2JV3A

Ets-1 pnt domain (29-138) nmr structure ensemble
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
110
structure length
110
Chain Sequence
MECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMSGAALCALGKECFLELAPDFVGDILWEHLEILQKEDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ETS1 proto-oncogene
publication title Ets-1 PNT domain (29-138) NMR structure ensemble
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 32
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2007-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02198 SAM_PNT Sterile alpha motif (SAM)/Pointed domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2jv3A01
1X9XA 2QB0B 1SXDA 2KIVA 2KSOA 1LKYB 4NJ8A 1OXJA 1UQVA 2DL0A 5J8YA 2E8PA 4PZNA 2FE9A 4RQNA 1PK1B 2LPEA 2K4PA 4RQMA 1OW5A 1B4FA 5F3XB 1JI7A 2F8KA 2KMDA 2QARB 2LMRA 1F0MA 5J8YC 2Y9TA 1SV4A 2KE7A 2JV3A 1WWVA 2DKXA 3BS5A 1SGGA 2E8MA 5L1MA 1V38A 1SXEA 2QB0A 2YTUA 1COKA 2KG5A 1X66A 5KNIA 2F44A 5JU5A 1LKYA 1X40A 1DXSA 2QKQA 1PK3A 4PZOA 2GLEA 2QB1A 2L5YA 4NL9A 2EAPA 1KW4A 2KSOB 1UCVA 3KKAA 2K60A 2Y9UA 2E8NA 3TADA 2QARA 4IS7A 2D8CA 1RG6A 3BS7A 3TACB 1WWUA 3K1RB 4MHVA 2E8OA 2F3NA 1V85A 2ESEA 3BQ7A 5JTIA 1SV0A 3SENA 2D3DA 3H8MA 4NL9C 1PK1A 2EANA 3IDWA 3HILA 3KKAC 2DKZA 3TADC 2ES6A 5JRTA 3SEIA 2B6GA 1B0XA 2EAOA 1Z1VA 2EAMA 3BS5B 1SV0C
chains in the Genus database with same CATH superfamily
1MC8A 2KIVA 4PGXA 4U6PA 1JN3A 2KK0A 2C22A 3OHBA 3OSPA 4TUSA 2BCUA 1VLBA 3LYSA 3HRDD 3UMCA 3AU6A 2GO7A 4O3MA 3OGUA 4KLGA 2KKPA 2R8JA 2KJ5A 4BWJA 4O5EA 2MSNA 1FIQA 3T5JA 1NK0A 8ICUA 1FEZA 3RJGA 2NRZA 2BQRA 4J9QA 4B9TA 4M9LA 4DF4A 3GIJA 2DPIA 3JPNA 1RYRA 3ZDDA 3QZ7A 1SXEA 2BKEA 2QB0A 3N28A 5JUMA 2F1JA 3M7DA 2XGQA 3PV8A 1ZQIA 4R64A 2FMQA 4OCZA 1K1SA 1XS9D 4B9UA 4UB5A 1ECWA 5J0SA 9ICMA 5KFEA 1L7NA 1JROA 5J0WA 3SAFA 2R8HA 3WK7A 3Q8LA 2QKQA 2NRXA 5L9XA 2FJ6A 2EAPA 4CNQA 4YP3A 2IHNA 1WG8A 3L3FX 4OJ6A 3TADA 3PO4A 4CF5A 2Y0SC 1QCKA 3PW2A 2LBOA 1SL1A 3K75D 4MF8A 2H3VA 4PHEA 3ALRA 4F5QA 5KFDA 1N56A 4JWMA 2ESEA 2I6XA 4EBEA 3IHQB 1PK1A 2EANA 4PL1A 2A1AA 1ZXIA 5KTQA 1CUKA 8ICQA 4G9BA 5J29A 3AQFA 5J2DA 3RJIA 8ICZA 3RH4A 5DBBA 3G6YA 2RDJA 4DOCA 4UAWA 5IIKA 2LM4A 5J2CA 2AHOB 3JPTA 5G5HA 2E3TA 4J9PA 1KLNA 5ALUA 1KKXA 4ED7A 5J2BA 1ZRMA 1OW5A 4ELTA 4YD2A 1SKSA 5J2GA 1DOQA 2YB4A 2YQEA 1X9SA 4TURA 3AM9A 2KE7A 5ALSA 3QZ8A 2ZIXB 4ECSA 3TARA 1MA7A 1JRPA 1EXNA 4TQRA 1X6IA 2FI1A 4J9OA 2JR5A 5JU5A 4MFAA 3AQEA 2BPGA 8ICBA 2RRDA 1S97A 3C2LA 4PH5A 1KDHA 1XWLA 1ZETA 2MAXA 2OEHA 2W9AA 5KFXA 4RT3A 2ZUDA 3N7SC 3J81j 4P4OA 2CRXA 1NZBA 5AI4A 4GC7A 1NK8A 4IS7A 5J0UA 1DK2A 8ICOA 1WWUA 2KHQA 3GDXA 1AQ6A 1ZD5A 4BJQA 5KFGA 1BPYA 1QSSA 2DGZA 3TAQA 3RBDA 3H4DA 5J2JA 3LWLA 4IC9A 1NJXA 3F2BA 4YN4A 2IOFK 1U47A 2LYHA 1Z1VA 2H3IA 2HBMA 4XUSA 4ECTA 3BS5B 3KHHA 3BQ1A 4ICAA 8ICMA 4RQ4A 1SKRA 1SXDA 3FC4A 2AXTU 2WF6A 4QWCA 5AI5A 2F1HA 1LKYB 3T5HA 4YG2A 4DQRA 1S76D 5DG9A 2RDIA 3WKDA 4CF4A 4EENA 1J2NA 2ZJAA 1GO3F 2R18A 1O08A 2ZJ5A 3PO5A 4DSJA 9ICLA 2NV3A 5AICA 3KHRA 3H4BA 1RYUA 2VJ4A 7ICPA 5E79U 3RJHA 4CE6A 4O9MA 7ICFA 4KMUA 4PHDA 5BOLA 4Y2VA 5ALHA 4UBCA 4QZCA 1X66A 4UASA 1V97A 1ZQEA 5C5JA 3OHAA 2NO5A 4GXJA 4Y2XA 5J0TA 9ICXA 1BPEA 3WK4A 4AYBC 4DFPA 2OM6A 3NASA 2EQYA 4I2CA 2FLNA 3K4GA 3KTQA 5KFWA 3D6JA 4MHVA 2AQ0A 3QXGA 3KFUF 4ZH4A 2ZIXA 2W7OA 2HHVA 2W3SA 8ICRA 1X2IA 4DL3A 1KQQA 1TKDA 3G6XA 4M9GA 2H3FA 4JMUA 3PMNA 4F4WA 5GTHU 1JX4A 5AKZA 1N61A 4NLCA 5IINA 3RR8A 3UMBA 4DQQA 2W7PA 5ALYA 1X9XA 3Q8QB 2KFZA 2HDOA 4ACOA 2A1JA 1ZQTA 1XO0A 3GFKB 4PZNA 2FLPA 1SL2A 1L5UA 1X6JA 5EE1A 1ZQVA 1UA1A 3V7LA 3HW8A 1NKCA 1JI7A 3OSNA 5EWGA 4YQWA 2LYBA 8ICSA 2CN1A 1X9WA 5AM1A 5J8YC 7ICNA 1NK5A 3GILA 4TUPA 2I9GA 2KVSA 8ICPA 2ZTDA 4K4HA 5AKIA 3R9KA 3BS5A 4DQIA 1KTQA 2E8MA 4DS4A 3HWTA 4NM2A 4B9NA 4I2GA 1S10A 9ICEA 1LKYA 2P66A 4RQ0A 2XCAA 4YD1A 1D8LA 5AKHA 1KRPA 3RTVA 3RAXA 3GZFA 5AM2A 1C7YA 1L3VA 9ICCA 2ZJ8A 2KEYA 2NYVA 4RNNA 5KT7A 2EZZA 2JHDA 4I2IA 3KZXA 3EWAA 3WKEA 4UAVA 4YCXA 4KTQA 2GH1A 5GTIU 3SZ2A 5BPCA 1RG6A 2Z7JA 3MFIA 4F50A 9ICGA 1KBUA 8ICFA 2FMPA 2XO7A 3BQ7A 