2JV3A

Ets-1 pnt domain (29-138) nmr structure ensemble
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
110
structure length
110
Chain Sequence
b'MECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMSGAALCALGKECFLELAPDFVGDILWEHLEILQKEDVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ETS1 proto-oncogene
publication title Ets-1 PNT domain (29-138) NMR structure ensemble
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 32
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2007-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02198 SAM_PNT Sterile alpha motif (SAM)/Pointed domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2jv3A01
2EANA 2KMDA 4RQMA 2K4PA 2F44A 2Y9UA 5J8YA 2E8OA 4PZNA 3K1RB 1SXDA 1UQVA 1X9XA 1RG6A 3KKAC 2DKZA 2QARA 5J8YC 2EAMA 3TADA 1SGGA 1SXEA 1LKYB 1B0XA 1COKA 3TADC 3BS5B 2F3NA 5L1MA 2GLEA 2LMRA 2QB0B 1PK1B 2DKXA 2KSOA 3KKAA 1WWVA 5KNIA 2LPEA 2D8CA 2ES6A 2YTUA 2B6GA 1V38A 2QARB 4MHVA 5JRTA 1SV4A 2QKQA 2E8PA 1PK1A 1DXSA 2ESEA 2K60A 2FE9A 5JTIA 1SV0A 2EAPA 1OXJA 2KSOB 1JI7A 2EAOA 3BQ7A 4RQNA 3IDWA 1UCVA 2D3DA 1B4FA 3H8MA 3HILA 1SV0C 2QB1A 2JV3A 2E8NA 3SEIA 1V85A 5JU5A 2F8KA 2KIVA 5F3XB 1WWUA 2E8MA 1OW5A 4NL9A 2L5YA 3BS7A 2Y9TA 4NJ8A 3SENA 1KW4A 1Z1VA 2KG5A 4NL9C 1PK3A 4IS7A 3TACB 1LKYA 1X40A 2KE7A 2DL0A 1X66A 3BS5A 2QB0A 1F0MA 4PZOA
chains in the Genus database with same CATH superfamily
1XO0A 4ECUA 2F44A 2ZJ8A 3GV7B 2I6XA 5B66U 2E8OA 5KFEA 4NLNA 3O0FA 5D46A 4RQ1A 2QARA 1NJXA 2GH1A 5D49A 5KFMA 4Y2UA 4ED8A 1SGGA 1ZQRA 2HOIA 4F2RA 2LMRA 4DF8A 1L3UA 2XY6A 1KL9A 4EX7A 7ICJA 1WWVA 5D4BA 3UMCA 3V72A 3OTQA 2KD1A 4UW9A 7ICVA 2KZMA 2IOHA 4WJ3B 2LHTA 1RYRA 4KLMA 7ICUA 1ZQBA 3QUTA 2YMMA 4O3QA 4J9LA 3L3FX 2WF9A 5AICA 4YP3A 1OXJA 1JI7A 2PFOA 4DFKA 5J2EA 1ZQHA 2FPLA 3BZCA 8ICEA 5AM1A 2WTFA 2XGPA 4I29A 3RB0A 1NI3A 1T94A 2A3VA 4RQ2A 4MFAA 3RRGA 1MQ2A 4EBDA 4OJLA 5KG0A 5J2IA 1A6SA 4IR9A 5KFHA 4Z6DA 4NJ8A 3TQ1A 2IMWP 4Y2SA 4K4IA 2I1QA 1K1QA 5CHGA 2IHMA 2ODGA 1Z3EB 1WCLA 2BDPA 4DS4A 2WAQF 5H2FU 1U49A 5J2JA 2DGZA 1Y88A 3RBEA 2ZJAA 5KG1A 2ZIXB 5ALEA 4DSKA 3K1RB 4DQRA 2H3VA 3UM9A 1RG6A 3CW2C 3UMBA 1GO3F 4PHAA 3C2MA 3GV5B 1ZQFA 1LB2B 4OCZA 2G06A 5DQGA 1Q8KA 4F50A 2PFPA 3TI0A 3H0LB 2YMLA 4RQ5A 4X5VA 1ZQSA 3PNCA 1NK5A 3J81j 8ICMA 4YMOA 3PMLA 1BPDA 4HAIA 1ZQUA 3MR3A 4P2HA 1ZQTA 1H38A 1QQ7A 1U45A 1BPEA 4B9TA 1TAQA 4K4HA 2FMSA 2LYHA 1DXSA 3RJJA 3NUQA 4KN4A 5IIIA 4F5NA 4OJPA 8ICSA 5J29A 1EXNA 2EAPA 4RQ6A 4ED7A 4C8MA 1QQ6A 2DFLA 3TANA 2JMGA 4IRCA 2RDJA 4Y2YA 8ICZA 3H8MA 1QSYA 2JRZA 1NJZA 1ZQZA 2F8LA 3RH6A 4XRHA 1T4GA 3NTUA 5DGBA 1OW5A 1U47A 3SAGA 1N2XA 2AJQA 2E3TA 1X9WA 1IIPA 7ICGA 3H7IA 3C21A 3SENA 4NL9C 5B5EU 1XSPA 4GLXA 3M9OB 2YQEA 2W7PA 4QWAA 4EZ6A 8ICVA 1XO1A 4I2JA 4DWIA 1S9FA 4F5OA 2KFZA 2DL0A 3DV9A 2BPGA 3M9MB 5DG7A 3K4GA 4TUPA 4ECSA 2Y9UA 3TAQA 5BOMA 5AKXA 1ZD2P 5KFWA 3HW8A 2AGPA 2C22A 3QEBZ 2H3ZA 1IG6A 2ZTEA 2R8KA 1SXEA 4PJ0U 1ZQYA 1B0XA 4R8UB 3Q8MA 2KEYA 5KT4A 3E58A 4F4XA 3RBDA 4BJQA 5HP4A 4XUSA 4IRKA 2VANA 3UXNA 2CN1A 3ISDA 3H4BA 8ICRA 1RM6C 9ICPA 5KG7A 2JH1A 4QZHA 4DLEA 5J0PA 4C8NA 1DGSA 2H3IA 3JPQA 4YCXA 3F2DA 5JUMA 1ZQEA 3I28A 1J2NA 1S5LU 3TARA 4O5KA 1JROA 4EEKA 5ALTA 3EZ5A 4P0QB 4O3OA 2HOFA 3MGIA 2NYVA 1FO4A 5KFZA 3IDWA 1B22A 5KFJA 8ICKA 2RDIA 4Y2JA 2KNJA 4Q8FA 3HRDD 2G09A 1T8EA 3SEIA 4DCCA 4C4SA 1O03A 1X9SA 1S77D 1X6IA 4PL1A 2J6UA 4DL2A 3V7LA 5C0YA 1ZQPA 2L5YA 3D6JA 2EQYA 3WK5A 2W7OA 2XGQA 1K1SA 3TFRA 4KLFA 2PKEA 4FZNA 4TUQA 2HBKA 1VLBA 2CPRA 5AKYA 3N28A 1MSWD 4YN4A 4EEYA 4KMOB 2JGAA 3NVWA 2HDOA 3NASA 5AM0A 4RPZA 2KIWA 4ACOA 8ICPA 3T5HA 4F8RA 5CP2A 4DFPA 4F5PA 1U9LA 3V6KA 3AN1A 4FZLA 2V4QA 5J2DA 1D9DA 1QLNA 4KLSA 5KFGA 3MR2A 5KG2A 1KSPA 4XA5A 4M9HA 4J03A 4O3RA 1PK1B 3A0HU 3PSIA 2FDRA 4C4TA 4IRDA 2ES6A 2RP5A 5KFOA 4UAZA 4RQ0A 3G6XA 4FBUA 5CB1A 1Q3VA 4YR2A 1A77A 2WHEA 3B9JA 3TKAA 1KLNA 2K8CB 5KAFU 4I2IA 1NZPA 2ZXHA 9ICVA 2Q0ZX 2Y1IA 2WB1F 4PHDA 1L8OA 4M6WA 1OUQA 1SKWA 3N7PD 5FP0A 4PGXA 1BGXT 3EW9A 2JZBB 3UQ2A 2HW3A 1TVAA 4RQ7A 4DQIA 5KAIU 4J9RA 4Q45A 5ALRA 3GDXA 1A76A 4QNLA 4J9PA 2KIVA 