A;  1QCS A;  3QQ8 A;  5D6W A;  1E32 A;  5D6Y A;  1CZ4 A;  1QDN A;  3BQB A;  5CCX A;  3QWZ A;  5FTM A;  3LGA A;  2Q18 X;  3ZJV A;  1O54 A;  3LHD A;  5CCB A;  3FPR A;  5GLF A;  5EPP A;  4ARI A;  1WLF A;  1CR5 A;  3HU3 A;  2PJH B;  3TIW A;  2Q1C X;  2LW6 A;  5DYG A;  4KOD A;  3CF2 A;  3FPT A;  2QQR A;  1I9G A;  2XDP A;  5CD1 A;  2Q1A X;  3HU2 A;  3MB5 A;  5FTK A;  5FTN A;  3ZJT A;  4ARC A;  4KO8 A;  3ZGZ A;  2B25 A;  4RV0 A; 
#chains in the Genus database with same CATH homology
 5B6C A;  2Q19 X;  2YVL A;  5EQJ B;  4KDL A;  2GF7 A;  2GFA A;  3ZJU A;  1R7R A;  3QC8 A;  5FTL A;  4UC4 A;  5C1B A;  2MM0 A;  2KY9 A;  4AS1 A;  3HU1 A;  4CQN A;  2JV2 A;  2QQS A;  4KLN A;  4FIB A;  2PWY A;  1CZ5 A;  3FPU A;  1S3S A;  4AQ7 A;  4KDI A;  5DYI A;  2MM2 A;  5FTJ A;  5ERG B;  2YUJ A;  2Q1D X;  3QQ7 A;  5C18 A;  5D6X A;  1ZC1 A;  1QCS A;  3QQ8 A;  5D6W A;  1E32 A;  5D6Y A;  1CZ4 A;  1QDN A;  3BQB A;  5CCX A;  3QWZ A;  5FTM A;  3LGA A;  2Q18 X;  3ZJV A;  1O54 A;  3LHD A;  5CCB A;  3FPR A;  5GLF A;  5EPP A;  4ARI A;  1WLF A;  1CR5 A;  3HU3 A;  2PJH B;  3TIW A;  2Q1C X;  2LW6 A;  5DYG A;  4KOD A;  3CF2 A;  3FPT A;  2QQR A;  1I9G A;  2XDP A;  5CD1 A;  2Q1A X;  3HU2 A;  3MB5 A;  5FTK A;  5FTN A;  3ZJT A;  4ARC A;  4KO8 A;  3ZGZ A;  2B25 A;  4RV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...