2JV3A

Ets-1 pnt domain (29-138) nmr structure ensemble
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
110
structure length
110
Chain Sequence
MECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMSGAALCALGKECFLELAPDFVGDILWEHLEILQKEDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ets-1 PNT domain (29-138) NMR structure ensemble
rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords ETS1 proto-oncogene
total genus 32
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2007-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02198 SAM_PNT Sterile alpha motif (SAM)/Pointed domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2jv3A01
1JI7A 1PK1A 4RQNA 2LMRA 5L1MA 5JU5A 4PZOA 3BS5A 2F3NA 2E8OA 1X66A 2DL0A 2EAMA 1COKA 2KSOB 4NL9C 2DKXA 2QB1A 2JV3A 2ES6A 5J8YA 2Y9UA 2E8PA 2E8NA 5KNIA 2KSOA 1SXDA 2K60A 1DXSA 3BQ7A 4NL9A 4RQMA 5JRTA 2E8MA 1B0XA 2YTUA 2K4PA 3BS7A 2FE9A 2F44A 1PK1B 3KKAC 1WWVA 2F8KA 4IS7A 1X9XA 5J8YC 1RG6A 3IDWA 3K1RB 3SENA 1LKYA 3KKAA 1SV0C 1UQVA 2KE7A 3SEIA 5JTIA 1B4FA 2QARB 2B6GA 1SGGA 2Y9TA 2EAOA 4MHVA 1OW5A 2D3DA 1UCVA 2QB0A 3TADC 1F0MA 1PK3A 3BS5B 2D8CA 1LKYB 1SV4A 1V85A 3TACB 2KMDA 1KW4A 2L5YA 2QKQA 1SV0A 1V38A 2DKZA 2LPEA 2ESEA 1WWUA 2GLEA 1Z1VA 1SXEA 2QARA 3HILA 1OXJA 1X40A 4PZNA 4NJ8A 2QB0B 2EAPA 2KIVA 3H8MA 5F3XB 3TADA 2EANA 2KG5A
chains in the Genus database with same CATH superfamily
2EZXA 1ZQAA 3IV6A 3MR2A 2LMRA 4Y2XA 2FI1A 4F8RA 2KJ5A 2E1EA 2IHNA 3RB6A 4DCCA 3AEVA 3OPXA 1CUKA 4DQRA 5KG5A 2YMQA 2XICA 4YN4A 4UAWA 3N7SC 4QJFB 4J9MA 2XY5A 3RRGA 2QB1A 3C5GA 4KLOA 4QWDA 2JXJA 1ZETA 1ZQCA 4P4PA 5AKHA 3U26A 3PSFA 5KT3A 3MGVA 3QZ8A 3FYHA 2W9CA 9ICBA 1Q8KA 1PUZA 4BWMA 2JMGA 1UA0A 1TAQA 5BPCA 1ZQNA 4TURA 3ZDDA 2BGWA 2BDPA 2HHTA 3K1RB 4CNQA 5KFHA 2W11A 3AMZA 4KLFA 2BR0A 4KX3A 5B5EU 5ALWA 5AK5A 1X9SA 5J2HA 2ZUCA 4Q45A 2RDJA 3GIJA 1ZQFA 3AU6A 4KLLA 2ZG6A 9ICOA 4DL6A 2LYBA 2KK0A 1F0MA 1HJPA 4KLDA 2ZUBA 2AU0A 4O5CA 1L7NA 4UBBA 2K8AA 3L3FX 3T5HA 1O03A 1T3NA 1NJZA 1X9WA 5KFIA 3SI8A 4PPXA 1T4GA 2FLPA 2VIXA 2F8LA 1S76D 7ICEA 4NM2A 3RR7A 4IL6U 3NUQA 