3OGUA 1HJPA 3ORYA 2XCPA 3BJYA 1ZQOA 3WKAA 5AK5A 4C0ZA 5AIBA 1HIWA 1MQ3A 2V9WA 3F53A 1TV9A 1NK8A 4JUZA 3WK8A 5J2KA 1Z1VA 5KFFA 1X42A 5G5HA 4OJOA 3FDSA 1LKYA 3PO5A 2A1AA 1U48A 4DSLA 5BPCA 4UB6U 4O3NA 3KD3A 2KHQA 4ELTA 2W11A 1O08A 2BCUA 1T3QA 1UQVA 5EE1A 4RNMA 4PGQA 4YVZA 4IQUA 2EAMA 2HHVA 4I2AA 3H4DA 2W9CA 2K8BB 4MFCA 1Z1BA 4IR1A 4G9BA 2YMQA 5CRXA 2KZ3A 2G08A 3C2LA 1ZD5A 5AM5A 3PSTA 3RB4A 3M6KA 5ALDA 4FFDA 2WF6A 5KFKA 1BNPA 3JPTA 2QARB 3VCBA 2LM4A 9ICGA 4M9JA 4HYKA 5DB9A 2O6KA 2XY5A 5KFBA 1ZQVA 9ICNA 1F5SA 7ICQA 1VJ5A 4GC6A 3GIIA 4KLLA 3MR5A 9ICQA 4DEZA 3ZI4A 4TUSA 1JX4A 2XICA 2JEJA 3QU4A 5L1IA 5CWRA 1ZJMA 1XSNA 1IM4A 5AM2A 5JU5A 4AYBC 2BGWA 3IP4B 4CF3A 4AP9A 2XIDA 1KBUA 2FLNA 2HHWA 2DUYA 1L3VA 1S8OA 2KKPA 2F2AB 4KX3A 4ECWA 4NLBA 2GWSA 5EWGA 1ZOLA 4RZRA 3WK7A 4Z6CA 4AYBF 3MFIA 2HHQA 3DDHA 8ICQA 2Y0SC 4CCHA 2ASLA 2E1EA 1QSLA 2BPFA 3ISCA 2ZTCA 1F0MA 1SWWA 1S10A 9ICJA 9ICOA 2EANA 3OSNA 5AKJA 1UT8A 3T3FA 3G6VA 4MF8A 4IQTA 1D9FA 4B9VA 1ZQGA 5KFLA 3IG8A 2IBKA 1QH9A 1KRPA 5EOZA 5L1MA 2HBLA 2HOQA 4RPYA 3RF9A 2Y1JA 4UATA 4R63A 3RAXA 2KSOA 4PH5A 5CR0A 4NM1A 5KNIA 5KFCA 3L5KA 2C2EA 2NRVA 4DL6A 5KL8B 3N7SC 2YN4A 4DSIA 4PGYA 3HKZF 4YFKA 4C8KA 3L4PA 4JV2A 1KEJA 1WCNA 1ZRNA 4RPXA 3QUCA 3OJSA 4B9NA 4US8A 4UB1A 2HBJA 3SR6A 3CNHA 5CJ7A 2ATLA 2JEFA 2BCQA 1JMSA 4UASA 5KFSA 4R66A 2KTQA 3PVXA 5AI4A 2B21A 2GO7A 5ALSA 3IRUA 4DL4A 3GIKA 1DRGA 2YX8A 4C8LA 2F1HA 3ETRA 3KHGA 1L3TA 4BDPA 3D2SA 2XC9A 5KG3A 1TK8A 5J0WA 3E2EA 4DSJA 1Q46A 2HBMA 4UB5A 4DL7A 5F9LA 2AXTU 4M04A 9ICHA 3E0FA 4QZBA 4UAUA 2MA1A 2E1FA 3EPIA 1WYGA 5EE0A 5L1JA 4Q43A 1IXRA 1NOMA 4R65A 7ICIA 3SQIA 2WAQC 5IINA 1RQLA 4CE6A 4F92B 2LYBA 3M8RA 3C29A 4DS5A 2W9AA 1M6YA 3JPSA 1MA7A 5HR7A 2ZUCA 1D8YA 3LDAA 2F1JA 5TZVA 2KICA 3AU6A 2KHVA 1COKA 4BX9C 1D8BA 4YMNA 4FZMA 3RJHA 3WKCA 4ZH4A 5J0QA 4ELUA 2W3RA 2KN7A 4Y2TA 2OCEA 3MDCA 2ZUBA 4RQ3A 5ALYA 4ECXA 5DBCA 2W9BA 2M9NA 1N5WA 9ICSA 4BXOA 1NK6A 2JHDA 4P4PA 3BQ0A 2J6SA 2I5HA 3ZD9A 5T14A 5JTIA 2A1JA 4CRXA 5J2FA 2EZYA 8ICGA 4ICAA 2W04A 4KMUA 1DK2A 4YR0A 4ECTA 1TK0A 5AK4A 3HILA 3VC8A 5G5GA 5AKHA 3V7KA 1B43A 2KFNA 5DG9A 3LVWA 3T5KA 4I2BA 4GXJA 2EZZA 2MU2A 3QYPA 1ZQXA 5ALWA 4I2CA 2AGOA 5K4LA 4DSEA 5KFXA 2C2DA 3TACB 1Z19A 3A0BU 3K1ZA 1BPBA 4O5EA 5ALGA 2HHUA 4TURA 3QEAZ 2AH5A 3FC4A 1XS9D 2HCFA 4ECYA 4PL2A 4NY8A 9ICBA 4I2GA 3Q8SB 2QLTA 2ZIUA 1SXDA 3NVZA 4KN7A 3Q8RB 4I2DA 1KN5A 3KHHA 3TADA 5KTQA 2DBYA 5AK6A 3N97B 2AHOB 4O5CA 2Z7JA 1JXLA 1YZ7A 4Y2RA 1N48A 2MSNA 4LVSA 3NRZA 1Z4OA 3RB6A 2HMXA 2ALZA 1HUZA 4UAYA 2P66A 3C2KA 1JN3A 1ZQ1C 2YTUA 2MUTA 5AHXA 3MABA 4I27A 2F1IA 1HEKA 3PSFA 1S0NA 2VA8A 3PW5A 2YB1A 2VA3A 2NRXA 3TFSA 2WFAA 4ED1A 3V6HA 1BVSA 5A0LA 2ZIWA 3FAHA 5KT2A 4I2HA 3CYMA 4RUAA 5J2BA 1SZHA 4UB3A 3N4MB 1ZQKA 3RR8A 2A19A 5ALHA 4UB4A 4M6WB 1U4BA 2PMZF 2PFNA 1S97A 2Y9TA 4M9NA 3S6JA 4MF2A 4Z6FA 5DB8A 4KLIA 4CDGA 1RXWA 8ICWA 2KK0A 2YY6A 3PSPA 5DLGA 3BS5A 1FIQA 8ICNA 2QB0A 3H8JA 3MGVA 4C80A 1C7YA 4OD0A 1KFSA 4RQMA 2LKYA 2MAXA 9ICRA 1RPLA 3UMGA 5J8YA 1ZQJA 3JPOA 4UAVA 7ICEA 4F5RA 3WK9A 3D2NA 4ELVA 5DB6A 2KVSA 4JMUA 4DOCA 4UB8U 2KJ8A 2CRXA 2ASJA 3ETLA 1LKYB 4Z6EA 4M2YA 3KZXA 1S76D 4XQ8A 2K89A 2NO5A 2CXYA 3PX4A 1DOQA 4RNNA 3HX0A 3C1ZA 3GU3A 5DDYA 5KT5A 5ALIA 3HP6A 4UQGA 2W9CB 4RUCA 4ECZA 4F4YA 5KFIA 1XNSA 3GIJA 8ICXA 1KKXA 4QZEA 4LZGA 2LM1A 3PV8A 5HHIA 3THVA 2WB1C 2YB4A 4GFJA 4RQNA 1TK5A 1SKSA 1MN8A 3ZDDA 7ICSA 5L1KA 2HVHA 4J9OA 3QU5A 2BCVA 3QU2A 1NKCA 3JPPA 5AI9A 1WWUA 2AQ0A 1JUDA 1ZQQA 4OJ6A 2ZTDA 4F2SA 4MFFA 5J0OA 3OSPA 3MC1A 4Q44A 4UBBA 4JV0A 3F5EA 5IIKA 2H3QA 5KT6A 1KTQA 2XO7A 4DO9A 4B9SA 4US9A 2XCAA 4CF4A 2ZIVA 1IV8A 1X66A 5AI6A 2UVWA 5KFVA 3UXPA 2OWOA 1T7PA 2DPJA 1WG8A 1S0OA 4KX5A 3OHBA 4O3SA 3SAHA 3Q8LA 1TAMA 4F3OA 7ICNA 2FMPA 2H5XA 2KJ9A 4F4KA 4YMMA 1ZQDA 3WK4A 5ALFA 3SD7A 1ZRMA 2C28A 2BCSA 4O3PA 3RJEA 4ED6A 4ECQA 4RNOA 2DKXA 3IHQB 4J9SA 2P6RA 3AQEA 4KLOA 2D8CA 5AKZA 1V97A 3RTVA 2XI9A 2NV3A 4J9NA 4U7CA 7ICLA 3UPQA 2LI6A 4MHVA 4NWIA 9ICAA 2NRZA 3TAPA 9ICWA 3WK6A 2HHSA 2FLPA 3CRXA 7ICRA 4YR3A 3WKDA 1PVPA 2KSOB 3BQ7A 1UCVA 2F77X 3ALRA 1UHUA 4ZOHC 