2JV2A

Solution structure of the n-terminal domain of ph1500
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
76
structure length
76
Chain Sequence
b'EGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLVTHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PH1500
publication title The Solution Structure of Ph1500-N
rcsb
source organism Pyrococcus horikoshii
molecule tags Unknown function
total genus 12
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2jv2A00
5FTKA 3HU1A 5FTLA 3QQ7A 3QC8A 1E32A 5FTMA 1WLFA 5DYGA 5EPPA 5GLFA 1CZ4A 2PJHB 1S3SA 3QQ8A 5FTJA 1ZC1A 4KDIA 5FTNA 2YUJA 5DYIA 1CR5A 4RV0A 1QCSA 4KLNA 2JV2A 5B6CA 4KDLA 4KO8A 1QDNA 3TIWA 3QWZA 1R7RA 5C18A 3CF2A 1CZ5A 5C1BA 3HU2A 4KODA 3HU3A
chains in the Genus database with same CATH superfamily
5FTLA 2B25A 1E32A 4ARCA 5EPPA 5GLFA 1S3SA 5FTNA 2Q18X 1QCSA 2JV2A 3TIWA 5CCXA 4UC4A 4AS1A 4KODA 3QQ7A 5FTMA 3LHDA 1WLFA 5DYGA 2Q1DX 1CZ4A 5FTJA 1ZC1A 3ZGZA 4RV0A 3FPUA 1I9GA 1O54A 2KY9A 2MM0A 5D6YA 5EQJB 3ZJTA 1QDNA 2XDPA 3QWZA 1R7RA 2QQRA 5C18A 4AQ7A 2GF7A 3HU2A 3FPRA 5D6XA 2PJHB 4FIBA 4KDIA 2LW6A 2YUJA 2QQSA 5DYIA 1CR5A 5CCBA 3BQBA 2Q1AX 3MB5A 4ARIA 5B6CA 2YVLA 2Q19X 5D6WA 3ZJVA 3CF2A 5ERGB 3ZJUA 1CZ5A 5C1BA 5FTKA 3HU1A 3QC8A 3QQ8A 2Q1CX 4KLNA 3LGAA 2PWYA 3FPTA 4KDLA 4KO8A 4CQNA 2GFAA 5CD1A 2MM2A 3HU3A
chains in the Genus database with same CATH topology
5FTLA 2B25A 1E32A 4ARCA 5EPPA 5GLFA 1S3SA 5FTNA 2Q18X 1QCSA 2JV2A 3TIWA 5CCXA 4UC4A 4AS1A 4KODA 3QQ7A 5FTMA 3LHDA 1WLFA 5DYGA 2Q1DX 1CZ4A 5FTJA 1ZC1A 3ZGZA 4RV0A 3FPUA 1I9GA 1O54A 2KY9A 2MM0A 5D6YA 5EQJB 3ZJTA 1QDNA 2XDPA 3QWZA 1R7RA 2QQRA 5C18A 4AQ7A 2GF7A 3HU2A 3FPRA 5D6XA 2PJHB 4FIBA 4KDIA 2LW6A 2YUJA 2QQSA 5DYIA 1CR5A 5CCBA 3BQBA 2Q1AX 3MB5A 4ARIA 5B6CA 2YVLA 2Q19X 5D6WA 3ZJVA 3CF2A 5ERGB 3ZJUA 1CZ5A 5C1BA 5FTKA 3HU1A 3QC8A 3QQ8A 2Q1CX 4KLNA 3LGAA 2PWYA 3FPTA 4KDLA 4KO8A 4CQNA 2GFAA 5CD1A 2MM2A 3HU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FTK A;  3HU1 A;  5FTL A;  3QQ7 A;  3QC8 A;  1E32 A;  5FTM A;  1WLF A;  5DYG A;  5EPP A;  5GLF A;  1CZ4 A;  2PJH B;  1S3S A;  3QQ8 A;  5FTJ A;  1ZC1 A;  4KDI A;  5FTN A;  2YUJ A;  5DYI A;  1CR5 A;  4RV0 A;  1QCS A;  4KLN A;  2JV2 A;  5B6C A;  4KDL A;  4KO8 A;  1QDN A;  3TIW A;  3QWZ A;  1R7R A;  5C18 A;  3CF2 A;  1CZ5 A;  5C1B A;  3HU2 A;  4KOD A;  3HU3 A; 
#chains in the Genus database with same CATH topology
 5FTL A;  2B25 A;  1E32 A;  4ARC A;  5EPP A;  5GLF A;  1S3S A;  5FTN A;  2Q18 X;  1QCS A;  2JV2 A;  3TIW A;  5CCX A;  4UC4 A;  4AS1 A;  4KOD A;  3QQ7 A;  5FTM A;  3LHD A;  1WLF A;  5DYG A;  2Q1D X;  1CZ4 A;  5FTJ A;  1ZC1 A;  3ZGZ A;  4RV0 A;  3FPU A;  1I9G A;  1O54 A;  2KY9 A;  2MM0 A;  5D6Y A;  5EQJ B;  3ZJT A;  1QDN A;  2XDP A;  3QWZ A;  1R7R A;  2QQR A;  5C18 A;  4AQ7 A;  2GF7 A;  3HU2 A;  3FPR A;  5D6X A;  2PJH B;  4FIB A;  4KDI A;  2LW6 A;  2YUJ A;  2QQS A;  5DYI A;  1CR5 A;  5CCB A;  3BQB A;  2Q1A X;  3MB5 A;  4ARI A;  5B6C A;  2YVL A;  2Q19 X;  5D6W A;  3ZJV A;  3CF2 A;  5ERG B;  3ZJU A;  1CZ5 A;  5C1B A;  5FTK A;  3HU1 A;  3QC8 A;  3QQ8 A;  2Q1C X;  4KLN A;  3LGA A;  2PWY A;  3FPT A;  4KDL A;  4KO8 A;  4CQN A;  2GFA A;  5CD1 A;  2MM2 A;  3HU3 A; 
#chains in the Genus database with same CATH homology
 5FTL A;  2B25 A;  1E32 A;  4ARC A;  5EPP A;  5GLF A;  1S3S A;  5FTN A;  2Q18 X;  1QCS A;  2JV2 A;  3TIW A;  5CCX A;  4UC4 A;  4AS1 A;  4KOD A;  3QQ7 A;  5FTM A;  3LHD A;  1WLF A;  5DYG A;  2Q1D X;  1CZ4 A;  5FTJ A;  1ZC1 A;  3ZGZ A;  4RV0 A;  3FPU A;  1I9G A;  1O54 A;  2KY9 A;  2MM0 A;  5D6Y A;  5EQJ B;  3ZJT A;  1QDN A;  2XDP A;  3QWZ A;  1R7R A;  2QQR A;  5C18 A;  4AQ7 A;  2GF7 A;  3HU2 A;  3FPR A;  5D6X A;  2PJH B;  4FIB A;  4KDI A;  2LW6 A;  2YUJ A;  2QQS A;  5DYI A;  1CR5 A;  5CCB A;  3BQB A;  2Q1A X;  3MB5 A;  4ARI A;  5B6C A;  2YVL A;  2Q19 X;  5D6W A;  3ZJV A;  3CF2 A;  5ERG B;  3ZJU A;  1CZ5 A;  5C1B A;  5FTK A;  3HU1 A;  3QC8 A;  3QQ8 A;  2Q1C X;  4KLN A;  3LGA A;  2PWY A;  3FPT A;  4KDL A;  4KO8 A;  4CQN A;  2GFA A;  5CD1 A;  2MM2 A;  3HU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...