3KZIU 4DL5A 4FS2A 1AQ6A 1L3SA 4RQ0A 3D2QA 2KVCA 2K8CB 4C4TA 4FBTA 5EE9A 4KTQA 3NS1A 4Y2SA 3MGHA 1FEZA 4OJ6A 3WK9A 1X66A 3V72A 3UXPA 4QZIA 4UAUA 2DKXA 1HUOA 1ZQMA 3JPTA 3PX4A 8ICIA 7ICJA 2KZ3A 4ECQA 3GIMA 1BPDA 3RTVA 1NZPA 1ZQBA 2UVRA 4Y2TA 4R64A 5ALHA 3T5JA 7ICGA 3ICXA 2KVSA 4YQWA 5ALXA 3QEBZ 3PX6A 5ALIA 2JEGA 4LVSA 4KLEA 3WKAA 1ZQTA 4G3IA 3CP8A 5AM5A 2Y1JA 1FFUA 1UT5A 4MF2A 8ICJA 2MUTB 5KFDA 1ZQZA 4F5RA 1B0XA 1KFSA 2EZYA 4RQ5A 3NVZA 3OJUA 2R8KA 5K4LA 5CWRA 3PO5A 5DBAA 1XNSA 4PHAA 8ICLA 2JEFA 3VCBA 3RBEA 2JRZA 4FZNA 5IIJA 5KG7A 2F1HA 2ODGA 2W04A 4G9BA 4Z6DA 2D3DA 4J9KA 2ZXIA 3WU2U 2CXYA 1S10A 2D8CA 5G5HA 5CRXA 7ICUA 1LKYB 4B9SA 1U48A 2R8HA 1BVSA 3ZDCA 2ESEA 3QU5A 5KG0A 3LK9A 2GLEA 7ICIA 9ICKA 1ZQ1C 4I2JA 5L1JA 4RUCA 4QIWC 2XY7A 2KIVA 3V6JA 4IR9A 5AKLA 3UM9A 3QUTA 2CRXA 4GC7A 3CRXA 5KT7A 1L8LA 5KFWA 3B0XA 3OGUA 2DFLA 2HCFA 3IP4B 2DL0A 1COKA 2BKEA 2ALZA 2C2RA 4RNMA 4NLNA 2HOIA 5AICA 5ALLA 4KLSA 4B9NA 2ES6A 5KAIU 1NJWA 4M6WB 2Y9UA 3I76A 5C5JA 2W9MA 1ZQPA 2FMPA 4RQ8A 2KZZA 3PW0A 1TK5A 2MRLA 4QW9A 1DXSA 4R8UB 1KQQA 3MFIA 1PK1B 5AM2A 1Z4NA 3FC4A 3IM1A 3L4PA 1N5WA 4NLGA 2J6SA 2YY6A 1Q46A 1NKCA 1SV0C 2YX8A 2ZIXA 4O3PA 2ZIUB 3M9OB 1B4FA 2HDOA 3T79A 3T5LA 8ICCA 2KOBA 3KHHA 2AXTU 5CA7A 1CEZA 2F2AB 5KFYA 1NOMA 3CW2C 1V38A 1ZQLA 2K89A 4JV1A 4YG2A 2I6XA 4QZ9A 2BZFA 4ECXA 2WF8A 5AK6A 2MAXA 1A6SA 4K4GA 5ALFA 1KDHA 2FMSA 1ZOLA 3C29A 2G08A 3IG8A 3DV9A 8ICOA 4EBEA 4M9NA 1MC8A 4IC9A 4UW9A 4EX6A 3QU9A 2ZIVB 2WB1C 1SKSA 1TFRA 1C20A 2LYHA 2KJ8A 4YD1A 1MN8A 3RH6A 3OTQA 1MSWD 4XA5A 2W7OA 1ZQVA 5KT6A 1T94A 5EE3A 7ICMA 2E8PA 5CP2A 3HPOA 4F4YA 2A3VA 4B9MA 2KP7A 3QUBA 3ORYA 4QNLA 5KFUA 5KNIA 5D4BA 5KFQA 1N2XA 4P4OA 5KG3A 5DB6A 2RHFA 1HEKA 1L3TA 2W55A 1Z1BA 2R8GA 8ICQA 2E8MA 2YTUA 3MABA 2PFPA 4XQ8A 4P2HA 2XGPA 1TKDA 4YMOA 3F2CA 1U45A 2AGPA 3MBYA 3KKAA 3H4DA 4CF3A 4RUAA 5G5GA 4MFCA 2LM4A 5IILA 4Y2YA 1FO4A 2OHFA 3MGIA 4JWMA 1N62A 4B9TA 4ECTA 2XC9A 1Q3VA 4QWEA 1ZQOA 5HMMA 2FPKA 2Q0ZX 4Y2QA 1D8YA 2E5SA 2FJ6A 1D9DA 2L5YA 1S77D 2HBLA 5KFSA 2DPIA 2AQ0A 1HUZA 9ICSA 4DFPA 3M9NB 2Y0SF 4PH5A 1EXNA 4ICAA 3V7KA 3SAGA 2EAPA 