4ECWA 3MR2A 4NL9C 4EELA 4EX7A 1XNSA 4J9LA 7ICRA 4J9NA 2C2RA 5DBAA 3KOOA 1JXEA 3PW4A 3PVXA 2P35A 2F77X 3FAHA 1S9FA 1BPBA 2HHQA 3BQ2A 1O03A 4ECUA 4ED2A 2VJ5A 1RQNA 2DBYA 4UB1A 3C2MA 1HUOA 3H0MB 2E8PA 1Q8KA 2ZIUB 2ATLA 9ICUA 4NXZA 4F2SA 4B9MA 1NJYA 3HKZC 5AI6A 3RJJA 2KOBA 3SYZA 1ED1A 4EEKA 1F0MA 4EBDA 2Y9TA 1Q46A 3MDAA 1ZJNA 2JV3A 4QZIA 5B66U 4KX5A 4DOAA 3AEVA 1N60A 3NS1A 4TQSA 3T3FA 1YT3A 1Q3UA 2IBKA 4M9JA 3GV7B 4UW9A 3B0XA 2WAQC 3KHGA 1ZYQA 2W8KA 4Y2YA 2WHEA 2YMMA 1KFDA 1ZD3A 1ZQFA 2BCRA 4F93B 4DL4A 2Y9UA 4QWDA 2ZIVA 3QU2A 1Z1BA 2E8NA 3F5AA 2XICA 9ICHA 4FS2A 4DQPA 2IA6A 3RRGA 3C5FA 4O5CA 1QH9A 2XY7A 3AL0B 4DLEA 2HVIA 5DBCA 1SV0A 5KT2A 2ZUCA 5ALNA 2M9NA 5AM3A 3HILA 4C8OA 4M9NA 2DKZA 4JK1A 4UQGA 3EW9A 2VA8A 3D2QA 4I2HA 3PX4A 2YMLA 4RQ3A 4Z6CA 2HHWA 2EZXA 3N4MB 1COOA 3CRXA 2Q0ZX 2BQ3A 2MRLA 3HKZF 2RQ5A 3CW2C 2DWQA 3SI8A 8ICHA 5KG6A 4IRCA 2DL0A 4NM1A 5IIIA 5KG4A 5KFIA 1P7DA 4BUGA 3T5KA 3M6ZA 3I76A 5ALZA 4KLMA 1ZQUA 1QQ6A 3SD7A 2UVWA 5KT4A 5CRXA 2K4PA 1SWVA 2RLTA 4RQMA 3GV8B 2HCFA 4YFKA 2KKVA 1BVSA 1QSLA 2OYYA 3NVVA 1CRXA 2LMRA 3NTUA 5EWFA 4EYIB 4RNOA 5B5EU 5G5GA 3AMZA 2WAQF 4C8NA 3BQ0A 3MR3A 7ICOA 3PW5A 4GLXA 1V9PA 3ISCA 4DF8A 5KNIA 3GIMA 2HHTA 2WF9A 4YR3A 4I29A 1U45A 4RQ2A 2AJQA 2ZIUA 4TUQA 1JUDA 1RYSA 4M6WB 9ICKA 4DSLA 5KFFA 4CGZA 1BPXA 1BGXT 4Y2RA 1UCVA 1S0VA 2XI9A 4C7ZA 3RB6A 3PW0A 3E2EA 1JMSA 2XY6A 5HR6A 4I27A 4UARA 2JEFA 4Y2JA 5KL8B 3U26A 1PVQA 3C5GA 3IDWA 2BPCA 2YX8A 3SV3A 3TADC 2JRZA 2P6UA 4Z6FA 1ZQCA 1MN8A 5DDYA 2PFQA 1NK9A 3T5LA 4XA5A 1HUZA 7ICEA 5J0QA 4FZLA 4R66A 2KTQA 4DL5A 3PR4A 2H5XA 5J0XA 1AROP 2DF4B 1DK3A 2W03A 2XGPA 3CP8A 5EE9A 1TAMA 5AHXA 3ICXA 3NUQA 2BCSA 5KFQA 3NVWA 2G06A 3QUBA 3F2DA 4GXIA 3THVA 4QZGA 9ICBA 2YN4A 2KMDA 4DFMA 4B9LA 3V7JA 4O3NA 2W3RA 1L7PA 4NWIA 2XIDA 4QZHA 2W9BA 5DB7A 4Q8FA 3A0HU 2ODGA 3TANA 2ISPA 4P0PB 1ZQOA 5J2HA 3TFRA 4I2BA 5L1MA 4P4PA 8ICTA 1XSLA 1TK0A 2BPFA 2R8KA 2C28A 4YVZA 7ICSA 1FFUA 3WK8A 3ZDAA 3C21A 2BHNA 2HI0A 1LV5A 3NVYA 9ICVA 2JH1A 3QX7A 3M6KA 4F5PA 4ECQA 4K4IA 1DXSA 1TVAA 4JB3A 4F8RA 4Q44A 8ICIA 9ICFA 1L3TA 1KW4A 5HHIA 5KFNA 1TFRA 2B0CA 4PL2A 4OJLA 3IG8A 4C4RA 9ICSA 5L1LA 4QW8A 4QZDA 5KG3A 3BS7A 1ZQQA 1L7MA 1SB3C 4PJ0U 1T3NA 3UXNA 3N7RC 3I1YA 4ED6A 1S0MA 3H8MA 8ICWA 3H0LB 2UVVA 1LB2B 5KT3A 2HHSA 1ZQPA 3WK9A 2NRWA 2JEIA 4UAYA 8ICXA 4EZ9A 4BDPA 4OJOA 5KL1B 4PHAA 3MGIA 4ECZA 3KBBA 2K4IA 1JIHA 3JPRA 5KFUA 3D2NA 4KMOB 3NVZA 1VJ5A 2HVHA 4BWMA 3LWMA 3QNMA 3N97B 2VA2A 5EE3A 5KT6A 1PVRA 2KVCA 5TZVA 5DG8A 2CXYA 3IM1A 4US8A 3BDPA 4K4GA 4I2JA 4J9MA 2KHVA 2WB1F 2PI5A 1SGGA 1XSPA 2K89A 2ALZA 3OJSA 3HJEA 1U49A 2VIXA 4UB4A 4Q8EA 2F1IA 3UXPA 4DOBA 5IILA 1X40A 2BR0A 4B6JA 4FZMA 2Q4TA 1IM4A 3HX0A 4UATA 4C4TA 5KFSA 8ICGA 3RRHA 2W55A 5AIBA 2L5YA 1T94A 4MEYA 4ECYA 5AK6A 3MC1A 2BQUA 1QLNA 1QQ7A 2WFAA 3SQIA 5ALIA 5KFZA 2A19A 2HHUA 7ICVA 3PSIA 4C80A 1J2MA 4KX3A 2ZUBA 4P0PA 3IV6A 2C2DA 1FO4A 1NJZA 1T8EA 1IIPA 3K1ZA 2EDUA 4O3QA 7ICHA 4F92B 3FYHA 1B43A 5AKYA 4GC6A 4RUAA 1WYGA 4YR0A 3QU4A 4WJ3B 9ICAA 2PMZF 2E5SA 1N62A 5KFTA 1NK6A 5EE0A 5DQGA 5KT5A 3G6VA 3ISBA 1Q3VA 1HJPA 2DFLA 2B21A 4QJFB 3LDAA 5IIMA 3RB4A 4QIWC 4IQTA 2KD1A 1F44A 3A0BU 1CI4A 4JUZA 4P2HA 1B4FA 2G07A 4YMNA 4QNLA 3WKAA 5KFBA 4PGQA 4EYHB 4OD0A 4Y2UA 1SIJA 3T79A 3M9OB 5CJ7A 1T7PA 5AI9A 4DSFA 8ICVA 3RF9A 1ZQLA 1S5LU 2V4RA 3IN5A 3MDCA 4DEZA 2LM1A 3RR7A 4C8KA 3JPSA 2KN7A 1ZQMA 2FMSA 5KAIU 1UPHA 2J6UA 2K8CB 2Y1JA 2J6SA 4RQ5A 5EOZA 3QEAZ 2KFNA 4UAUA 1IG6A 2ZIWB 4O3OA 5DGBA 5L1KA 2BCQA 4Z6DA 1H38A 1A77A 5J0OA 3CNHA 3BZCA 4R63A 1KSPA 1U48A 3C28A 4DQSA 1TK8A 4QWBA 2K60A 2G0AA 4US9A 2VA3A 1ZQGA 3H40A 9ICQA 4KLTA 3PSPA 3HPOA 2RHFA 3SMVA 4PPXA 4B9VA 4IR9A 5ALJA 3F5EA 1Z3EB 3ETRA 3RFAA 1RZTA 2LYAA 1SZHA 2W8LA 1ZD2P 4RPYA 5KAFU 4QIWF 8ICJA 3D2SA 3L5KA 4RQ7A 1JALA 3H7IA 5AKJA 1TV9A 5T14A 2KV2A 2HBKA 3B9JA 5J2EA 2MUTB 7ICMA 1XC9A 2BGWA 4CRXA 2HOIA 4DSKA 9ICJA 4LJXA 1S0NA 5KG0A 4LZGA 5KFYA 5KG2A 1SWWA 4ECRA 1ZQNA 3PZPA 1ZQYA 9ICOA 2FPMA 2KICA 1SKWA 1NK7A 4YXMA 1D8YA 3AU2A 4RNMA 2QLTA 4ED8A 3ZDCA 4MFCA 1A6SA 2KG5A 2ZG6A 5ALEA 2OH2A 3OPXA 5AK4A 4O0IA 