2RRDA 3Q8QB 5KFPA 1ZQMA 3BZKA 1NKBA 2E8NA 3WKEA 4KLJA 4Y2XA 5AM4A 4QZAA 1N5XA 4I2EA 3V6JA 3H0MB 1TE2A 1ZD3A 2FMQA 3KZIU 4P0PA 3IM1A 4EZ9A 4ED3A 9ICEA 1Z4NA 1WUDA 3GZFA 4NLKA 4RT2A 5DDMA 2BKEA 4CGZA 1ZETA 1ZD4A 4QIWF 5IIJA 4EELA 5C5JA 4JK1A 4I2FA 3AMZA 5AK3A 4DQPA 4JWNA 1ZJNA 3NRWA 1ECWA 3GIMA 3SYZA 2ZUDA 3AU2A 2EZXA 5AKLA 1UA1A 4NLZA 2V4RA 5IIOA 2DKZA 4YXMA 5HMLA 2UVUA 1N63A 4QJFB 1FFUA 2BHNA 2W3SA 3H0RB 3KFUF 3QE9Y 5KG4A 2WF8A 2HSZA 4DLGA 4KLQA 5ALOA 2FLLA 2DF4B 4Y2QA 4NLCA 5DQHA 7ICHA 4P4MA 1NNLA 4TQRA 3PX6A 2ISOA 1TAUA 1Z00A 2G0AA 1SL1A 3AM9A 1NK0A 2W54A 2G07A 5ALMA 4FS2A 2JEIA 2NO4A 1V38A 2BZFA 2W8KA 2BQUA 2AU0A 4QWCA 3HKZC 4J9MA 4KITB 2XY7A 3PO4A 4EENA 3IG5A 3B0YA 1V9PA 1SZPA 4EX6A 1QTMA 4NLGA 5ALXA 1CUKA 4BWJA 1ZQLA 1FFVA 3RAQA 2D3DA 1B4FA 2W9BB 1SB3C 8ICBA 3OPXA 9ICUA 2JV3A 5J0TA 5J2HA 2R8IA 1VDVA 2R18A 1JXEA 5HMMA 5TISU 4BXOB 4DSFA 1L6NA 2NRWA 4QW9A 1DK3A 1JALA 2ZG6A 2A1JB 2W9MA 2WF7A 9ICLA 5GTIU 1A0PA 3AL0B 1N61A 5HNKA 4RT3A 4LZDA 2W55A 3WU2U 2ZJ5A 3IV6A 8ICOA 3PY8A 2I9GA 1BNOA 4OJ5A 2W03A 5KFNA 4G3IA 4MEYA 4F5QA 1TFRA 2K4PA 5ALPA 3EYZA 5J0XA 1YZ6A 9ICXA 1L5UA 3SMVA 4USAA 1N62A 2PI4A 3B0XA 1NK7A 2JXJA 4UB2A 1KDHA 5ALNA 1UA0A 2OM6A 1BPYA 3FYHA 3TADC 1L8LA 2RHFA 2JR5A 1SIJA 8ICYA 3ZDCA 2OXOA 3HWTA 2RLTA 3EWAA 1AROP 4QZ9A 1CRXA 2LPEA 3KBBA 2LBOA 4A8EA 5CA7A 4C4RA 2ZIUB 4QZ8A 3QXGA 4I28A 2P35A 4O3MA 4YD1A 2VA2A 4MEXA 2QKQA 3KHRA 2E8PA 3SAFA 3F2CA 4DQQA 1URJA 3LWMA 1NK9A 5DGAA 2FE9A 5KT3A 1KQQA 4DFDA 2ZXIA 7ICMA 1QQ5A 3JPRA 1SV0A 1PVQA 1JRPA 2C2RA 1PVRA 1ZQCA 1KFTA 2MUTB 2K4EA 1QCKA 4JWMA 1RYSA 2XVTA 7ICTA 4QZGA 3RH5A 4BWMA 4ECVA 1J2MA 4KLHA 4U6PA 2W43A 8ICCA 5AI0A 1P7DA 4M47A 3WKBA 3PMNA 2EDUA 2ZIWB 1BPXA 1XC9A 4YXJA 4KLGA 4PHEA 3QX7A 3PW0A 4FS1A 4O0IA 5ALUA 3NGDA 4LJXA 3MR6A 1L7PA 1BPZA 3C23A 3BDPA 3GQCA 4K4GA 3PZPA 9ICIA 5KFUA 3SV4A 3RJIA 2BCRA 3KKAC 1X2IA 5J8YC 1LVHA 4OO1J 2IHNA 4F93B 1X6JA 4ED0A 1NKEA 1RQNA 1RZTA 4JB3A 3BS5B 3ZDEA 4EYIB 2GLEA 5AKIA 2QB0B 3H8WA 2OYYA 2BQRA 3UQ0A 4R64A 3H8SA 1TKDA 4DQSA 1ZQIA 1F44A 1L7NA 4O9MA 3LVVA 5KFYA 2DPIA 3PR5B 4FO6A 2GOLA 4QZIA 3RJGA 9ICCA 4B9LA 4UBCA 9ICMA 1SV4A 4RU9A 1PZNA 4Y2PA 2R8GA 2ESEA 2K60A 4P4OA 7ICPA 3KTQA 7ICFA 4DOAA 3ICXA 2PFQA 2R8JA 2ASDA 2F76X 2HI0A 2K4IA 3I1YA 2QB1A 2IOFA 4NXZA 2PI5A 3SV3A 4YQWA 2KKVA 2K4HA 2F8KA 3V7JA 4GXKA 2HVIA 2BDUA 1UPHA 5E79U 2ZIXA 2PMZC 1KW4A 1X9MA 1PK3A 1PUZA 4DL3A 2HHXA 2FPMA 2BQ3A 3RFAA 1DGJA 8ICAA 3ISBA 1ED1A 4EBCA 2KV2A 2UVVA 3AEVA 3ED5A 3QNMA 3K75D 1NK4A 1SL0A 4IS7A 5HHHA 2Q4TA 2MRLA 4YG2A 5J2GA 4EBEA 3PW4A 4BUGA 1S0MA 4B6JA 3BQ1A 3C1YA 3R9KA 2OH2A 1ZQWA 1T3NA 4EYHB 4RQ4A 1RYUA 4IC9A 3LWLA 4ECRA 4KLUA 3ZDAA 2ZIVB 5EE3A 1JIHA 4KLTA 1COOA 3CP8A 3N7RC 1CEZA 1FEZA 2E5SA 3KKAA 5ALKA 5L1LA 2AGQA 2LYAA 2FPKA 3RB3A 3M9NB 5JRTA 5AKKA 1SKRA 4PHPA 3GV8B 3D2QA 3ZDBA 1XU4A 3T79A 3HJEA 1RXVA 2VJ4A 8ICUA 3ONNA 4QZFA 4IL6U 3QZ7A 2WF5A 8ICFA 2OEHA 2PXIA 2KJ5A 5AI5A 3T5JA 1ZYQA 5DKWA 1N56A 4ED2A 8ICHA 2VIXA 3F5AA 4KLEA 1ZQAA 3SZ2A 1L3SA 5J0YA 1XWLA 2K8AA 3Q8KA 4NV0A 5F3XB 2KOBA 5HR6A 1L7OA 4NL9A 3Q8PB 3RJKA 5AKEA 2D6FC 3BS7A 3FM9A 4QWEA 3MGHA 3G6YA 4QWDA 2EH9A 1K5OA 2KG5A 3PX0A 5EWEA 5KFRA 3KHLA 4DFMA 1YT3A 5ALVA 2DQNB 2NRTA 5CEHA 5DLFA 1X40A 2KE7A 3QU9A 4R8UA 4CNQA 3C28A 3IN5A 4F4ZA 8ICTA 4J9KA 2R8HA 2KMDA 2N1RA 1KFDA 5ALJA 3U26A 4P0PB 4F71A 4PZNA 4NM2A 5AIAA 2B0CA 7ICKA 4Y2VA 4KLDA 3I76A 4M0AA 4C7ZA 1SWVA 1RDFA 3QUQA 2ISPA 3PW7A 1UT5A 3M8SA 2UVRA 2F3NA 3UXOA 2KZZA 3M7DA 4P0QA 4QZCA 9ICTA 1LV5A 2OHFA 5KFDA 4IQWA 4DL5A 4JV1A 4KTQA 2JH7A 2M0NA 3RR7A 2J6TA 3ZD8A 2FI1A 3NVYA 2W8LA 3H40A 4J9QA 7ICOA 5AKGA 8ICLA 3BQTA 4PPXA 3GFKB 2EAOA 2YMPA 4F4WA 3OHAA 1Z00B 9ICFA 1ZQNA 2DWQA 3GILA 2IA6A 1CI4A 1SL2A 3RRHA 3MBYA 4UAWA 5J2AA 3LK9A 1XSLA 4DF4A 2FJ6A 4IQVA 3JPNA 2IOFK 2P6UA 3NS1A 2KVCA 2JEGA 5DBAA 5ALLA 5KG5A 5KFQA 5GTHU 4F91B 3DEEA 3QUBA 3RH4A 2AQ4A 3EUB2 4QIWC 1N60A 3AUOA 4GXIA 4QZDA 4FE3A 1S0VA 1J97A 4DOBA 1PK1A 5DBBA 2G5HB 4CF5A 5EWFA 4M9GA 1MC8A 2BR0A 5AM3A 1X9XA 4YD2A 1D8LA 5KL1B 5IILA 4RQ8A 4FBTA 3T5LA 3M1YA 1L7MA 5KG6A 8ICIA 3BQ2A 5DB7A 3AQFA 1ZXIA 2G5IB 2JZBA 1Q3UA 2HHTA 2KP7A 3HPOA 5KFTA 5AI8A 5KFAA 2B6GA 5DG8A 4UARA 8ICJA 2VKQA 2H3FA 4C8OA 3M6ZA 5ALZA 4C7YA 4Q8EA 4B9MA 5ALQA 4B9UA 3NVVA 2VJ5A 3EPGA 1NJYA 5L9XA 3OJUA 5J0UA 4BGDA 1HUOA 3C5GA 3QZ8A 3PW2A 1SV0C 1V85A 3KOOA 3QU7A 4TQSA 3MDAA 5EE9A 2E8MA 1C20A 4QWBA 3SI8A 3PR4A 3F2BA 4GC7A 3C5FA 1QSSA 5F9NA 4DFJA 4QW8A 3RJFA 5BOLA 1NJWA 2RQ5A 3LYSA 3HT3A 5J0RA 4GIBA 5J0SA 2Y0SF 1NZBA 4M9LA 1AQ6A 4E0DA 4F72A 5KT7A 5DQIA 9ICKA 2BPCA 3MFHA 5IIMA 5J2CA 4PZOA