4ZH4A 4DL2A 1L3UA 5KT2A 3UXNA 2RP5A 4KLHA 1JI7A 3ZDEA 5KFNA 9ICWA 3K1ZA 2V9WA 3BS5A 2ZTDA 5DG8A 3AQFA 9ICCA 3RAQA 4LJXA 2ASDA 1N61A 1XSPA 4DSKA 1ZQSA 3K4GA 4F5NA 4QWCA 4PHPA 2AH5A 4Y2RA 5KFLA 1Z00A 3EYZA 3I1YA 3KHRA 3TAQA 4CCHA 1PZNA 1S0MA 2KD1A 4U7CA 2R8IA 2Y0SC 4J9OA 4RQMA 3EPGA 2HVHA 4DFMA 1BPZA 3Q8QB 3AQEA 9ICTA 2F44A 2P66A 5AKXA 1RM6C 3RH4A 1LVHA 4P0PA 3NVVA 4IQVA 2HSZA 4IR1A 4CDGA 4UQGA 3NGDA 9ICNA 5EWGA 1S0VA 3VC8A 2JH7A 2UVVA 2ZJ5A 2VANA 2QARB 2XCPA 1S9FA 4YR2A 3SR6A 3KFUF 2ZUDA 4J03A 2EAOA 3D2SA 1OW5A 2A1JB 2G07A 5CR0A 1Z19A 1PK3A 4QW8A 5CB1A 1JUDA 3Q8MA 3R9KA 4IRCA 4DOAA 2KJ9A 4YCXA 1SV0A 4RPZA 1J2MA 3N97B 2AJQA 3ETLA 4KMOB 1FIQA 2BQUA 1JX4A 4UB4A 1XU4A 2XY6A 3N4MB 5KFAA 4O3OA 1VDVA 3TADA 3F2DA 1D8LA 5DB9A 1KN5A 2KG5A 4BUGA 4F4ZA 8ICKA 3PR4A 3GV8B 5KTQA 4Q43A 1IG6A 1ZQXA 2NRXA 5DLGA 3TARA 5J2FA 4FFDA 5D49A 4NLZA 2HHXA 7ICOA 4Z6EA 7ICHA 5L1IA 4ED7A 5KFPA 2KSOB 3C1YA 3UMCA 1MA7A 4BDPA 2ASLA 4I28A 4JWNA 4RQ6A 5KFZA 2DBYA 5CJ7A 5AM4A 3BZCA 2G06A 4BXOB 4NXZA 1NK6A 4UB8U 1KRPA 1UT8A 5AK3A 2WF7A 1FFVA 1ZQUA 1A77A 2MSNA 3RJKA 3HRDD 4NL9A 3SD7A 4ELVA 1TE2A 2FE9A 4EENA 3E2EA 2Z7JA 3PVXA 3UQ0A 4R66A 2F8KA 4ECWA 4IS7A 2HHWA 1YT3A 1Y88A 4F50A 4ACOA 5F9NA 3HX0A 4NM1A 5KFFA 5J2GA 2KKVA 3G6XA 2G0AA 3DEEA 2QB0A 5HHIA 3TADC 4RQ4A 3PW7A 4DQPA 3H40A 1S97A 2KMDA 5KFMA 2KV2A 3TANA 2P35A 4DS4A 4DWIA 3C2LA 4DF4A 4P0QB 3V6HA 2LPEA 4P0QA 1NK7A 1QQ6A 8ICTA 1JXLA 3AUOA 1SIJA 4PZNA 3ZI4A 1RXVA 4UARA 7ICQA 2HHVA 2FDRA 5ALYA 2F77X 2E1FA 3MR5A 4OD0A 2RRDA 3SZ2A 7ICTA 4KN7A 1ZD4A 3WK8A 4ED3A 2F1IA 3ONNA 3D2NA 2W8KA 3T3FA 2ZIVA 1ECWA 4F5QA 2KFZA 3OJSA 5KL1B 3FAHA 5ALSA 2OM6A 3PZPA 4OJLA 2KNJA 1Z4OA 1S0OA 5KG2A 2ASJA 3QUCA 4QZAA 4M9GA 4I2BA 9ICIA 1T7PA 2J6TA 2XIDA 3HJEA 4YP3A 1XO1A 4NY8A 3RJFA 3RB4A 4DS5A 5JRTA 9ICHA 8ICMA 2K4PA 3NVYA 2RDIA 2LI6A 4Z6FA 3N7RC 4KLTA 4E0DA 8ICAA 5KFEA 5AM3A 5ALMA 4XUSA 4ECYA 4Q8EA 4C4SA 4M2YA 2ZXHA 5ALOA 3J81j 1MQ2A 5GTHU 4AYBC 3F2BA 4BWJA 5J0QA 4MHVA 4I2FA 2LM1A 4RPYA 3TI0A 2BHNA 5KFGA 1HIWA 4B9VA 4TQRA 4OJOA 2NRWA 5AIBA 5AIAA 2H3VA 4QZGA 1XSNA 2KFNA 3RJEA 5KG1A 2H3QA 