9ICRA 1ZOLA 3GQCA 2HSZA 2FDRA 1ZQDA 2AGPA 5DDMA 2BDPA 2YMQA 4KLIA 3RJEA 4PZOA 2UVUA 2RP5A 1ZRNA 2KSOB 3DEEA 2ZTEA 4QW9A 1UA0A 4J9RA 1KL9A 4MF2A 5CR0A 1F5SA 3TACB 5KFAA 9ICWA 5J0RA 4RQ6A 1N2XA 1Z4OA 2KZZA 4P4MA 2D3DA 3WKBA 4ELVA 2OXOA 3TQ1A 1NOMA 4PGYA 2ZIWA 5KFKA 3MGVA 2NO4A 2B6GA 1B0XA 3MFHA 4IRDA 4IQWA 3ORYA 2EAMA 1PVPA 1ZQRA 4NY8A 1RDFA 1RQLA 2I1QA 3HT3A 3QYPA 1SV0C 1L6NA 5D49A 5ALFA 4RQ8A 5HNKA 4QZEA 4Q45A 2G09A 3Q8PB 9ICTA 4NJ8A 8ICEA 1OXJA 4X5VA 8ICCA 4ED3A 3QUTA 2EH9A 3LK9A 5DGAA 5L1IA 5F9LA 3QU7A 4RUCA 3EPGA 1RPLA 1PK1B 3E58A 3EZ5A 1DGSA 7ICLA 1D8BA 3DDHA 4DLGA 4J03A 5CP2A 5KG7A 2AGQA 4KLOA 5F3XB 4FBUA 2F8KA 1TE2A 3GIIA 3GIKA 1ZQKA 3Q8SB 2PXIA 2KZMA 4C4SA 2V9WA 5AKLA 1FFVA 3ONNA 4KLSA 5ALGA 3PSFA 2WF5A 3NRZA 1RXVA 2YTUA 4NLKA 1NI3A 1RXWA 3F2CA 4KLQA 2PKEA 4JV0A 4O3PA 1Z00B 2LI6A 1XSNA 1U4BA 1MQ2A 4J9SA 5DB6A 3S6JA 3L4PA 2MUTA 5AI8A 4FBTA 2NRVA 1WUDA 4UB8U 1ZQ1C 4KN7A 2VKQA 1OUQA 2JH7A 3EYZA 2O6KA 3KZIU 1NK4A 8ICKA 1YZ7A 1JXLA 1XO1A 3KKAA 3JPOA 4DS5A 1PUZA 8ICAA 5AKKA 2D8CA 2EZYA 2K8BB 3I28A 3K1RB 5KFLA 5KFOA 2WF8A 5ALDA 2AU0A 5AIAA 2HHXA 2IOFA 2R8IA 4DFKA 4YR2A 5AM5A 4C0ZA 4M9HA 5AK3A 2JEGA 2E1EA 3SEIA 3GU3A 4UB2A 5IIJA 2E1FA 1L3UA 1TAQA 1XU4A 4NV0A 4DFDA 3V6KA 2V4QA 2KSOA 4NLBA 3PX0A 5KFPA 2OCEA 5J0YA 4OJPA 4B9SA 1S8OA 3ZI4A 2HW3A 3UPQA 1KFSA 3NGDA 3RB0A 3TFSA 4O5KA 1C20A 2LPEA 8ICNA 5J2KA 3M8SA 2K8AA 5H2FU 1MQ3A 2QARB 3SR6A 2DUYA 3BQTA 3ED5A 2AGOA 4I2AA 2R8GA 4CDGA 1DRGA 5HR7A 4RU9A 8ICLA 2W11A 2DPJA 2HBJA 4Q43A 1WWVA 2G5IB 4QZAA 2ZTCA 5AM4A 1COKA 1N48A 2A3VA 3RH5A 1SL0A 3HP6A 4DCCA 1T3QA 4F5NA 7ICTA 4UB6U 5HMLA 2HOFA 2W54A 2ASDA 4DL6A 4EBCA 1UHUA 4R65A 3UXOA 4P0QB 2QB1A 2BDUA 4DFJA 4QWAA 2PI4A 5HHHA 5EWEA 2W9MA 3ISDA 4U7CA 5AM0A 1NJWA 1N63A 4QZFA 3WKCA 1ZQBA 2XY5A 4M2YA 2WB1C 5D46A 5ALXA 2ASJA 3MABA 3GV5B 4ELUA 1Z00A 4E0DA 5ALQA 5DKWA 3C23A 1BPDA 1UT8A 4F71A 4M04A 3PR5B 3M8RA 4KITB 4PHPA 3V72A 3ZD9A 5KFRA 4R8UB 3H8JA 1Z4NA 7ICJA 2D6FC 3UQ2A 1S77D 2F76X 9ICNA 1QTMA 2FE9A 1N5WA 5FP0A 3RJFA 1A76A 1KEJA 4UBBA 4F2RA 4KLEA 2AQ4A 1X42A 4UB3A 4GIBA 2XC9A 2YMPA 3PW7A 3QU9A 3C1YA 4M6WA 2Y0SF 2KZ3A 3MR6A 3WK6A 2KP7A 1HEKA 2PFNA 1BPZA 4FS1A 1K5OA 1SV4A 5ALLA 4G3IA 2GWSA 4M47A 7ICUA 1L8OA 2DKXA 1Z19A 2A1JB 5KFVA 2GOLA 2YY6A 3M9MB 2JXJA 5KFMA 5AI0A 3LVVA 5CA7A 2PMZC 2F44A 1ZQZA 4JWNA 4F5RA 3H8WA 3RB3A 3M1YA 4F5OA 5KFHA 2KJ8A 4FO6A 3SAGA 1QSYA 3IG5A 3SV4A 3IP4B 1NNLA 2QARA 3RH6A 5CHGA 4UAZA 2IHMA 2MA1A 1BNOA 1M6YA 3EUB2 5AK5A 4JV2A 3SAHA 4NLZA 5ALMA 2KNJA 1ZQJA 1ZJMA 4C7YA 3QUQA 4Y2TA 3QEBZ 3QE9Y 3Q8RB 3VCBA 2LHTA 4EZ6A 4I28A 4LZDA 2Y1IA 3V6JA 2EAOA 3BZKA 1NKEA 1J97A 4KLLA 3LVWA 7ICIA 4P0QA 1NZPA 3BJYA 4FZNA 4RQ1A 2AH5A 3RJKA 4QZBA 1WCNA 1ZQAA 1B22A 2G5HB 2JGAA 1ZQHA 1UQVA 4DL7A 3EPIA 3FM9A 4KLHA 2HBLA 2FPLA 4RT2A 2P6RA 4QZ8A 3UQ0A 4BXOB 4BGDA 3TI0A 2K4EA 3ZDEA 5KG1A 7ICQA 4CF3A 5K4LA 4F4ZA 4HAIA 5ALWA 4C8MA 5A0LA 3V6HA 4MEXA 4IQVA 4Z6EA 2KJ9A 4FFDA 2N1RA 4NLNA 1K1QA 2KIWA 1V38A 3CYMA 4F72A 4DSEA 4R8UA 5DQHA 4MFFA 4LVSA 2W43A 3KHLA 4IRKA 4J9KA 1BNPA 1IV8A 2IOHA 4I2DA 4XRHA 2CPRA 3IRUA 3OTQA 4ECVA 5J2IA 1VDVA 1UT5A 1D9DA 3QU5A 3M9NB 4RPZA 1ZQSA 5C0YA 3ZDBA 5HMMA 2W04A 2F3NA 5AKXA 2PFOA 2J6TA 1WCLA 5JTIA 3JPQA 1QQ5A 1HIWA 2OWOA 4EEYA 4F4YA 4CCHA 2DQNB 7ICKA 1LVHA 2PFPA 2HMXA 4GXKA 9ICPA 7ICGA 2ZXHA 4DL2A 2ES6A 5JRTA 3FDSA 4A8EA 4DSIA 3V7KA 2MU2A 2FPKA 5AKGA 2WTFA 2ZIVB 3N7PD 3C1ZA 3C2KA 5HP4A 2C2EA 1URJA 1L3SA 8ICYA 5KFJA 5J2FA 4YMOA 2JZBB 5J8YA 4NLGA 4F4XA 2ZXIA 4AYBF 3PX6A 2F8LA 4KN4A 3PNCA 4XQ8A 3PSTA 2ISOA 4ECXA 2LKYA 5ALVA 5DQIA 5CEHA 1ZQXA 3TKAA 4ZOHC 5DLFA 4C8LA 3KD3A 2W9CB 4KLDA 2I5HA 4F4KA 3E0FA 5DB8A 5ALKA 5DLGA 5KG5A 4Y2QA 4RZRA 3WK5A 4O3SA 5CWRA 4NL9A 3AUOA 3RBEA 1T4GA 4BXOA 3AN1A 1KN5A 5ALPA 2XVTA 1L7OA 1Y88A 5BOMA 3ETLA 3NRWA 4IR1A 1V85A 5CB1A 3RAQA 4FE3A 2F2AB 4F3OA 3MGHA 3H8SA 4KLJA 1A0PA 4QWEA 3B0YA 4ED1A 5ALTA 3C29A 3PMLA 1U9LA 1NKBA 9ICIA 3F53A 4YXJA 1ZD4A 3Q8MA 5KFCA 5DG7A 2QB0B 1PZNA 4RPXA 1YZ6A 4OJ5A 3DV9A 2ASLA 2HOQA 4RQNA 3WU2U 1DGJA 1TK5A 3MBYA 4KLUA 4IL6U 1IXRA 2JMGA 1MSWD 5DB9A 3ZD8A 1S0OA 4YMMA 1D9FA 5ALRA 5L1JA 2K4HA 2WF7A 2UVRA 2IMWP 2M0NA 4DO9A 2H3ZA 2FLLA 4I2FA 4F91B 3OJUA 4M0AA 4ED0A 5ALOA 5IIOA 2G08A 3UMGA 1TAUA 2JZBA 5J0PA 5TISU 4USAA 4AP9A 4EX6A 4GFJA 4KLFA 1PK3A 2GLEA 3JPPA 3QUCA 4JV1A 1L8LA 3MR5A 2VANA 2W9BB 3UM9A 1N5XA 2NRTA 5D4BA 4IQUA 2BZFA 2OHFA 2E8OA 5J2AA 3O0FA 3SENA 4O3RA 1CEZA 3Q8KA 4BX9C 5AKEA 3VC8A 1ZQWA 2XCPA 4HYKA 2H3QA 3KKAC 4OO1J 3PY8A 4DWIA 1KFTA 4QZ9A 3TAPA 1SZPA 1RM6C 2W9CA 4Y2PA 4I2EA 3H0RB 2JEJA 1X9MA 4Y2SA 5F9NA 2BCVA 2YB1A