chains in the Genus database with same CATH topology
2EANA 2KMDA 4RQMA 2K4PA 2F44A 2Y9UA 5J8YA 2E8OA 4PZNA 3K1RB 1SXDA 1UQVA 1X9XA 1RG6A 3KKAC 2DKZA 2QARA 5J8YC 2EAMA 3TADA 1SGGA 1SXEA 1LKYB 1B0XA 1COKA 3TADC 3BS5B 2F3NA 5L1MA 2GLEA 2LMRA 2QB0B 1PK1B 2DKXA 2KSOA 3KKAA 1WWVA 5KNIA 2LPEA 2D8CA 2ES6A 2YTUA 2B6GA 1V38A 2QARB 4MHVA 5JRTA 1SV4A 2QKQA 2E8PA 1PK1A 1DXSA 2ESEA 2K60A 2FE9A 5JTIA 1SV0A 2EAPA 1OXJA 2KSOB 1JI7A 2EAOA 3BQ7A 4RQNA 3IDWA 1UCVA 2D3DA 1B4FA 3H8MA 3HILA 1SV0C 2QB1A 2JV3A 2E8NA 3SEIA 1V85A 5JU5A 2F8KA 2KIVA 5F3XB 1WWUA 2E8MA 1OW5A 4NL9A 2L5YA 3BS7A 2Y9TA 4NJ8A 3SENA 1KW4A 1Z1VA 2KG5A 4NL9C 1PK3A 4IS7A 3TACB 1LKYA 1X40A 2KE7A 2DL0A 1X66A 3BS5A 2QB0A 1F0MA 4PZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAN A;  2KMD A;  4RQM A;  2K4P A;  2F44 A;  2Y9U A;  5J8Y A;  2E8O A;  4PZN A;  3K1R B;  1SXD A;  1UQV A;  1X9X A;  1RG6 A;  3KKA C;  2DKZ A;  2QAR A;  5J8Y C;  2EAM A;  3TAD A;  1SGG A;  1SXE A;  1LKY B;  1B0X A;  1COK A;  3TAD C;  3BS5 B;  2F3N A;  5L1M A;  2GLE A;  2LMR A;  2QB0 B;  1PK1 B;  2DKX A;  2KSO A;  3KKA A;  1WWV A;  5KNI A;  2LPE A;  2D8C A;  2ES6 A;  2YTU A;  2B6G A;  1V38 A;  2QAR B;  4MHV A;  5JRT A;  1SV4 A;  2QKQ A;  2E8P A;  1PK1 A;  1DXS A;  2ESE A;  2K60 A;  2FE9 A;  5JTI A;  1SV0 A;  2EAP A;  1OXJ A;  2KSO B;  1JI7 A;  2EAO A;  3BQ7 A;  4RQN A;  3IDW A;  1UCV A;  2D3D A;  1B4F A;  3H8M A;  3HIL A;  1SV0 C;  2QB1 A;  2JV3 A;  2E8N A;  3SEI A;  1V85 A;  5JU5 A;  2F8K A;  2KIV A;  5F3X B;  1WWU A;  2E8M A;  1OW5 A;  4NL9 A;  2L5Y A;  3BS7 A;  2Y9T A;  4NJ8 A;  3SEN A;  1KW4 A;  1Z1V A;  2KG5 A;  4NL9 C;  1PK3 A;  4IS7 A;  3TAC B;  1LKY A;  1X40 A;  2KE7 A;  2DL0 A;  1X66 A;  3BS5 A;  2QB0 A;  1F0M A;  4PZO A; 
#chains in the Genus database with same CATH topology
 1XO0 A;  4ECU A;  2F44 A;  2ZJ8 A;  3GV7 B;  2I6X A;  5B66 U;  2E8O A;  5KFE A;  4NLN A;  3O0F A;  5D46 A;  4RQ1 A;  2QAR A;  1NJX A;  2GH1 A;  5D49 A;  5KFM A;  4Y2U A;  4ED8 A;  1SGG A;  1ZQR A;  2HOI A;  4F2R A;  2LMR A;  4DF8 A;  1L3U A;  2XY6 A;  1KL9 A;  4EX7 A;  7ICJ A;  1WWV A;  5D4B A;  3UMC A;  3V72 A;  3OTQ A;  2KD1 A;  4UW9 A;  7ICV A;  2KZM A;  2IOH A;  4WJ3 B;  2LHT A;  1RYR A;  4KLM A;  7ICU A;  1ZQB A;  3QUT A;  2YMM A;  4O3Q A;  4J9L A;  3L3F X;  2WF9 A;  5AIC A;  4YP3 A;  1OXJ A;  1JI7 A;  2PFO A;  4DFK A;  5J2E A;  1ZQH A;  2FPL A;  3BZC A;  8ICE A;  5AM1 A;  2WTF A;  2XGP A;  4I29 A;  3RB0 A;  1NI3 A;  1T94 A;  2A3V A;  4RQ2 A;  4MFA A;  3RRG A;  1MQ2 A;  4EBD A;  4OJL A;  5KG0 A;  5J2I A;  1A6S A;  4IR9 A;  5KFH A;  4Z6D A;  4NJ8 A;  3TQ1 A;  2IMW P;  4Y2S A;  4K4I A;  2I1Q A;  1K1Q A;  5CHG A;  2IHM A;  2ODG A;  1Z3E B;  1WCL A;  2BDP A;  4DS4 A;  2WAQ F;  5H2F U;  1U49 A;  5J2J A;  2DGZ A;  1Y88 A;  3RBE A;  2ZJA A;  5KG1 A;  2ZIX B;  5ALE A;  4DSK A;  3K1R B;  4DQR A;  2H3V A;  3UM9 A;  1RG6 A;  3CW2 C;  3UMB A;  1GO3 F;  4PHA A;  3C2M A;  3GV5 B;  1ZQF A;  1LB2 B;  4OCZ A;  2G06 A;  5DQG A;  1Q8K A;  4F50 A;  2PFP A;  3TI0 A;  3H0L B;  2YML A;  4RQ5 A;  4X5V A;  1ZQS A;  3PNC A;  1NK5 A;  3J81 j;  8ICM A;  4YMO A;  3PML A;  1BPD A;  4HAI A;  1ZQU A;  3MR3 A;  4P2H A;  1ZQT A;  1H38 A;  1QQ7 A;  1U45 A;  1BPE A;  4B9T A;  1TAQ A;  4K4H A;  2FMS A;  2LYH A;  1DXS A;  3RJJ A;  3NUQ A;  4KN4 A;  5III A;  4F5N A;  4OJP A;  8ICS A;  5J29 A;  1EXN A;  2EAP A;  4RQ6 A;  4ED7 A;  4C8M A;  1QQ6 A;  2DFL A;  3TAN A;  2JMG A;  4IRC A;  2RDJ A;  4Y2Y A;  8ICZ A;  3H8M A;  1QSY A;  2JRZ A;  1NJZ A;  1ZQZ A;  2F8L A;  3RH6 A;  4XRH A;  