4RQ2A 5AM0A 1N60A 1OXJA 4C7ZA 4F5OA 3ISDA 5DDYA 2A1JA 4DSIA 5EWEA 4F3OA 3RRHA 1ZQJA 2WF9A 1NNLA 5CHGA 2AHOB 2WAQF 2ZTCA 4RQNA 3Q8LA 1ZQKA 2IOFK 5JU5A 4CGZA 2HW3A 2LHTA 3C1ZA 5J2IA 2FPLA 1SKRA 2KICA 2E8OA 3GV5B 3JPQA 1V97A 5KT5A 4CE6A 5AI0A 1RYSA 4IQTA 3MDAA 4TUPA 4EYHB 3ZD8A 1NI3A 2V4RA 3AU2A 4ECRA 5L1KA 3UQ2A 2BPCA 3SAFA 3ED5A 1SL1A 1NJYA 2KSOA 3RFAA 4RQ1A 3RR8A 1PVQA 2XI9A 3FDSA 1U49A 1T3QA 5DB7A 2P6UA 4YR0A 2DF4B 2A1AA 3ZD9A 1ZRMA 1L7MA 3PX0A 4NLKA 3MR6A 2AQ4A 4PGXA 1LKYA 4EBDA 1H38A 2IMWP 4CRXA 3BQ0A 2OWOA 4R63A 4GXIA 1GO3F 5IIIA 4O0IA 2KZMA 5H2FU 4B9LA 1OUQA 4F2SA 1QCKA 4OO1J 3PO4A 3SQIA 1S5LU 3WKCA 5L1LA 3GFKB 9ICUA 3KHLA 2G5HB 4C8KA 2HBJA 1V85A 2I5HA 4DLEA 4I2GA 4FS1A 4F93B 2IA6A 5DBCA 4UAYA 9ICRA 2DWQA 2N1RA 5KFVA 2QARA 3H0LB 3RJJA 5HR6A 4C80A 3H4BA 4DL3A 3H8MA 2W3RA 2VKQA 1NZBA 5TISU 5T14A 1COOA 2ISPA 2ZIUA 1L6NA 2ZJAA 1B43A 5J0XA 5ALQA 3GV7B 4DSLA 2UVWA 3RAXA 4BJQA 4DSFA 4Y2UA 1DRGA 4BGDA 3BJYA 4YFKA 2VJ4A 4F5PA 5ALNA 7ICSA 4I2CA 4YMNA 2ZIXB 4QZCA 4C7YA 2JGAA 4DO9A 4EEKA 1KSPA 5AI9A 2BQ3A 2E8NA 5IIKA 4KLGA 1BNOA 3QU4A 5KFKA 4DQSA 2KIWA 2LYAA 2JZBB 4GXKA 4PL1A 1BPEA 2K60A 4PGYA 4K4IA 3UXOA 3RH5A 3QXGA 4QZDA 3PNCA 3JPPA 4O3SA 3D6JA 1WG8A 7ICRA 4RPXA 9ICGA 4A8EA 2EQYA 5DQHA 3Q8PB 2PI4A 3PSIA 5J0SA 4RQ7A 2CPRA 1UHUA 4DQQA 2K4IA 4CF4A 2AGQA 3C28A 4CF5A 1N56A 4US9A 2PFNA 2YB1A 3ALRA 3PW2A 4BXOA 2PMZF 4C8NA 1X6JA 1MQ3A 7ICKA 4GXJA 5DLFA 2ATLA 5AK4A 1QQ7A 2DKZA 3M1YA 4EZ9A 2UVUA 4PGQA 1BNPA 5EWFA 1Z1VA 1DGJA 3GILA 4M47A 1X40A 3ZDAA 4NJ8A 2QB0B 5EOZA 7ICFA 3SMVA 1S8OA 4UB1A 5F3XB 1SL2A 5AKKA 5DQIA 4PJ0U 2WF6A 3E0FA 1N5XA 1RQLA 1NKEA 4F72A 4RNNA 1T8EA 1JMSA 1QSLA 3PW4A 4JK1A 4ECZA 4P4MA 5AKIA 2K8BB 3S6JA 3PR5B 4I2EA 3H0RB 2WF5A 3RB0A 3OSNA 8ICPA 2VA8A 3CNHA 2O6KA 1WCLA 4P0PB 3NTUA 4KMUA 3GQCA 3M9MB 2PFOA 3JPOA 3RJGA 1PVRA 2GOLA 2BCVA 3BDPA 2W9AA 1CRXA 5KFCA 9ICVA 4C0ZA 3I28A 2M0NA 2I1QA 2XGQA 3GZFA 5J8YC 1ZQDA 5HR7A 3IDWA 4I29A 1NK4A 7ICVA 4MF8A 4FZMA 1ZQRA 3QZ7A 4KLQA 5D46A 4QWAA 2VJ5A 1KFDA 8ICZA 1VJ5A 2BDUA 3BS5B 2JR5A 1BPBA 9ICJA 5ALRA 1UPHA 5J2BA 1XO0A 4WJ3B 4YMMA 4IRDA 