2JV2A

Solution structure of the n-terminal domain of ph1500
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
76
structure length
76
Chain Sequence
EGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLVTHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PH1500
publication title The Solution Structure of Ph1500-N
rcsb
source organism Pyrococcus horikoshii
molecule tags Unknown function
total genus 12
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2jv2A00
2YUJA 3HU3A 5DYIA 1WLFA 1CR5A 1QDNA 5C1BA 2JV2A 5FTNA 1S3SA 5EPPA 3CF2A 1CZ5A 1QCSA 1R7RA 5C18A 5FTKA 5FTLA 5GLFA 4KDIA 5FTMA 5DYGA 1E32A 5FTJA 3HU2A 4KDLA 3QQ8A 2PJHB 1CZ4A 3QC8A 4KO8A 3TIWA 4RV0A 4KODA 5B6CA 3QWZA 3QQ7A 4KLNA 3HU1A 1ZC1A
chains in the Genus database with same CATH superfamily
3HU3A 5DYIA 3ZJTA 2XDPA 5D6WA 2JV2A 2YVLA 1I9GA 5EPPA 1QCSA 2LW6A 3LHDA 5GLFA 2B25A 2GF7A 4ARIA 5FTJA 4KDLA 2PJHB 3QQ8A 1CZ4A 2KY9A 4AQ7A 5CCBA 2GFAA 2PWYA 5B6CA 4CQNA 3FPTA 2MM2A 3FPRA 1WLFA 1S3SA 5D6YA 1R7RA 5FTKA 5FTLA 4AS1A 2Q19X 1E32A 4FIBA 4RV0A 3QQ7A 3HU1A 1ZC1A 3ZJUA 1CR5A 5CD1A 4ARCA 5FTNA 3ZJVA 3ZGZA 2Q1CX 5D6XA 5FTMA 3BQBA 5DYGA 3LGAA 1O54A 3QC8A 3TIWA 3QWZA 2Q18X 2MM0A 2YUJA 5EQJB 1QDNA 5C1BA 2QQRA 3MB5A 3CF2A 2Q1AX 1CZ5A 5C18A 2QQSA 3FPUA 4KDIA 5CCXA 3HU2A 4UC4A 2Q1DX 4KO8A 4KODA 4KLNA 5ERGB
chains in the Genus database with same CATH topology
3HU3A 5DYIA 3ZJTA 2XDPA 5D6WA 2JV2A 2YVLA 1I9GA 5EPPA 1QCSA 2LW6A 3LHDA 5GLFA 2B25A 2GF7A 4ARIA 5FTJA 4KDLA 2PJHB 3QQ8A 1CZ4A 2KY9A 4AQ7A 5CCBA 2GFAA 2PWYA 5B6CA 4CQNA 3FPTA 2MM2A 3FPRA 1WLFA 1S3SA 5D6YA 1R7RA 5FTKA 5FTLA 4AS1A 2Q19X 1E32A 4FIBA 4RV0A 3QQ7A 3HU1A 1ZC1A 3ZJUA 1CR5A 5CD1A 4ARCA 5FTNA 3ZJVA 3ZGZA 2Q1CX 5D6XA 5FTMA 3BQBA 5DYGA 3LGAA 1O54A 3QC8A 3TIWA 3QWZA 2Q18X 2MM0A 2YUJA 5EQJB 1QDNA 5C1BA 2QQRA 3MB5A 3CF2A 2Q1AX 1CZ5A 5C18A 2QQSA 3FPUA 4KDIA 5CCXA 3HU2A 4UC4A 2Q1DX 4KO8A 4KODA 4KLNA 5ERGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUJ A;  3HU3 A;  5DYI A;  1WLF A;  1CR5 A;  1QDN A;  5C1B A;  2JV2 A;  5FTN A;  1S3S A;  5EPP A;  3CF2 A;  1CZ5 A;  1QCS A;  1R7R A;  5C18 A;  5FTK A;  5FTL A;  5GLF A;  4KDI A;  5FTM A;  5DYG A;  1E32 A;  5FTJ A;  3HU2 A;  4KDL A;  3QQ8 A;  2PJH B;  1CZ4 A;  3QC8 A;  4KO8 A;  3TIW A;  4RV0 A;  4KOD A;  5B6C A;  3QWZ A;  3QQ7 A;  4KLN A;  3HU1 A;  1ZC1 A; 
#chains in the Genus database with same CATH topology
 3HU3 A;  5DYI A;  3ZJT A;  2XDP A;  5D6W A;  2JV2 A;  2YVL A;  1I9G A;  5EPP A;  1QCS A;  2LW6 A;  3LHD A;  5GLF A;  2B25 A;  2GF7 A;  4ARI A;  5FTJ A;  4KDL A;  2PJH B;  3QQ8 A;  1CZ4 A;  2KY9 A;  4AQ7 A;  5CCB A;  2GFA A;  2PWY A;  5B6C A;  4CQN A;  3FPT A;  2MM2 A;  3FPR A;  1WLF A;  1S3S A;  5D6Y A;  1R7R A;  5FTK A;  5FTL A;  4AS1 A;  2Q19 X;  1E32 A;  4FIB A;  4RV0 A;  3QQ7 A;  3HU1 A;  1ZC1 A;  3ZJU A;  1CR5 A;  5CD1 A;  4ARC A;  5FTN A;  3ZJV A;  3ZGZ A;  2Q1C X;  5D6X A;  5FTM A;  3BQB A;  5DYG A;  3LGA A;  1O54 A;  3QC8 A;  3TIW A;  3QWZ A;  2Q18 X;  2MM0 A;  2YUJ A;  5EQJ B;  1QDN A;  5C1B A;  2QQR A;  3MB5 A;  3CF2 A;  2Q1A X;  1CZ5 A;  5C18 A;  2QQS A;  3FPU A;  4KDI A;  5CCX A;  3HU2 A;  4UC4 A;  2Q1D X;  4KO8 A;  4KOD A;  4KLN A;  5ERG B; 
#chains in the Genus database with same CATH homology
 3HU3 A;  5DYI A;  3ZJT A;  2XDP A;  5D6W A;  2JV2 A;  2YVL A;  1I9G A;  5EPP A;  1QCS A;  2LW6 A;  3LHD A;  5GLF A;  2B25 A;  2GF7 A;  4ARI A;  5FTJ A;  4KDL A;  2PJH B;  3QQ8 A;  1CZ4 A;  2KY9 A;  4AQ7 A;  5CCB A;  2GFA A;  2PWY A;  5B6C A;  4CQN A;  3FPT A;  2MM2 A;  3FPR A;  1WLF A;  1S3S A;  5D6Y A;  1R7R A;  5FTK A;  5FTL A;  4AS1 A;  2Q19 X;  1E32 A;  4FIB A;  4RV0 A;  3QQ7 A;  3HU1 A;  1ZC1 A;  3ZJU A;  1CR5 A;  5CD1 A;  4ARC A;  5FTN A;  3ZJV A;  3ZGZ A;  2Q1C X;  5D6X A;  5FTM A;  3BQB A;  5DYG A;  3LGA A;  1O54 A;  3QC8 A;  3TIW A;  3QWZ A;  2Q18 X;  2MM0 A;  2YUJ A;  5EQJ B;  1QDN A;  5C1B A;  2QQR A;  3MB5 A;  3CF2 A;  2Q1A X;  1CZ5 A;  5C18 A;  2QQS A;  3FPU A;  4KDI A;  5CCX A;  3HU2 A;  4UC4 A;  2Q1D X;  4KO8 A;  4KOD A;  4KLN A;  5ERG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...