1T4G A;  3NTU A;  5DGB A;  1OW5 A;  1U47 A;  3SAG A;  1N2X A;  2AJQ A;  2E3T A;  1X9W A;  1IIP A;  7ICG A;  3H7I A;  3C21 A;  3SEN A;  4NL9 C;  5B5E U;  1XSP A;  4GLX A;  3M9O B;  2YQE A;  2W7P A;  4QWA A;  4EZ6 A;  8ICV A;  1XO1 A;  4I2J A;  4DWI A;  1S9F A;  4F5O A;  2KFZ A;  2DL0 A;  3DV9 A;  2BPG A;  3M9M B;  5DG7 A;  3K4G A;  4TUP A;  4ECS A;  2Y9U A;  3TAQ A;  5BOM A;  5AKX A;  1ZD2 P;  5KFW A;  3HW8 A;  2AGP A;  2C22 A;  3QEB Z;  2H3Z A;  1IG6 A;  2ZTE A;  2R8K A;  1SXE A;  4PJ0 U;  1ZQY A;  1B0X A;  4R8U B;  3Q8M A;  2KEY A;  5KT4 A;  3E58 A;  4F4X A;  3RBD A;  4BJQ A;  5HP4 A;  4XUS A;  4IRK A;  2VAN A;  3UXN A;  2CN1 A;  3ISD A;  3H4B A;  8ICR A;  1RM6 C;  9ICP A;  5KG7 A;  2JH1 A;  4QZH A;  4DLE A;  5J0P A;  4C8N A;  1DGS A;  2H3I A;  3JPQ A;  4YCX A;  3F2D A;  5JUM A;  1ZQE A;  3I28 A;  1J2N A;  1S5L U;  3TAR A;  4O5K A;  1JRO A;  4EEK A;  5ALT A;  3EZ5 A;  4P0Q B;  4O3O A;  2HOF A;  3MGI A;  2NYV A;  1FO4 A;  5KFZ A;  3IDW A;  1B22 A;  5KFJ A;  8ICK A;  2RDI A;  4Y2J A;  2KNJ A;  4Q8F A;  3HRD D;  2G09 A;  1T8E A;  3SEI A;  4DCC A;  4C4S A;  1O03 A;  1X9S A;  1S77 D;  1X6I A;  4PL1 A;  2J6U A;  4DL2 A;  3V7L A;  5C0Y A;  1ZQP A;  2L5Y A;  3D6J A;  2EQY A;  3WK5 A;  2W7O A;  2XGQ A;  1K1S A;  3TFR A;  4KLF A;  2PKE A;  4FZN A;  4TUQ A;  2HBK A;  1VLB A;  2CPR A;  5AKY A;  3N28 A;  1MSW D;  4YN4 A;  4EEY A;  4KMO B;  2JGA A;  3NVW A;  2HDO A;  3NAS A;  5AM0 A;  4RPZ A;  2KIW A;  4ACO A;  8ICP A;  3T5H A;  4F8R A;  5CP2 A;  4DFP A;  4F5P A;  1U9L A;  3V6K A;  3AN1 A;  4FZL A;  2V4Q A;  5J2D A;  1D9D A;  1QLN A;  4KLS A;  5KFG A;  3MR2 A;  5KG2 A;  1KSP A;  4XA5 A;  4M9H A;  4J03 A;  4O3R A;  1PK1 B;  3A0H U;  3PSI A;  2FDR A;  4C4T A;  4IRD A;  2ES6 A;  2RP5 A;  5KFO A;  4UAZ A;  4RQ0 A;  3G6X A;  4FBU A;  5CB1 A;  1Q3V A;  4YR2 A;  1A77 A;  2WHE A;  3B9J A;  3TKA A;  1KLN A;  2K8C B;  5KAF U;  4I2I A;  1NZP A;  2ZXH A;  9ICV A;  2Q0Z X;  2Y1I A;  2WB1 F;  4PHD A;  1L8O A;  4M6W A;  1OUQ A;  1SKW A;  3N7P D;  5FP0 A;  4PGX A;  1BGX T;  3EW9 A;  2JZB B;  3UQ2 A;  2HW3 A;  1TVA A;  4RQ7 A;  4DQI A;  5KAI U;  4J9R A;  4Q45 A;  5ALR A;  3GDX A;  1A76 A;  4QNL A;  4J9P A;  2KIV A;  3OGU A;  1HJP A;  3ORY A;  2XCP A;  3BJY A;  1ZQO A;  3WKA A;  5AK5 A;  4C0Z A;  5AIB A;  1HIW A;  1MQ3 A;  2V9W A;  3F53 A;  1TV9 A;  1NK8 A;  4JUZ A;  3WK8 A;  5J2K A;  1Z1V A;  5KFF A;  1X42 A;  5G5H A;  4OJO A;  3FDS A;  1LKY A;  3PO5 A;  2A1A A;  1U48 A;  4DSL A;  5BPC A;  4UB6 U;  4O3N A;  3KD3 A;  2KHQ A;  4ELT A;  2W11 A;  1O08 A;  2BCU A;  1T3Q A;  1UQV A;  5EE1 A;  4RNM A;  4PGQ A;  4YVZ A;  4IQU A;  2EAM A;  2HHV A;  4I2A A;  3H4D A;  2W9C A;  2K8B B;  4MFC A;  1Z1B A;  4IR1 A;  4G9B A;  2YMQ A;  5CRX A;  2KZ3 A;  2G08 A;  3C2L A;  1ZD5 A;  5AM5 A;  3PST A;  3RB4 A;  3M6K A;  5ALD A;  4FFD A;  2WF6 A;  5KFK A;  1BNP A;  3JPT A;  2QAR B;  3VCB A;  2LM4 A;  9ICG A;  4M9J A;  4HYK A;  5DB9 A;  2O6K A;  2XY5 A;  5KFB A;  1ZQV A;  9ICN A;  1F5S A;  7ICQ A;  1VJ5 A;  4GC6 A;  3GII A;  4KLL A;  3MR5 A;  9ICQ A;  4DEZ A;  3ZI4 A;  4TUS A;  1JX4 A;  2XIC A;  2JEJ A;  3QU4 A;  5L1I A;  5CWR A;  1ZJM A;  1XSN A;  1IM4 A;  5AM2 A;  5JU5 A;  4AYB C;  2BGW A;  3IP4 B;  4CF3 A;  4AP9 A;  2XID A;  1KBU A;  2FLN A;  2HHW A;  2DUY A;  1L3V A;  1S8O A;  2KKP A;  2F2A B;  4KX3 A;  4ECW A;  4NLB A;  2GWS A;  5EWG A;  1ZOL A;  4RZR A;  3WK7 A;  4Z6C A;  4AYB F;  3MFI A;  2HHQ A;  3DDH A;  8ICQ A;  2Y0S C;  4CCH A;  2ASL A;  2E1E A;  1QSL A;  2BPF A;  3ISC A;  2ZTC A;  1F0M A;  1SWW A;  1S10 A;  9ICJ A;  9ICO A;  2EAN A;  3OSN A;  5AKJ A;  1UT8 A;  3T3F A;  3G6V A;  4MF8 A;  4IQT A;  1D9F A;  4B9V A;  1ZQG A;  5KFL A;  3IG8 A;  2IBK A;  1QH9 A;  1KRP A;  5EOZ A;  5L1M A;  2HBL A;  2HOQ A;  4RPY A;  3RF9 A;  2Y1J A;  4UAT A;  4R63 A;  3RAX A;  2KSO A;  4PH5 A;  5CR0 A;  4NM1 A;  5KNI A;  5KFC A;  3L5K A;  2C2E A;  2NRV A;  4DL6 A;  5KL8 B;  3N7S C;  2YN4 A;  4DSI A;  4PGY A;  3HKZ F;  4YFK A;  4C8K A;  3L4P A;  4JV2 A;  1KEJ A;  1WCN A;  1ZRN