5B66U 1A0PA 1NKBA 1F44A 2EZZA 4KX5A 3QU2A 3AN1A 4NWIA 5J0WA 3TFSA 4LZDA 2HI0A 5ALGA 2EANA 4RT3A 1D9FA 1ZYQA 4IQWA 2HOFA 1PK1A 3NRWA 5KFJA 2JH1A 4F4WA 4UAVA 3L5KA 4UBCA 2OH2A 4RNOA 3ETRA 5HNKA 2IOFA 4KLUA 7ICLA 4NL9C 5AKZA 4F71A 4J9QA 3A0HU 1DOQA 4MEXA 1QTMA 2BQRA 2PFQA 2OXOA 3RJIA 1KBUA 2V4QA 5J2JA 1PVPA 1TAUA 1L7OA 2HOQA 4RT2A 8ICNA 5J29A 8ICEA 1JXEA 7ICPA 1SB3C 2W7PA 1RZTA 3BZKA 2JHDA 5DKWA 2W9BA 4RZRA 4YXJA 2KHQA 2E3TA 3KKAC 5L9XA 3FM9A 2EDUA 4KLMA 2I9GA 4NV0A 1UQVA 5ALEA 3BQ1A 3KZXA 2W9BB 4UASA 5J2KA 1ZQIA 2W3SA 2ZIWB 1UCVA 4UB2A 3IHQB 1IM4A 4UAZA 8ICGA 3PMLA 3KBBA 1SKWA 5HMLA 4R65A 2WAQC 4YR3A 3G6VA 1IIPA 4J9LA 1ZQYA 4ECUA 4B9UA 3OSPA 3SV4A 4KN4A 4PL2A 4DOCA 4ECVA 7ICNA 2GH1A 1SXEA 5J2CA 1NJXA 3GDXA 1K1QA 5KL8B 4O3QA 3BQTA 2M9NA 4DF8A 4DOBA 5KFOA 3EZ5A 3TQ1A 1NK9A 1ZD5A 4ED1A 3QUQA 2AGOA 4KLIA 3JPNA 2A19A 2YN4A 3BQ2A 8ICRA 3EW9A 2NO4A 1Z3EB 2HHQA 3HKZF 3V7JA 3AL0B 3NVWA 4C8LA 1YZ6A 2VA2A 2JEIA 8ICHA 3WK5A 4FZLA 1Q3UA 4UB5A 2LKYA 5KG4A 4ELUA 4UB3A 4FO6A 3Q8RB 4NLCA 3QYPA 2B21A 1S0NA 3M6ZA 5J0PA 4JV0A 4DFDA 1SXDA 1JALA 3QU7A 8ICFA 3BS7A 3LVWA 3EWAA 3H0MB 5ALUA 1SZHA 1UA1A 4F91B 4XRHA 9ICXA 1SWVA 2FPMA 4O9MA 3CYMA 9ICFA 3QNMA 1ZRNA 4I2AA 3F5EA 4HYKA 2Y9TA 3EUB2 4PHDA 4NLBA 4O5EA 4DEZA 1SV4A 8ICWA 3LWMA 4ECSA 3MFHA 2W9CB 2W43A 2C2EA 4GFJA 4USAA 3GIKA 2NV3A 4OCZA 3T5KA 1X2IA 2YMPA 4K4HA 1RQNA 3KTQA 3TAPA 3IG5A 1TAMA 4IRKA 1AROP 2HHSA 3UMBA 3ZDBA 3OHBA 5J2EA 3C21A 4C8OA 4JB3A 4MFAA 3WK7A 4Y2PA 3MR3A 4O3NA 3PW5A 1M6YA 5FP0A 4X5VA 1ZD3A 1IXRA 2ZIWA 2HBMA 1U9LA 4KLJA 1RDFA 1WUDA 4F2RA 1F5SA 2HHUA 1O08A 1Z00B 4M9HA 2JV3A 2NO5A 4I2HA 3E58A 1DK2A 5ALJA 5J0RA 1N63A 8ICYA 1KFTA 1JN3A 2WFAA 2IHMA 2G5IB 3WKBA 5ALZA 2NYVA 3DDHA 3KOOA 2W54A 4M6WA 5DGBA 2KEYA 4QIWF 4UB6U 4DSJA 4DSEA 3A0BU 4QZ8A 1J97A 2ZJ8A 1ZQEA 4HAIA 2RLTA 4ED2A 1RG6A 9ICQA 5KAFU 4F4KA 2F76X 2C28A 4ZOHC 1SZPA 3RJHA 9ICPA 3F5AA 4J9SA 5JTIA 4DL4A 2H5XA 5KFRA 2YQEA 2CN1A 1SGGA 3SAHA 1ZQWA 2H3FA 2DQNB 5HHHA 3SYZA 1X42A 5KFXA 3NRZA 1KL9A 4JUZA 2HBKA 9ICEA 5J0YA 4O3RA 5KFTA 4KITB 5AI8A 5AI5A 8ICSA 8ICVA 1KW4A 2Y1IA 2ZTEA 3PSTA 