chains in the Genus database with same CATH topology
1X9XA 2QB0B 1SXDA 2KIVA 2KSOA 1LKYB 4NJ8A 1OXJA 1UQVA 2DL0A 5J8YA 2E8PA 4PZNA 2FE9A 4RQNA 1PK1B 2LPEA 2K4PA 4RQMA 1OW5A 1B4FA 5F3XB 1JI7A 2F8KA 2KMDA 2QARB 2LMRA 1F0MA 5J8YC 2Y9TA 1SV4A 2KE7A 2JV3A 1WWVA 2DKXA 3BS5A 1SGGA 2E8MA 5L1MA 1V38A 1SXEA 2QB0A 2YTUA 1COKA 2KG5A 1X66A 5KNIA 2F44A 5JU5A 1LKYA 1X40A 1DXSA 2QKQA 1PK3A 4PZOA 2GLEA 2QB1A 2L5YA 4NL9A 2EAPA 1KW4A 2KSOB 1UCVA 3KKAA 2K60A 2Y9UA 2E8NA 3TADA 2QARA 4IS7A 2D8CA 1RG6A 3BS7A 3TACB 1WWUA 3K1RB 4MHVA 2E8OA 2F3NA 1V85A 2ESEA 3BQ7A 5JTIA 1SV0A 3SENA 2D3DA 3H8MA 4NL9C 1PK1A 2EANA 3IDWA 3HILA 3KKAC 2DKZA 3TADC 2ES6A 5JRTA 3SEIA 2B6GA 1B0XA 2EAOA 1Z1VA 2EAMA 3BS5B 1SV0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X9X A;  2QB0 B;  1SXD A;  2KIV A;  2KSO A;  1LKY B;  4NJ8 A;  1OXJ A;  1UQV A;  2DL0 A;  5J8Y A;  2E8P A;  4PZN A;  2FE9 A;  4RQN A;  1PK1 B;  2LPE A;  2K4P A;  4RQM A;  1OW5 A;  1B4F A;  5F3X B;  1JI7 A;  2F8K A;  2KMD A;  2QAR B;  2LMR A;  1F0M A;  5J8Y C;  2Y9T A;  1SV4 A;  2KE7 A;  2JV3 A;  1WWV A;  2DKX A;  3BS5 A;  1SGG A;  2E8M A;  5L1M A;  1V38 A;  1SXE A;  2QB0 A;  2YTU A;  1COK A;  2KG5 A;  1X66 A;  5KNI A;  2F44 A;  5JU5 A;  1LKY A;  1X40 A;  1DXS A;  2QKQ A;  1PK3 A;  4PZO A;  2GLE A;  2QB1 A;  2L5Y A;  4NL9 A;  2EAP A;  1KW4 A;  2KSO B;  1UCV A;  3KKA A;  2K60 A;  2Y9U A;  2E8N A;  3TAD A;  2QAR A;  4IS7 A;  2D8C A;  1RG6 A;  3BS7 A;  3TAC B;  1WWU A;  3K1R B;  4MHV A;  2E8O A;  2F3N A;  1V85 A;  2ESE A;  3BQ7 A;  5JTI A;  1SV0 A;  3SEN A;  2D3D A;  3H8M A;  4NL9 C;  1PK1 A;  2EAN A;  3IDW A;  3HIL A;  3KKA C;  2DKZ A;  3TAD C;  2ES6 A;  5JRT A;  3SEI A;  2B6G A;  1B0X A;  2EAO A;  1Z1V A;  2EAM A;  3BS5 B;  1SV0 C; 
#chains in the Genus database with same CATH topology
 1MC8 A;  2KIV A;  4PGX A;  4U6P A;  1JN3 A;  2KK0 A;  2C22 A;  3OHB A;  3OSP A;  4TUS A;  2BCU A;  1VLB A;  3LYS A;  3HRD D;  3UMC A;  3AU6 A;  2GO7 A;  4O3M A;  3OGU A;  4KLG A;  2KKP A;  2R8J A;  2KJ5 A;  4BWJ A;  4O5E A;  2MSN A;  1FIQ A;  3T5J A;  1NK0 A;  8ICU A;  1FEZ A;  3RJG A;  2NRZ A;  2BQR A;  4J9Q A;  4B9T A;  4M9L A;  4DF4 A;  3GIJ A;  2DPI A;  3JPN A;  1RYR A;  3ZDD A;  3QZ7 A;  1SXE A;  2BKE A;  2QB0 A;  3N28 A;  5JUM A;  2F1J A;  3M7D A;  2XGQ A;  3PV8 A;  1ZQI A;  4R64 A;  2FMQ A;  4OCZ A;  1K1S A;  1XS9 D;  4B9U A;  4UB5 A;  1ECW A;  5J0S A;  9ICM A;  5KFE A;  1L7N A;  1JRO A;  5J0W A;  3SAF A;  2R8H A;  3WK7 A;  3Q8L A;  2QKQ A;  2NRX A;  5L9X A;  2FJ6 A;  2EAP A;  4CNQ A;  4YP3 A;  2IHN A;  1WG8 A;  3L3F X;  4OJ6 A;  3TAD A;  3PO4 A;  4CF5 A;  2Y0S C;  1QCK A;  3PW2 A;  2LBO A;  1SL1 A;  3K75 D;  4MF8 A;  2H3V A;  4PHE A;  3ALR A;  4F5Q A;  5KFD A;  1N56 A;  4JWM A;  2ESE A;  2I6X A;  4EBE A;  3IHQ B;  1PK1 A;  2EAN A;  4PL1 A;  2A1A A;  1ZXI A;  5KTQ A;  1CUK A;  8ICQ A;  4G9B A;  5J29 A;  3AQF A;  5J2D A;  3RJI A;  8ICZ A;  3RH4 A;  5DBB A;  3G6Y A;  2RDJ A;  4DOC A;  4UAW A;  5IIK A;  2LM4 A;  5J2C A;  2AHO B;  3JPT A;  5G5H A;  2E3T A;  4J9P A;  1KLN A;  5ALU A;  1KKX A;  4ED7 A;  5J2B A;  1ZRM A;  1OW5 A;  4ELT A;  4YD2 A;  1SKS A;  5J2G A;  1DOQ A;  2YB4 A;  2YQE A;  1X9S A;  4TUR A;  3AM9 A;  2KE7 A;  5ALS A;  3QZ8 A;  2ZIX B;  4ECS A;  3TAR A;  1MA7 A;  1JRP A;  1EXN A;  4TQR A;  1X6I A;  2FI1 A;  4J9O A;  2JR5 A;  5JU5 A;  4MFA A;  3AQE A;  2BPG A;  8ICB A;  2RRD A;  1S97 A;  3C2L A;  4PH5 A;  1KDH A;  1XWL A;  1ZET A;  2MAX A;  2OEH A;  2W9A A;  5KFX A;  4RT3 A;  2ZUD A;  3N7S C;  3J81 j;  4P4O A;  2CRX A;  1NZB A;  5AI4 