A;  4RPX A;  3QUC A;  3OJS A;  4B9N A;  4US8 A;  4UB1 A;  2HBJ A;  3SR6 A;  3CNH A;  5CJ7 A;  2ATL A;  2JEF A;  2BCQ A;  1JMS A;  4UAS A;  5KFS A;  4R66 A;  2KTQ A;  3PVX A;  5AI4 A;  2B21 A;  2GO7 A;  5ALS A;  3IRU A;  4DL4 A;  3GIK A;  1DRG A;  2YX8 A;  4C8L A;  2F1H A;  3ETR A;  3KHG A;  1L3T A;  4BDP A;  3D2S A;  2XC9 A;  5KG3 A;  1TK8 A;  5J0W A;  3E2E A;  4DSJ A;  1Q46 A;  2HBM A;  4UB5 A;  4DL7 A;  5F9L A;  2AXT U;  4M04 A;  9ICH A;  3E0F A;  4QZB A;  4UAU A;  2MA1 A;  2E1F A;  3EPI A;  1WYG A;  5EE0 A;  5L1J A;  4Q43 A;  1IXR A;  1NOM A;  4R65 A;  7ICI A;  3SQI A;  2WAQ C;  5IIN A;  1RQL A;  4CE6 A;  4F92 B;  2LYB A;  3M8R A;  3C29 A;  4DS5 A;  2W9A A;  1M6Y A;  3JPS A;  1MA7 A;  5HR7 A;  2ZUC A;  1D8Y A;  3LDA A;  2F1J A;  5TZV A;  2KIC A;  3AU6 A;  2KHV A;  1COK A;  4BX9 C;  1D8B A;  4YMN A;  4FZM A;  3RJH A;  3WKC A;  4ZH4 A;  5J0Q A;  4ELU A;  2W3R A;  2KN7 A;  4Y2T A;  2OCE A;  3MDC A;  2ZUB A;  4RQ3 A;  5ALY A;  4ECX A;  5DBC A;  2W9B A;  2M9N A;  1N5W A;  9ICS A;  4BXO A;  1NK6 A;  2JHD A;  4P4P A;  3BQ0 A;  2J6S A;  2I5H A;  3ZD9 A;  5T14 A;  5JTI A;  2A1J A;  4CRX A;  5J2F A;  2EZY A;  8ICG A;  4ICA A;  2W04 A;  4KMU A;  1DK2 A;  4YR0 A;  4ECT A;  1TK0 A;  5AK4 A;  3HIL A;  3VC8 A;  5G5G A;  5AKH A;  3V7K A;  1B43 A;  2KFN A;  5DG9 A;  3LVW A;  3T5K A;  4I2B A;  4GXJ A;  2EZZ A;  2MU2 A;  3QYP A;  1ZQX A;  5ALW A;  4I2C A;  2AGO A;  5K4L A;  4DSE A;  5KFX A;  2C2D A;  3TAC B;  1Z19 A;  3A0B U;  3K1Z A;  1BPB A;  4O5E A;  5ALG A;  2HHU A;  4TUR A;  3QEA Z;  2AH5 A;  3FC4 A;  1XS9 D;  2HCF A;  4ECY A;  4PL2 A;  4NY8 A;  9ICB A;  4I2G A;  3Q8S B;  2QLT A;  2ZIU A;  1SXD A;  3NVZ A;  4KN7 A;  3Q8R B;  4I2D A;  1KN5 A;  3KHH A;  3TAD A;  5KTQ A;  2DBY A;  5AK6 A;  3N97 B;  2AHO B;  4O5C A;  2Z7J A;  1JXL A;  1YZ7 A;  4Y2R A;  1N48 A;  2MSN A;  4LVS A;  3NRZ A;  1Z4O A;  3RB6 A;  2HMX A;  2ALZ A;  1HUZ A;  4UAY A;  2P66 A;  3C2K A;  1JN3 A;  1ZQ1 C;  2YTU A;  2MUT A;  5AHX A;  3MAB A;  4I27 A;  2F1I A;  1HEK A;  3PSF A;  1S0N A;  2VA8 A;  3PW5 A;  2YB1 A;  2VA3 A;  2NRX A;  3TFS A;  2WFA A;  4ED1 A;  3V6H A;  1BVS A;  5A0L A;  2ZIW A;  3FAH A;  5KT2 A;  4I2H A;  3CYM A;  4RUA A;  5J2B A;  1SZH A;  4UB3 A;  3N4M B;  1ZQK A;  3RR8 A;  2A19 A;  5ALH A;  4UB4 A;  4M6W B;  1U4B A;  2PMZ F;  2PFN A;  1S97 A;  2Y9T A;  4M9N A;  3S6J A;  4MF2 A;  4Z6F A;  5DB8 A;  4KLI A;  4CDG A;  1RXW A;  8ICW A;  2KK0 A;  2YY6 A;  3PSP A;  5DLG A;  3BS5 A;  1FIQ A;  8ICN A;  2QB0 A;  3H8J A;  3MGV A;  4C80 A;  1C7Y A;  4OD0 A;  1KFS A;  4RQM A;  2LKY A;  2MAX A;  9ICR A;  1RPL A;  3UMG A;  5J8Y A;  1ZQJ A;  3JPO A;  4UAV A;  7ICE A;  4F5R A;  3WK9 A;  3D2N A;  4ELV A;  5DB6 A;  2KVS A;  4JMU A;  4DOC A;  4UB8 U;  2KJ8 A;  2CRX A;  2ASJ A;  3ETL A;  1LKY B;  4Z6E A;  4M2Y A;  3KZX A;  1S76 D;  4XQ8 A;  2K89 A;  2NO5 A;  2CXY A;  3PX4 A;  1DOQ A;  4RNN A;  3HX0 A;  3C1Z A;  3GU3 A;  5DDY A;  5KT5 A;  5ALI A;  3HP6 A;  4UQG A;  2W9C B;  4RUC A;  4ECZ A;  4F4Y A;  5KFI A;  1XNS A;  3GIJ A;  8ICX A;  1KKX A;  4QZE A;  4LZG A;  2LM1 A;  3PV8 A;  5HHI A;  3THV A;  2WB1 C;  2YB4 A;  4GFJ A;  4RQN A;  1TK5 A;  1SKS A;  1MN8 A;  3ZDD A;  7ICS A;  5L1K A;  2HVH A;  4J9O A;  3QU5 A;  2BCV A;  3QU2 A;  1NKC A;  3JPP A;  5AI9 A;  1WWU A;  2AQ0 A;  1JUD A;  1ZQQ A;  4OJ6 A;  2ZTD A;  4F2S A;  4MFF A;  5J0O A;  3OSP A;  3MC1 A;  4Q44 A;  4UBB A;  4JV0 A;  3F5E A;  5IIK A;  2H3Q A;  5KT6 A;  1KTQ A;  2XO7 A;  4DO9 A;  4B9S A;  4US9 A;  2XCA A;  4CF4 A;  2ZIV A;  1IV8 A;  1X66 A;  5AI6 A;  2UVW A;  5KFV A;  3UXP A;  2OWO A;  1T7P A;  2DPJ A;  1WG8 A;  1S0O A;  4KX5 A;  3OHB A;  4O3S A;  3SAH A;  3Q8L A;  1TAM A;  4F3O A;  7ICN A;  2FMP A;  2H5X A;  2KJ9 A;  4F4K A;  4YMM A;  1ZQD A;  3WK4 A;  5ALF A;  3SD7 A;  1ZRM A;  2C28 A;  2BCS A;  4O3P A;  3RJE A;  4ED6 A;  4ECQ A;  4RNO A;  2DKX A;  3IHQ B;  4J9S A;  2P6R A;  3AQE A;  4KLO A;  2D8C A;  5AKZ A;  1V97 A;  3RTV A;  2XI9 A;  2NV3 A;  4J9N A;  4U7C A;  7ICL A;  3UPQ A;  2LI6 A;  4MHV A;  