4DFKA 4C4RA 2FMQA 2OCEA 4EBCA 5DG9A 1ZQHA 3HILA 1NK8A 2BCSA 5HP4A 3N28A 5AI6A 8ICUA 2K4HA 2YB4A 5IIMA 1TV9A 2LBOA 1RYUA 5GTIU 1JRPA 2NRZA 1N48A 2WHEA 2GO7A 4O3MA 4AYBF 4EX7A 1QLNA 2BCUA 2EAMA 2MU2A 3G6YA 4FBUA 3AM9A 2PI5A 1K5OA 4ED6A 3LVVA 4BX9C 3PV8A 4F92B 2C22A 4I2IA 3UMGA 3C23A 5ALTA 1CI4A 1L8OA 2KHVA 3EPIA 4AP9A 3LDAA 5AHXA 1KEJA 1BGXT 2YMMA 4I27A 3B0YA 3BQ7A 4M0AA 1TK0A 2WTFA 1NK5A 5J2AA 3GU3A 3K75D 3SENA 2QLTA 1KLNA 3V6KA 3H8JA 8ICXA 4YVZA 2BCQA 4DLGA 1X6IA 2B6GA 3ISBA 2XVTA 2RQ5A 3ISCA 4OJPA 5AKJA 1DGSA 1QH9A 1K1SA 4J9PA 1YZ7A 3TACB 4M04A 1L5UA 4Q44A 4ED0A 5IINA 3N7PD 1WYGA 9ICAA 1XS9D 3Q8SB 5F9LA 5KFBA 4JV2A 1RPLA 3B9JA 4IQUA 5J2DA 5DG7A 1ZJNA 3IN5A 5E79U 3HWTA 3SV3A 4DFJA 1JIHA 2PKEA 2NRTA 2YMLA 4C8MA 2C2DA 3M7DA 1C7YA 1U4BA 3JPSA 2BPGA 4MEYA 5L1MA 1JROA 2DGZA 2IBKA 2K4EA 4ED8A 1RXWA 3OHAA 1L7PA 1IV8A 3TKAA 2JEJA 1XSLA 2F3NA 3PY8A 4O5KA 4QZEA 3LWLA 3QX7A 3IRUA 4FE3A 5J8YA 4RU9A 2HMXA 2R18A 2F1JA 3WKEA 3WK6A 1ZXIA 4GIBA 9ICLA 4YXMA 2P6RA 1TK8A 1J2NA 5CEHA 1L3VA 5C0YA 1SL0A 2PXIA 3M8SA 2JZBA 1LB2B 1URJA 5AKEA 4QZBA 2D6FC 2IOHA 9ICMA 4EYIB 2KKPA 5KG6A 1D8BA 3SEIA 2DUYA 4TUQA 2GWSA 3RBDA 3M6KA 4R8UA 5BOMA 3TFRA 4GC6A 1DK3A 1VLBA 4I2DA 3PMNA 3RF9A 3HW8A 2VA3A 1KKXA 1B22A 1P7DA 5KT4A 1XWLA 2H3IA 2FLLA 2DPJA 3WK4A 5IIOA 1X9MA 3H7IA 1QSSA 4LZGA 5BOLA 5J0OA 4QZFA 3RB3A 4DQIA 5ALKA 2EH9A 4MFFA 4Z6CA 2G09A 1U47A 5AKGA 3HT3A 4TQSA 4OJ5A 2H3ZA 3MDCA 1BPXA 5AKYA 4RQ3A 4PZOA 4DL7A 1NK0A 5DGAA 4UATA 3Q8KA 4M9JA 5ALPA 2W8LA 1QQ5A 3C2MA 2XO7A 1RYRA 5DQGA 5A0LA 4PHEA 4GLXA 4US8A 3WKDA 3GIIA 2XCAA 1ZQQA 1SWWA 4Y2JA 5DDMA 4U6PA 2B0CA 2BCRA 3UPQA 1BPYA 4JMUA 2BPFA 1A76A 1XC9A 2W03A 2KTQA 3QE9Y 2J6UA 3H8SA 2KN7A 4YD2A 2PMZC 8ICBA 3NASA 1ZD2P 5TZVA 3M8RA 2FLNA 3QEAZ 1WWVA 3V7LA 1WCNA 3C2KA 1ZQGA 1X9XA 4TUSA 4QZHA 1QSYA 2R8JA 2NRVA 3LYSA 1TVAA 5AM1A 5J0TA 2KE7A 1LV5A 5AI4A 4Q8FA 2MUTA 2WB1F 3HKZC 5DBBA 3F53A 4EELA 3C5FA 4EZ6A 1ED1A 1V9PA 5EE1A 5DB8A 5J0UA 3THVA 2OEHA 5ALVA 5EE0A 4EEYA 2ISOA 4B6JA 2QKQA 2OYYA 3KHGA 3H8WA 4ELTA 2MA1A 1WWUA 4M9LA 5ALDA 4J9RA 4Y2VA 2Q4TA 3PSPA 3KD3A 3MC1A 4J9NA 3O0FA 5JUMA 2HVIA 4F4XA 1ZJMA 4QWBA 1KTQA 3HP6A 3JPRA