A;  4GC7 A;  1NK8 A;  4IS7 A;  5J0U A;  1DK2 A;  8ICO A;  1WWU A;  2KHQ A;  3GDX A;  1AQ6 A;  1ZD5 A;  4BJQ A;  5KFG A;  1BPY A;  1QSS A;  2DGZ A;  3TAQ A;  3RBD A;  3H4D A;  5J2J A;  3LWL A;  4IC9 A;  1NJX A;  3F2B A;  4YN4 A;  2IOF K;  1U47 A;  2LYH A;  1Z1V A;  2H3I A;  2HBM A;  4XUS A;  4ECT A;  3BS5 B;  3KHH A;  3BQ1 A;  4ICA A;  8ICM A;  4RQ4 A;  1SKR A;  1SXD A;  3FC4 A;  2AXT U;  2WF6 A;  4QWC A;  5AI5 A;  2F1H A;  1LKY B;  3T5H A;  4YG2 A;  4DQR A;  1S76 D;  5DG9 A;  2RDI A;  3WKD A;  4CF4 A;  4EEN A;  1J2N A;  2ZJA A;  1GO3 F;  2R18 A;  1O08 A;  2ZJ5 A;  3PO5 A;  4DSJ A;  9ICL A;  2NV3 A;  5AIC A;  3KHR A;  3H4B A;  1RYU A;  2VJ4 A;  7ICP A;  5E79 U;  3RJH A;  4CE6 A;  4O9M A;  7ICF A;  4KMU A;  4PHD A;  5BOL A;  4Y2V A;  5ALH A;  4UBC A;  4QZC A;  1X66 A;  4UAS A;  1V97 A;  1ZQE A;  5C5J A;  3OHA A;  2NO5 A;  4GXJ A;  4Y2X A;  5J0T A;  9ICX A;  1BPE A;  3WK4 A;  4AYB C;  4DFP A;  2OM6 A;  3NAS A;  2EQY A;  4I2C A;  2FLN A;  3K4G A;  3KTQ A;  5KFW A;  3D6J A;  4MHV A;  2AQ0 A;  3QXG A;  3KFU F;  4ZH4 A;  2ZIX A;  2W7O A;  2HHV A;  2W3S A;  8ICR A;  1X2I A;  4DL3 A;  1KQQ A;  1TKD A;  3G6X A;  4M9G A;  2H3F A;  4JMU A;  3PMN A;  4F4W A;  5GTH U;  1JX4 A;  5AKZ A;  1N61 A;  4NLC A;  5IIN A;  3RR8 A;  3UMB A;  4DQQ A;  2W7P A;  5ALY A;  1X9X A;  3Q8Q B;  2KFZ A;  2HDO A;  4ACO A;  2A1J A;  1ZQT A;  1XO0 A;  3GFK B;  4PZN A;  2FLP A;  1SL2 A;  1L5U A;  1X6J A;  5EE1 A;  1ZQV A;  1UA1 A;  3V7L A;  3HW8 A;  1NKC A;  1JI7 A;  3OSN A;  5EWG A;  4YQW A;  2LYB A;  8ICS A;  2CN1 A;  1X9W A;  5AM1 A;  5J8Y C;  7ICN A;  1NK5 A;  3GIL A;  4TUP A;  2I9G A;  2KVS A;  8ICP A;  2ZTD A;  4K4H A;  5AKI A;  3R9K A;  3BS5 A;  4DQI A;  1KTQ A;  2E8M A;  4DS4 A;  3HWT A;  4NM2 A;  4B9N A;  4I2G A;  1S10 A;  9ICE A;  1LKY A;  2P66 A;  4RQ0 A;  2XCA A;  4YD1 A;  1D8L A;  5AKH A;  1KRP A;  3RTV A;  3RAX A;  3GZF A;  5AM2 A;  1C7Y A;  1L3V A;  9ICC A;  2ZJ8 A;  2KEY A;  2NYV A;  4RNN A;  5KT7 A;  2EZZ A;  2JHD A;  4I2I A;  3KZX A;  3EWA A;  3WKE A;  4UAV A;  4YCX A;  4KTQ A;  2GH1 A;  5GTI U;  3SZ2 A;  5BPC A;  1RG6 A;  2Z7J A;  3MFI A;  4F50 A;  9ICG A;  1KBU A;  8ICF A;  2FMP A;  2XO7 A;  3BQ7 A;  4ECW A;  3MR2 A;  4NL9 C;  4EEL A;  4EX7 A;  1XNS A;  4J9L A;  7ICR A;  4J9N A;  2C2R A;  5DBA A;  3KOO A;  1JXE A;  3PW4 A;  3PVX A;  2P35 A;  2F77 X;  3FAH A;  1S9F A;  1BPB A;  2HHQ A;  3BQ2 A;  1O03 A;  4ECU A;  4ED2 A;  2VJ5 A;  1RQN A;  2DBY A;  4UB1 A;  3C2M A;  1HUO A;  3H0M B;  2E8P A;  1Q8K A;  2ZIU B;  2ATL A;  9ICU A;  4NXZ A;  4F2S A;  4B9M A;  1NJY A;  3HKZ C;  5AI6 A;  3RJJ A;  2KOB A;  3SYZ A;  1ED1 A;  4EEK A;  1F0M A;  4EBD A;  2Y9T A;  1Q46 A;  3MDA A;  1ZJN A;  2JV3 A;  4QZI A;  5B66 U;  4KX5 A;  4DOA A;  3AEV A;  1N60 A;  3NS1 A;  4TQS A;  3T3F A;  1YT3 A;  1Q3U A;  2IBK A;  4M9J A;  3GV7 B;  4UW9 A;  3B0X A;  2WAQ C;  3KHG A;  1ZYQ A;  2W8K A;  4Y2Y A;  2WHE A;  2YMM A;  1KFD A;  1ZD3 A;  1ZQF A;  2BCR A;  4F93 B;  4DL4 A;  2Y9U A;  4QWD A;  2ZIV A;  3QU2 A;  1Z1B A;  2E8N A;  3F5A A;  2XIC A;  9ICH A;  4FS2 A;  4DQP A;  2IA6 A;  3RRG A;  3C5F A;  4O5C A;  1QH9 A;  2XY7 A;  3AL0 B;  4DLE A;  2HVI A;  5DBC A;  1SV0 A;  5KT2 A;  2ZUC A;  5ALN A;  2M9N A;  5AM3 A;  3HIL A;  4C8O A;  4M9N A;  2DKZ A;  4JK1 A;  4UQG A;  3EW9 A;  2VA8 A;  3D2Q A;  4I2H A;  3PX4 A;  2YML A;  4RQ3 A;  4Z6C A;  2HHW A;  2EZX A;  3N4M B;  1COO A;  3CRX A;  2Q0Z X;  2BQ3 A;  2MRL A;  3HKZ F;  2RQ5 A;  3CW2 C;  2DWQ A;  3SI8 A;  8ICH A;  5KG6 A;  4IRC A;  2DL0 A;  4NM1 A;  5III A;  5KG4 A;  5KFI A;  1P7D A;  4BUG A;  3T5K A;  3M6Z A;  3I76 A;  5ALZ A;  4KLM A;  1ZQU A;  1QQ6 A;  3SD7 A;  2UVW A;  5KT4 A;  5CRX A;  2K4P A;  1SWV A;  2RLT A;  4RQM A;  3GV8 B;  2HCF A;  4YFK A;  2KKV A;  1BVS A;  1QSL A;  2OYY A;  3NVV A;  1CRX A;  2LMR A;  3NTU A;  5EWF A;  4EYI B;  4RNO A;  5B5E U;  5G5G A;  3AMZ A;  2WAQ F;  4C8N A;  3BQ0 A;  3MR3 A;  7ICO A;  3PW5 A;  4GLX A;  1V9P A;  3ISC A;  4DF8 A;  5KNI A;  3GIM A;  2HHT A;  2WF9 A;  4YR3 A;  4I29 