4NWI A;  9ICA A;  2NRZ A;  3TAP A;  9ICW A;  3WK6 A;  2HHS A;  2FLP A;  3CRX A;  7ICR A;  4YR3 A;  3WKD A;  1PVP A;  2KSO B;  3BQ7 A;  1UCV A;  2F77 X;  3ALR A;  1UHU A;  4ZOH C;  2RRD A;  3Q8Q B;  5KFP A;  1ZQM A;  3BZK A;  1NKB A;  2E8N A;  3WKE A;  4KLJ A;  4Y2X A;  5AM4 A;  4QZA A;  1N5X A;  4I2E A;  3V6J A;  3H0M B;  1TE2 A;  1ZD3 A;  2FMQ A;  3KZI U;  4P0P A;  3IM1 A;  4EZ9 A;  4ED3 A;  9ICE A;  1Z4N A;  1WUD A;  3GZF A;  4NLK A;  4RT2 A;  5DDM A;  2BKE A;  4CGZ A;  1ZET A;  1ZD4 A;  4QIW F;  5IIJ A;  4EEL A;  5C5J A;  4JK1 A;  4I2F A;  3AMZ A;  5AK3 A;  4DQP A;  4JWN A;  1ZJN A;  3NRW A;  1ECW A;  3GIM A;  3SYZ A;  2ZUD A;  3AU2 A;  2EZX A;  5AKL A;  1UA1 A;  4NLZ A;  2V4R A;  5IIO A;  2DKZ A;  4YXM A;  5HML A;  2UVU A;  1N63 A;  4QJF B;  1FFU A;  2BHN A;  2W3S A;  3H0R B;  3KFU F;  3QE9 Y;  5KG4 A;  2WF8 A;  2HSZ A;  4DLG A;  4KLQ A;  5ALO A;  2FLL A;  2DF4 B;  4Y2Q A;  4NLC A;  5DQH A;  7ICH A;  4P4M A;  1NNL A;  4TQR A;  3PX6 A;  2ISO A;  1TAU A;  1Z00 A;  2G0A A;  1SL1 A;  3AM9 A;  1NK0 A;  2W54 A;  2G07 A;  5ALM A;  4FS2 A;  2JEI A;  2NO4 A;  1V38 A;  2BZF A;  2W8K A;  2BQU A;  2AU0 A;  4QWC A;  3HKZ C;  4J9M A;  4KIT B;  2XY7 A;  3PO4 A;  4EEN A;  3IG5 A;  3B0Y A;  1V9P A;  1SZP A;  4EX6 A;  1QTM A;  4NLG A;  5ALX A;  1CUK A;  4BWJ A;  1ZQL A;  1FFV A;  3RAQ A;  2D3D A;  1B4F A;  2W9B B;  1SB3 C;  8ICB A;  3OPX A;  9ICU A;  2JV3 A;  5J0T A;  5J2H A;  2R8I A;  1VDV A;  2R18 A;  1JXE A;  5HMM A;  5TIS U;  4BXO B;  4DSF A;  1L6N A;  2NRW A;  4QW9 A;  1DK3 A;  1JAL A;  2ZG6 A;  2A1J B;  2W9M A;  2WF7 A;  9ICL A;  5GTI U;  1A0P A;  3AL0 B;  1N61 A;  5HNK A;  4RT3 A;  4LZD A;  2W55 A;  3WU2 U;  2ZJ5 A;  3IV6 A;  8ICO A;  3PY8 A;  2I9G A;  1BNO A;  4OJ5 A;  2W03 A;  5KFN A;  4G3I A;  4MEY A;  4F5Q A;  1TFR A;  2K4P A;  5ALP A;  3EYZ A;  5J0X A;  1YZ6 A;  9ICX A;  1L5U A;  3SMV A;  4USA A;  1N62 A;  2PI4 A;  3B0X A;  1NK7 A;  2JXJ A;  4UB2 A;  1KDH A;  5ALN A;  1UA0 A;  2OM6 A;  1BPY A;  3FYH A;  3TAD C;  1L8L A;  2RHF A;  2JR5 A;  1SIJ A;  8ICY A;  3ZDC A;  2OXO A;  3HWT A;  2RLT A;  3EWA A;  1ARO P;  4QZ9 A;  1CRX A;  2LPE A;  3KBB A;  2LBO A;  4A8E A;  5CA7 A;  4C4R A;  2ZIU B;  4QZ8 A;  3QXG A;  4I28 A;  2P35 A;  4O3M A;  4YD1 A;  2VA2 A;  4MEX A;  2QKQ A;  3KHR A;  2E8P A;  3SAF A;  3F2C A;  4DQQ A;  1URJ A;  3LWM A;  1NK9 A;  5DGA A;  2FE9 A;  5KT3 A;  1KQQ A;  4DFD A;  2ZXI A;  7ICM A;  1QQ5 A;  3JPR A;  1SV0 A;  1PVQ A;  1JRP A;  2C2R A;  1PVR A;  1ZQC A;  1KFT A;  2MUT B;  2K4E A;  1QCK A;  4JWM A;  1RYS A;  2XVT A;  7ICT A;  4QZG A;  3RH5 A;  4BWM A;  4ECV A;  1J2M A;  4KLH A;  4U6P A;  2W43 A;  8ICC A;  5AI0 A;  1P7D A;  4M47 A;  3WKB A;  3PMN A;  2EDU A;  2ZIW B;  1BPX A;  1XC9 A;  4YXJ A;  4KLG A;  4PHE A;  3QX7 A;  3PW0 A;  4FS1 A;  4O0I A;  5ALU A;  3NGD A;  4LJX A;  3MR6 A;  1L7P A;  1BPZ A;  3C23 A;  3BDP A;  3GQC A;  4K4G A;  3PZP A;  9ICI A;  5KFU A;  3SV4 A;  3RJI A;  2BCR A;  3KKA C;  1X2I A;  5J8Y C;  1LVH A;  4OO1 J;  2IHN A;  4F93 B;  1X6J A;  4ED0 A;  1NKE A;  1RQN A;  1RZT A;  4JB3 A;  3BS5 B;  3ZDE A;  4EYI B;  2GLE A;  5AKI A;  2QB0 B;  3H8W A;  2OYY A;  2BQR A;  3UQ0 A;  4R64 A;  3H8S A;  1TKD A;  4DQS A;  1ZQI A;  1F44 A;  1L7N A;  4O9M A;  3LVV A;  5KFY A;  2DPI A;  3PR5 B;  4FO6 A;  2GOL A;  4QZI A;  3RJG A;  9ICC A;  4B9L A;  4UBC A;  9ICM A;  1SV4 A;  4RU9 A;  1PZN A;  4Y2P A;  2R8G A;  2ESE A;  2K60 A;  4P4O A;  7ICP A;  3KTQ A;  7ICF A;  4DOA A;  3ICX A;  2PFQ A;  2R8J A;  2ASD A;  2F76 X;  2HI0 A;  2K4I A;  3I1Y A;  2QB1 A;  2IOF A;  4NXZ A;  2PI5 A;  3SV3 A;  4YQW A;  2KKV A;  2K4H A;  2F8K A;  3V7J A;  4GXK A;  2HVI A;  2BDU A;  1UPH A;  5E79 U;  2ZIX A;  2PMZ C;  1KW4 A;  1X9M A;  1PK3 A;  1PUZ A;  4DL3 A;  2HHX A;  2FPM A;  2BQ3 A;  3RFA A;  1DGJ A;  8ICA A;  3ISB A;  1ED1 A;  4EBC A;  2KV2 A;  2UVV A;  3AEV A;  3ED5 A;  3QNM A;  3K75 D;  1NK4 A;  1SL0 A;  4IS7 A;  5HHH A;  2Q4T A;  2MRL A;  4YG2 A;  5J2G A;  4EBE A;  3PW4 A;  4BUG A;  1S0M A;  4B6J A;  3BQ1 A;  3C1Y