chains in the Genus database with same CATH topology
1JI7A 1PK1A 4RQNA 2LMRA 5L1MA 5JU5A 4PZOA 3BS5A 2F3NA 2E8OA 1X66A 2DL0A 2EAMA 1COKA 2KSOB 4NL9C 2DKXA 2QB1A 2JV3A 2ES6A 5J8YA 2Y9UA 2E8PA 2E8NA 5KNIA 2KSOA 1SXDA 2K60A 1DXSA 3BQ7A 4NL9A 4RQMA 5JRTA 2E8MA 1B0XA 2YTUA 2K4PA 3BS7A 2FE9A 2F44A 1PK1B 3KKAC 1WWVA 2F8KA 4IS7A 1X9XA 5J8YC 1RG6A 3IDWA 3K1RB 3SENA 1LKYA 3KKAA 1SV0C 1UQVA 2KE7A 3SEIA 5JTIA 1B4FA 2QARB 2B6GA 1SGGA 2Y9TA 2EAOA 4MHVA 1OW5A 2D3DA 1UCVA 2QB0A 3TADC 1F0MA 1PK3A 3BS5B 2D8CA 1LKYB 1SV4A 1V85A 3TACB 2KMDA 1KW4A 2L5YA 2QKQA 1SV0A 1V38A 2DKZA 2LPEA 2ESEA 1WWUA 2GLEA 1Z1VA 1SXEA 2QARA 3HILA 1OXJA 1X40A 4PZNA 4NJ8A 2QB0B 2EAPA 2KIVA 3H8MA 5F3XB 3TADA 2EANA 2KG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JI7 A;  1PK1 A;  4RQN A;  2LMR A;  5L1M A;  5JU5 A;  4PZO A;  3BS5 A;  2F3N A;  2E8O A;  1X66 A;  2DL0 A;  2EAM A;  1COK A;  2KSO B;  4NL9 C;  2DKX A;  2QB1 A;  2JV3 A;  2ES6 A;  5J8Y A;  2Y9U A;  2E8P A;  2E8N A;  5KNI A;  2KSO A;  1SXD A;  2K60 A;  1DXS A;  3BQ7 A;  4NL9 A;  4RQM A;  5JRT A;  2E8M A;  1B0X A;  2YTU A;  2K4P A;  3BS7 A;  2FE9 A;  2F44 A;  1PK1 B;  3KKA C;  1WWV A;  2F8K A;  4IS7 A;  1X9X A;  5J8Y C;  1RG6 A;  3IDW A;  3K1R B;  3SEN A;  1LKY A;  3KKA A;  1SV0 C;  1UQV A;  2KE7 A;  3SEI A;  5JTI A;  1B4F A;  2QAR B;  2B6G A;  1SGG A;  2Y9T A;  2EAO A;  4MHV A;  1OW5 A;  2D3D A;  1UCV A;  2QB0 A;  3TAD C;  1F0M A;  1PK3 A;  3BS5 B;  2D8C A;  1LKY B;  1SV4 A;  1V85 A;  3TAC B;  2KMD A;  1KW4 A;  2L5Y A;  2QKQ A;  1SV0 A;  1V38 A;  2DKZ A;  2LPE A;  2ESE A;  1WWU A;  2GLE A;  1Z1V A;  1SXE A;  2QAR A;  3HIL A;  1OXJ A;  1X40 A;  4PZN A;  4NJ8 A;  2QB0 B;  2EAP A;  2KIV A;  3H8M A;  5F3X B;  3TAD A;  2EAN A;  2KG5 A; 
#chains in the Genus database with same CATH topology