A;  1U45 A;  4RQ2 A;  2AJQ A;  2ZIU A;  4TUQ A;  1JUD A;  1RYS A;  4M6W B;  9ICK A;  4DSL A;  5KFF A;  4CGZ A;  1BPX A;  1BGX T;  4Y2R A;  1UCV A;  1S0V A;  2XI9 A;  4C7Z A;  3RB6 A;  3PW0 A;  3E2E A;  1JMS A;  2XY6 A;  5HR6 A;  4I27 A;  4UAR A;  2JEF A;  4Y2J A;  5KL8 B;  3U26 A;  1PVQ A;  3C5G A;  3IDW A;  2BPC A;  2YX8 A;  3SV3 A;  3TAD C;  2JRZ A;  2P6U A;  4Z6F A;  1ZQC A;  1MN8 A;  5DDY A;  2PFQ A;  1NK9 A;  3T5L A;  4XA5 A;  1HUZ A;  7ICE A;  5J0Q A;  4FZL A;  4R66 A;  2KTQ A;  4DL5 A;  3PR4 A;  2H5X A;  5J0X A;  1ARO P;  2DF4 B;  1DK3 A;  2W03 A;  2XGP A;  3CP8 A;  5EE9 A;  1TAM A;  5AHX A;  3ICX A;  3NUQ A;  2BCS A;  5KFQ A;  3NVW A;  2G06 A;  3QUB A;  3F2D A;  4GXI A;  3THV A;  4QZG A;  9ICB A;  2YN4 A;  2KMD A;  4DFM A;  4B9L A;  3V7J A;  4O3N A;  2W3R A;  1L7P A;  4NWI A;  2XID A;  4QZH A;  2W9B A;  5DB7 A;  4Q8F A;  3A0H U;  2ODG A;  3TAN A;  2ISP A;  4P0P B;  1ZQO A;  5J2H A;  3TFR A;  4I2B A;  5L1M A;  4P4P A;  8ICT A;  1XSL A;  1TK0 A;  2BPF A;  2R8K A;  2C28 A;  4YVZ A;  7ICS A;  1FFU A;  3WK8 A;  3ZDA A;  3C21 A;  2BHN A;  2HI0 A;  1LV5 A;  3NVY A;  9ICV A;  2JH1 A;  3QX7 A;  3M6K A;  4F5P A;  4ECQ A;  4K4I A;  1DXS A;  1TVA A;  4JB3 A;  4F8R A;  4Q44 A;  8ICI A;  9ICF A;  1L3T A;  1KW4 A;  5HHI A;  5KFN A;  1TFR A;  2B0C A;  4PL2 A;  4OJL A;  3IG8 A;  4C4R A;  9ICS A;  5L1L A;  4QW8 A;  4QZD A;  5KG3 A;  3BS7 A;  1ZQQ A;  1L7M A;  1SB3 C;  4PJ0 U;  1T3N A;  3UXN A;  3N7R C;  3I1Y A;  4ED6 A;  1S0M A;  3H8M A;  8ICW A;  3H0L B;  2UVV A;  1LB2 B;  5KT3 A;  2HHS A;  1ZQP A;  3WK9 A;  2NRW A;  2JEI A;  4UAY A;  8ICX A;  4EZ9 A;  4BDP A;  4OJO A;  5KL1 B;  4PHA A;  3MGI A;  4ECZ A;  3KBB A;  2K4I A;  1JIH A;  3JPR A;  5KFU A;  3D2N A;  4KMO B;  3NVZ A;  1VJ5 A;  2HVH A;  4BWM A;  3LWM A;  3QNM A;  3N97 B;  2VA2 A;  5EE3 A;  5KT6 A;  1PVR A;  2KVC A;  5TZV A;  5DG8 A;  2CXY A;  3IM1 A;  4US8 A;  3BDP A;  4K4G A;  4I2J A;  4J9M A;  2KHV A;  2WB1 F;  2PI5 A;  1SGG A;  1XSP A;  2K89 A;  2ALZ A;  3OJS A;  3HJE A;  1U49 A;  2VIX A;  4UB4 A;  4Q8E A;  2F1I A;  3UXP A;  4DOB A;  5IIL A;  1X40 A;  2BR0 A;  4B6J A;  4FZM A;  2Q4T A;  1IM4 A;  3HX0 A;  4UAT A;  4C4T A;  5KFS A;  8ICG A;  3RRH A;  2W55 A;  5AIB A;  2L5Y A;  1T94 A;  4MEY A;  4ECY A;  5AK6 A;  3MC1 A;  2BQU A;  1QLN A;  1QQ7 A;  2WFA A;  3SQI A;  5ALI A;  5KFZ A;  2A19 A;  2HHU A;  7ICV A;  3PSI A;  4C80 A;  1J2M A;  4KX3 A;  2ZUB A;  4P0P A;  3IV6 A;  2C2D A;  1FO4 A;  1NJZ A;  1T8E A;  1IIP A;  3K1Z A;  2EDU A;  4O3Q A;  7ICH A;  4F92 B;  3FYH A;  1B43 A;  5AKY A;  4GC6 A;  4RUA A;  1WYG A;  4YR0 A;  3QU4 A;  4WJ3 B;  9ICA A;  2PMZ F;  2E5S A;  1N62 A;  5KFT A;  1NK6 A;  5EE0 A;  5DQG A;  5KT5 A;  3G6V A;  3ISB A;  1Q3V A;  1HJP A;  2DFL A;  2B21 A;  4QJF B;  3LDA A;  5IIM A;  3RB4 A;  4QIW C;  4IQT A;  2KD1 A;  1F44 A;  3A0B U;  1CI4 A;  4JUZ A;  4P2H A;  1B4F A;  2G07 A;  4YMN A;  4QNL A;  3WKA A;  5KFB A;  4PGQ A;  4EYH B;  4OD0 A;  4Y2U A;  1SIJ A;  3T79 A;  3M9O B;  5CJ7 A;  1T7P A;  5AI9 A;  4DSF A;  8ICV A;  3RF9 A;  1ZQL A;  1S5L U;  2V4R A;  3IN5 A;  3MDC A;  4DEZ A;  2LM1 A;  3RR7 A;  4C8K A;  3JPS A;  2KN7 A;  1ZQM A;  2FMS A;  5KAI U;  1UPH A;  2J6U A;  2K8C B;  2Y1J A;  2J6S A;  4RQ5 A;  5EOZ A;  3QEA Z;  2KFN A;  4UAU A;  1IG6 A;  2ZIW B;  4O3O A;  5DGB A;  5L1K A;  2BCQ A;  4Z6D A;  1H38 A;  1A77 A;  5J0O A;  3CNH A;  3BZC A;  4R63 A;  1KSP A;  1U48 A;  3C28 A;  4DQS A;  1TK8 A;  4QWB A;  2K60 A;  2G0A A;  4US9 A;  2VA3 A;  1ZQG A;  3H40 A;  9ICQ A;  4KLT A;  3PSP A;  3HPO A;  2RHF A;  3SMV A;  4PPX A;  4B9V A;  4IR9 A;  5ALJ A;  3F5E A;  1Z3E B;  3ETR A;  3RFA A;  1RZT A;  2LYA A;  1SZH A;  2W8L A;  1ZD2 P;  4RPY A;  5KAF U;  4QIW F;  8ICJ A;  3D2S A;  3L5K A;  4RQ7 A;  1JAL A;  3H7I A;  5AKJ A;  1TV9 A;  5T14 A;  2KV2 A;  2HBK A;  3B9J A;  5J2E A;  2MUT B;  7ICM A;  1XC9 A;  2BGW A;  4CRX A;  2HOI A;  4DSK A;  9ICJ A;  4LJX A;  1S0N A;  5KG0 A;  4LZG A;  5KFY A;  5KG2 A;  1SWW A;  4ECR A;  1ZQN A;  3PZP A;  1ZQY A;  9ICO A;  