A;  3R9K A;  2OH2 A;  1ZQW A;  1T3N A;  4EYH B;  4RQ4 A;  1RYU A;  4IC9 A;  3LWL A;  4ECR A;  4KLU A;  3ZDA A;  2ZIV B;  5EE3 A;  1JIH A;  4KLT A;  1COO A;  3CP8 A;  3N7R C;  1CEZ A;  1FEZ A;  2E5S A;  3KKA A;  5ALK A;  5L1L A;  2AGQ A;  2LYA A;  2FPK A;  3RB3 A;  3M9N B;  5JRT A;  5AKK A;  1SKR A;  4PHP A;  3GV8 B;  3D2Q A;  3ZDB A;  1XU4 A;  3T79 A;  3HJE A;  1RXV A;  2VJ4 A;  8ICU A;  3ONN A;  4QZF A;  4IL6 U;  3QZ7 A;  2WF5 A;  8ICF A;  2OEH A;  2PXI A;  2KJ5 A;  5AI5 A;  3T5J A;  1ZYQ A;  5DKW A;  1N56 A;  4ED2 A;  8ICH A;  2VIX A;  3F5A A;  4KLE A;  1ZQA A;  3SZ2 A;  1L3S A;  5J0Y A;  1XWL A;  2K8A A;  3Q8K A;  4NV0 A;  5F3X B;  2KOB A;  5HR6 A;  1L7O A;  4NL9 A;  3Q8P B;  3RJK A;  5AKE A;  2D6F C;  3BS7 A;  3FM9 A;  4QWE A;  3MGH A;  3G6Y A;  4QWD A;  2EH9 A;  1K5O A;  2KG5 A;  3PX0 A;  5EWE A;  5KFR A;  3KHL A;  4DFM A;  1YT3 A;  5ALV A;  2DQN B;  2NRT A;  5CEH A;  5DLF A;  1X40 A;  2KE7 A;  3QU9 A;  4R8U A;  4CNQ A;  3C28 A;  3IN5 A;  4F4Z A;  8ICT A;  4J9K A;  2R8H A;  2KMD A;  2N1R A;  1KFD A;  5ALJ A;  3U26 A;  4P0P B;  4F71 A;  4PZN A;  4NM2 A;  5AIA A;  2B0C A;  7ICK A;  4Y2V A;  4KLD A;  3I76 A;  4M0A A;  4C7Z A;  1SWV A;  1RDF A;  3QUQ A;  2ISP A;  3PW7 A;  1UT5 A;  3M8S A;  2UVR A;  2F3N A;  3UXO A;  2KZZ A;  3M7D A;  4P0Q A;  4QZC A;  9ICT A;  1LV5 A;  2OHF A;  5KFD A;  4IQW A;  4DL5 A;  4JV1 A;  4KTQ A;  2JH7 A;  2M0N A;  3RR7 A;  2J6T A;  3ZD8 A;  2FI1 A;  3NVY A;  2W8L A;  3H40 A;  4J9Q A;  7ICO A;  5AKG A;  8ICL A;  3BQT A;  4PPX A;  3GFK B;  2EAO A;  2YMP A;  4F4W A;  3OHA A;  1Z00 B;  9ICF A;  1ZQN A;  2DWQ A;  3GIL A;  2IA6 A;  1CI4 A;  1SL2 A;  3RRH A;  3MBY A;  4UAW A;  5J2A A;  3LK9 A;  1XSL A;  4DF4 A;  2FJ6 A;  4IQV A;  3JPN A;  2IOF K;  2P6U A;  3NS1 A;  2KVC A;  2JEG A;  5DBA A;  5ALL A;  5KG5 A;  5KFQ A;  5GTH U;  4F91 B;  3DEE A;  3QUB A;  3RH4 A;  2AQ4 A;  3EUB 2;  4QIW C;  1N60 A;  3AUO A;  4GXI A;  4QZD A;  4FE3 A;  1S0V A;  1J97 A;  4DOB A;  1PK1 A;  5DBB A;  2G5H B;  4CF5 A;  5EWF A;  4M9G A;  1MC8 A;  2BR0 A;  5AM3 A;  1X9X A;  4YD2 A;  1D8L A;  5KL1 B;  5IIL A;  4RQ8 A;  4FBT A;  3T5L A;  3M1Y A;  1L7M A;  5KG6 A;  8ICI A;  3BQ2 A;  5DB7 A;  3AQF A;  1ZXI A;  2G5I B;  2JZB A;  1Q3U A;  2HHT A;  2KP7 A;  3HPO A;  5KFT A;  5AI8 A;  5KFA A;  2B6G A;  5DG8 A;  4UAR A;  8ICJ A;  2VKQ A;  2H3F A;  4C8O A;  3M6Z A;  5ALZ A;  4C7Y A;  4Q8E A;  4B9M A;  5ALQ A;  4B9U A;  3NVV A;  2VJ5 A;  3EPG A;  1NJY A;  5L9X A;  3OJU A;  5J0U A;  4BGD A;  1HUO A;  3C5G A;  3QZ8 A;  3PW2 A;  1SV0 C;  1V85 A;  3KOO A;  3QU7 A;  4TQS A;  3MDA A;  5EE9 A;  2E8M A;  1C20 A;  4QWB A;  3SI8 A;  3PR4 A;  3F2B A;  4GC7 A;  3C5F A;  1QSS A;  5F9N A;  4DFJ A;  4QW8 A;  3RJF A;  5BOL A;  1NJW A;  2RQ5 A;  3LYS A;  3HT3 A;  5J0R A;  4GIB A;  5J0S A;  2Y0S F;  1NZB A;  4M9L A;  1AQ6 A;  4E0D A;  4F72 A;  5KT7 A;  5DQI A;  9ICK A;  2BPC A;  3MFH A;  5IIM A;  5J2C A;  4PZO A; 
#chains in the Genus database with same CATH homology
 2EAN A;  2KMD A;  4RQM A;  2K4P A;  2F44 A;  2Y9U A;  5J8Y A;  2E8O A;  4PZN A;  3K1R B;  1SXD A;  1UQV A;  1X9X A;  1RG6 A;  3KKA C;  2DKZ A;  2QAR A;  5J8Y C;  2EAM A;  3TAD A;  1SGG A;  1SXE A;  1LKY B;  1B0X A;  1COK A;  3TAD C;  3BS5 B;  2F3N A;  5L1M A;  2GLE A;  2LMR A;  2QB0 B;  1PK1 B;  2DKX A;  2KSO A;  3KKA A;  1WWV A;  5KNI A;  2LPE A;  2D8C A;  2ES6 A;  2YTU A;  2B6G A;  1V38 A;  2QAR B;  4MHV A;  5JRT A;  1SV4 A;  2QKQ A;  2E8P A;  1PK1 A;  1DXS A;  2ESE A;  2K60 A;  2FE9 A;  5JTI A;  1SV0 A;  2EAP A;  1OXJ A;  2KSO B;  1JI7 A;  2EAO A;  3BQ7 A;  4RQN A;  3IDW A;  1UCV A;  2D3D A;  1B4F A;  3H8M A;  3HIL A;  1SV0 C;  2QB1 A;  2JV3 A;  2E8N A;  3SEI A;  1V85 A;  5JU5 A;  2F8K A;  2KIV A;  5F3X B;  1WWU A;  2E8M A;  1OW5 A;  4NL9 A;  2L5Y A;  3BS7 A;  2Y9T A;  4NJ8 A;  3SEN A;  1KW4 A;  1Z1V A;  2KG5 A;  4NL9 C;  1PK3 A;  4IS7 A;  3TAC B;  1LKY A;  1X40 A;  2KE7 A;  2DL0 A;  1X66 A;  3BS5 A;  2QB0 A;  1F0M A;  4PZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...