2FPM A;  2KIC A;  1SKW A;  1NK7 A;  4YXM A;  1D8Y A;  3AU2 A;  4RNM A;  2QLT A;  4ED8 A;  3ZDC A;  4MFC A;  1A6S A;  2KG5 A;  2ZG6 A;  5ALE A;  2OH2 A;  3OPX A;  5AK4 A;  4O0I A;  9ICR A;  1ZOL A;  3GQC A;  2HSZ A;  2FDR A;  1ZQD A;  2AGP A;  5DDM A;  2BDP A;  2YMQ A;  4KLI A;  3RJE A;  4PZO A;  2UVU A;  2RP5 A;  1ZRN A;  2KSO B;  3DEE A;  2ZTE A;  4QW9 A;  1UA0 A;  4J9R A;  1KL9 A;  4MF2 A;  5CR0 A;  1F5S A;  3TAC B;  5KFA A;  9ICW A;  5J0R A;  4RQ6 A;  1N2X A;  1Z4O A;  2KZZ A;  4P4M A;  2D3D A;  3WKB A;  4ELV A;  2OXO A;  3TQ1 A;  1NOM A;  4PGY A;  2ZIW A;  5KFK A;  3MGV A;  2NO4 A;  2B6G A;  1B0X A;  3MFH A;  4IRD A;  4IQW A;  3ORY A;  2EAM A;  1PVP A;  1ZQR A;  4NY8 A;  1RDF A;  1RQL A;  2I1Q A;  3HT3 A;  3QYP A;  1SV0 C;  1L6N A;  5D49 A;  5ALF A;  4RQ8 A;  5HNK A;  4QZE A;  4Q45 A;  2G09 A;  3Q8P B;  9ICT A;  4NJ8 A;  8ICE A;  1OXJ A;  4X5V A;  8ICC A;  4ED3 A;  3QUT A;  2EH9 A;  3LK9 A;  5DGA A;  5L1I A;  5F9L A;  3QU7 A;  4RUC A;  3EPG A;  1RPL A;  1PK1 B;  3E58 A;  3EZ5 A;  1DGS A;  7ICL A;  1D8B A;  3DDH A;  4DLG A;  4J03 A;  5CP2 A;  5KG7 A;  2AGQ A;  4KLO A;  5F3X B;  4FBU A;  2F8K A;  1TE2 A;  3GII A;  3GIK A;  1ZQK A;  3Q8S B;  2PXI A;  2KZM A;  4C4S A;  2V9W A;  5AKL A;  1FFV A;  3ONN A;  4KLS A;  5ALG A;  3PSF A;  2WF5 A;  3NRZ A;  1RXV A;  2YTU A;  4NLK A;  1NI3 A;  1RXW A;  3F2C A;  4KLQ A;  2PKE A;  4JV0 A;  4O3P A;  1Z00 B;  2LI6 A;  1XSN A;  1U4B A;  1MQ2 A;  4J9S A;  5DB6 A;  3S6J A;  3L4P A;  2MUT A;  5AI8 A;  4FBT A;  2NRV A;  1WUD A;  4UB8 U;  1ZQ1 C;  4KN7 A;  2VKQ A;  1OUQ A;  2JH7 A;  3EYZ A;  2O6K A;  3KZI U;  1NK4 A;  8ICK A;  1YZ7 A;  1JXL A;  1XO1 A;  3KKA A;  3JPO A;  4DS5 A;  1PUZ A;  8ICA A;  5AKK A;  2D8C A;  2EZY A;  2K8B B;  3I28 A;  3K1R B;  5KFL A;  5KFO A;  2WF8 A;  5ALD A;  2AU0 A;  5AIA A;  2HHX A;  2IOF A;  2R8I A;  4DFK A;  4YR2 A;  5AM5 A;  4C0Z A;  4M9H A;  5AK3 A;  2JEG A;  2E1E A;  3SEI A;  3GU3 A;  4UB2 A;  5IIJ A;  2E1F A;  1L3U A;  1TAQ A;  1XU4 A;  4NV0 A;  4DFD A;  3V6K A;  2V4Q A;  2KSO A;  4NLB A;  3PX0 A;  5KFP A;  2OCE A;  5J0Y A;  4OJP A;  4B9S A;  1S8O A;  3ZI4 A;  2HW3 A;  3UPQ A;  1KFS A;  3NGD A;  3RB0 A;  3TFS A;  4O5K A;  1C20 A;  2LPE A;  8ICN A;  5J2K A;  3M8S A;  2K8A A;  5H2F U;  1MQ3 A;  2QAR B;  3SR6 A;  2DUY A;  3BQT A;  3ED5 A;  2AGO A;  4I2A A;  2R8G A;  4CDG A;  1DRG A;  5HR7 A;  4RU9 A;  8ICL A;  2W11 A;  2DPJ A;  2HBJ A;  4Q43 A;  1WWV A;  2G5I B;  4QZA A;  2ZTC A;  5AM4 A;  1COK A;  1N48 A;  2A3V A;  3RH5 A;  1SL0 A;  3HP6 A;  4DCC A;  1T3Q A;  4F5N A;  7ICT A;  4UB6 U;  5HML A;  2HOF A;  2W54 A;  2ASD A;  4DL6 A;  4EBC A;  1UHU A;  4R65 A;  3UXO A;  4P0Q B;  2QB1 A;  2BDU A;  4DFJ A;  4QWA A;  2PI4 A;  5HHH A;  5EWE A;  2W9M A;  3ISD A;  4U7C A;  5AM0 A;  1NJW A;  1N63 A;  4QZF A;  3WKC A;  1ZQB A;  2XY5 A;  4M2Y A;  2WB1 C;  5D46 A;  5ALX A;  2ASJ A;  3MAB A;  3GV5 B;  4ELU A;  1Z00 A;  4E0D A;  5ALQ A;  5DKW A;  3C23 A;  1BPD A;  1UT8 A;  4F71 A;  4M04 A;  3PR5 B;  3M8R A;  4KIT B;  4PHP A;  3V72 A;  3ZD9 A;  5KFR A;  4R8U B;  3H8J A;  1Z4N A;  7ICJ A;  2D6F C;  3UQ2 A;  1S77 D;  2F76 X;  9ICN A;  1QTM A;  2FE9 A;  1N5W A;  5FP0 A;  3RJF A;  1A76 A;  1KEJ A;  4UBB A;  4F2R A;  4KLE A;  2AQ4 A;  1X42 A;  4UB3 A;  4GIB A;  2XC9 A;  2YMP A;  3PW7 A;  3QU9 A;  3C1Y A;  4M6W A;  2Y0S F;  2KZ3 A;  3MR6 A;  3WK6 A;  2KP7 A;  1HEK A;  2PFN A;  1BPZ A;  4FS1 A;  1K5O A;  1SV4 A;  5ALL A;  4G3I A;  2GWS A;  4M47 A;  7ICU A;  1L8O A;  2DKX A;  1Z19 A;  2A1J B;  5KFV A;  2GOL A;  2YY6 A;  3M9M B;  2JXJ A;  5KFM A;  5AI0 A;  3LVV A;  5CA7 A;  2PMZ C;  2F44 A;  1ZQZ A;  4JWN A;  4F5R A;  3H8W A;  3RB3 A;  3M1Y A;  4F5O A;  5KFH A;  2KJ8 A;  4FO6 A;  3SAG A;  1QSY A;  3IG5 A;  3SV4 A;  3IP4 B;  1NNL A;  2QAR A;  3RH6 A;  5CHG A;  4UAZ A;  2IHM A;  2MA1 A;  1BNO A;  1M6Y A;  3EUB 2;  5AK5 A;  4JV2 A;  3SAH A;  4NLZ A;  5ALM A;  2KNJ A;  1ZQJ A;  1ZJM A;  4C7Y A;  3QUQ A;  4Y2T A;  3QEB Z;  3QE9 Y;  3Q8R B;  3VCB A;  2LHT A;  4EZ6 A;  4I28 A;  4LZD A;  2Y1I A;  3V6J A;  2EAO A;  3BZK A;  1NKE A;  1J97 A;  4KLL A;  3LVW A;  7ICI A;  4P0Q A;  1NZP A;  3BJY A;  4FZN A;  4RQ1 A;  2AH5 A;  3RJK A;  4QZB A;  1WCN A;  1ZQA A;  1B22 A;  2G5H B;  2JGA A;  1ZQH A;  1UQV A;  4DL7 A;  3EPI A;  3FM9 A;  4KLH A;  2HBL A;  2FPL A;  4RT2 A;  2P6R A;  4QZ8 A;  3UQ0 A;  4BXO B;  4BGD A;  3TI0 A;  2K4E A;  3ZDE A;  5KG1 A;  7ICQ A;  4CF3 A;  5K4L A;  4F4Z A;  4HAI A;  5ALW A;  4C8M A;  5A0L A;  3V6H A;  4MEX A;  4IQV A;  4Z6E A;  2KJ9 A;  4FFD A;  2N1R A;  4NLN A;  1K1Q A;  2KIW A;  1V38 A;  3CYM A;  4F72 A;  4DSE A;  4R8U A;  5DQH A;  4MFF A;  4LVS A;  2W43 A;  3KHL A;  4IRK A;  4J9K A;  1BNP A;  1IV8 A;  2IOH A;  4I2D A;  4XRH A;  2CPR A;  3IRU A;  3OTQ A;  4ECV A;  5J2I A;  1VDV A;  1UT5 A;  1D9D A;  3QU5 A;  3M9N B;  4RPZ A;  1ZQS A;  5C0Y A;  3ZDB A;  5HMM A;  2W04 A;  2F3N A;  5AKX A;  2PFO A;  2J6T A;  1WCL A;  5JTI A;  3JPQ A;  1QQ5 A;  1HIW A;  2OWO A;  4EEY A;  4F4Y A;  4CCH A;  2DQN B;  7ICK A;  1LVH A;  2PFP A;  2HMX A;  4GXK A;  9ICP A;  7ICG A;  2ZXH A;  4DL2 A;  2ES6 A;  5JRT A;  3FDS A;  4A8E A;  4DSI A;  3V7K A;  2MU2 A;  2FPK A;  5AKG A;  2WTF A;  2ZIV B;  3N7P D;  3C1Z A;  3C2K A;  5HP4 A;  2C2E A;  1URJ A;  1L3S A;  8ICY A;  5KFJ A;  5J2F A;  4YMO A;  2JZB B;  5J8Y A;  4NLG A;  4F4X A;  2ZXI A;  4AYB F;  3PX6 A;  2F8L A;  4KN4 A;  3PNC A;  4XQ8 A;  3PST A;  2ISO A;  4ECX A;  2LKY A;  5ALV A;  5DQI A;  5CEH A;  1ZQX A;  3TKA A;  4ZOH C;  5DLF A;  4C8L A;  3KD3 A;  2W9C B;  4KLD A;  2I5H A;  4F4K A;  3E0F A;  5DB8 A;  5ALK A;  5DLG A;  5KG5 A;  4Y2Q A;  4RZR A;  3WK5 A;  4O3S A;  5CWR A;  4NL9 A;  3AUO A;  3RBE A;  1T4G A;  4BXO A;  3AN1 A;  1KN5 A;  5ALP A;  2XVT A;  1L7O A;  1Y88 A;  5BOM A;  3ETL A;  3NRW A;  4IR1 A;  1V85 A;  5CB1 A;  3RAQ A;  4FE3 A;  2F2A B;  4F3O A;  3MGH A;  3H8S A;  4KLJ A;  1A0P A;  4QWE A;  3B0Y A;  4ED1 A;  5ALT A;  3C29 A;  3PML A;  1U9L A;  1NKB A;  9ICI A;  3F53 A;  4YXJ A;  1ZD4 A;  3Q8M A;  5KFC A;  5DG7 A;  2QB0 B;  1PZN A;  4RPX A;  1YZ6 A;  4OJ5 A;  3DV9 A;  2ASL A;  2HOQ A;  4RQN A;  3WU2 U;  1DGJ A;  1TK5 A;  3MBY A;  4KLU A;  4IL6 U;  1IXR A;  2JMG A;  1MSW D;  5DB9 A;  3ZD8 A;  1S0O A;  4YMM A;  1D9F A;  5ALR A;  5L1J A;  2K4H A;  2WF7 A;  2UVR A;  2IMW P;  2M0N A;  4DO9 A;  2H3Z A;  2FLL A;  4I2F A;  4F91 B;  3OJU A;  4M0A A;  4ED0 A;  5ALO A;  5IIO A;  2G08 A;  3UMG A;  1TAU A;  2JZB A;  5J0P A;  5TIS U;  4USA A;  4AP9 A;  4EX6 A;  4GFJ A;  4KLF A;  1PK3 A;  2GLE A;  3JPP A;  3QUC A;  4JV1 A;  1L8L A;  3MR5 A;  2VAN A;  2W9B B;  3UM9 A;  1N5X A;  2NRT A;  5D4B A;  4IQU A;  2BZF A;  2OHF A;  2E8O A;  5J2A A;  3O0F A;  3SEN A;  4O3R A;  1CEZ A;  3Q8K A;  4BX9 C;  5AKE A;  3VC8 A;  1ZQW A;  2XCP A;  4HYK A;  2H3Q A;  3KKA C;  4OO1 J;  3PY8 A;  4DWI A;  1KFT A;  4QZ9 A;  3TAP A;  1SZP A;  1RM6 C;  2W9C A;  4Y2P A;  4I2E A;  3H0R B;  2JEJ A;  1X9M A;  4Y2S A;  5F9N A;  2BCV A;  2YB1 A; 
#chains in the Genus database with same CATH homology
 1X9X A;  2QB0 B;  1SXD A;  2KIV A;  2KSO A;  1LKY B;  4NJ8 A;  1OXJ A;  1UQV A;  2DL0 A;  5J8Y A;  2E8P A;  4PZN A;  2FE9 A;  4RQN A;  1PK1 B;  2LPE A;  2K4P A;  4RQM A;  1OW5 A;  1B4F A;  5F3X B;  1JI7 A;  2F8K A;  2KMD A;  2QAR B;  2LMR A;  1F0M A;  5J8Y C;  2Y9T A;  1SV4 A;  2KE7 A;  2JV3 A;  1WWV A;  2DKX A;  3BS5 A;  1SGG A;  2E8M A;  5L1M A;  1V38 A;  1SXE A;  2QB0 A;  2YTU A;  1COK A;  2KG5 A;  1X66 A;  5KNI A;  2F44 A;  5JU5 A;  1LKY A;  1X40 A;  1DXS A;  2QKQ A;  1PK3 A;  4PZO A;  2GLE A;  2QB1 A;  2L5Y A;  4NL9 A;  2EAP A;  1KW4 A;  2KSO B;  1UCV A;  3KKA A;  2K60 A;  2Y9U A;  2E8N A;  3TAD A;  2QAR A;  4IS7 A;  2D8C A;  1RG6 A;  3BS7 A;  3TAC B;  1WWU A;  3K1R B;  4MHV A;  2E8O A;  2F3N A;  1V85 A;  2ESE A;  3BQ7 A;  5JTI A;  1SV0 A;  3SEN A;  2D3D A;  3H8M A;  4NL9 C;  1PK1 A;  2EAN A;  3IDW A;  3HIL A;  3KKA C;  2DKZ A;  3TAD C;  2ES6 A;  5JRT A;  3SEI A;  2B6G A;  1B0X A;  2EAO A;  1Z1V A;  2EAM A;  3BS5 B;  1SV0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...