 2EZX A;  1ZQA A;  3IV6 A;  3MR2 A;  2LMR A;  4Y2X A;  2FI1 A;  4F8R A;  2KJ5 A;  2E1E A;  2IHN A;  3RB6 A;  4DCC A;  3AEV A;  3OPX A;  1CUK A;  4DQR A;  5KG5 A;  2YMQ A;  2XIC A;  4YN4 A;  4UAW A;  3N7S C;  4QJF B;  4J9M A;  2XY5 A;  3RRG A;  2QB1 A;  3C5G A;  4KLO A;  4QWD A;  2JXJ A;  1ZET A;  1ZQC A;  4P4P A;  5AKH A;  3U26 A;  3PSF A;  5KT3 A;  3MGV A;  3QZ8 A;  3FYH A;  2W9C A;  9ICB A;  1Q8K A;  1PUZ A;  4BWM A;  2JMG A;  1UA0 A;  1TAQ A;  5BPC A;  1ZQN A;  4TUR A;  3ZDD A;  2BGW A;  2BDP A;  2HHT A;  3K1R B;  4CNQ A;  5KFH A;  2W11 A;  3AMZ A;  4KLF A;  2BR0 A;  4KX3 A;  5B5E U;  5ALW A;  5AK5 A;  1X9S A;  5J2H A;  2ZUC A;  4Q45 A;  2RDJ A;  3GIJ A;  1ZQF A;  3AU6 A;  4KLL A;  2ZG6 A;  9ICO A;  4DL6 A;  2LYB A;  2KK0 A;  1F0M A;  1HJP A;  4KLD A;  2ZUB A;  2AU0 A;  4O5C A;  1L7N A;  4UBB A;  2K8A A;  3L3F X;  3T5H A;  1O03 A;  1T3N A;  1NJZ A;  1X9W A;  5KFI A;  3SI8 A;  4PPX A;  1T4G A;  2FLP A;  2VIX A;  2F8L A;  1S76 D;  7ICE A;  4NM2 A;  3RR7 A;  4IL6 U;  3NUQ A;  3KZI U;  4DL5 A;  4FS2 A;  1AQ6 A;  1L3S A;  4RQ0 A;  3D2Q A;  2KVC A;  2K8C B;  4C4T A;  4FBT A;  5EE9 A;  4KTQ A;  3NS1 A;  4Y2S A;  3MGH A;  1FEZ A;  4OJ6 A;  3WK9 A;  1X66 A;  3V72 A;  3UXP A;  4QZI A;  4UAU A;  2DKX A;  1HUO A;  1ZQM A;  3JPT A;  3PX4 A;  8ICI A;  7ICJ A;  2KZ3 A;  4ECQ A;  3GIM A;  1BPD A;  3RTV A;  1NZP A;  1ZQB A;  2UVR A;  4Y2T A;  4R64 A;  5ALH A;  3T5J A;  7ICG A;  3ICX A;  2KVS A;  4YQW A;  5ALX A;  3QEB Z;  3PX6 A;  5ALI A;  2JEG A;  4LVS A;  4KLE A;  3WKA A;  1ZQT A;  4G3I A;  3CP8 A;  5AM5 A;  2Y1J A;  1FFU A;  1UT5 A;  4MF2 A;  8ICJ A;  2MUT B;  5KFD A;  1ZQZ A;  4F5R A;  1B0X A;  1KFS A;  2EZY A;  4RQ5 A;  3NVZ A;  3OJU A;  2R8K A;  5K4L A;  5CWR A;  3PO5 A;  5DBA A;  1XNS A;  4PHA A;  8ICL A;  2JEF A;  3VCB A;  3RBE A;  2JRZ A;  4FZN A;  5IIJ A;  5KG7 A;  2F1H A;  2ODG A;  2W04 A;  4G9B A;  4Z6D A;  2D3D A;  4J9K A;  2ZXI A;  3WU2 U;  2CXY A;  1S10 A;  2D8C A;  5G5H A;  5CRX A;  7ICU A;  1LKY B;  4B9S A;  1U48 A;  2R8H A;  1BVS A;  3ZDC A;  2ESE A;  3QU5 A;  5KG0 A;  3LK9 A;  2GLE A;  7ICI A;  9ICK A;  1ZQ1 C;  4I2J A;  5L1J A;  4RUC A;  4QIW C;  2XY7 A;  2KIV A;  3V6J A;  4IR9 A;  5AKL A;  3UM9 A;  3QUT A;  2CRX A;  4GC7 A;  3CRX A;  5KT7 A;  1L8L A;  5KFW A;  3B0X A;  3OGU A;  2DFL A;  2HCF A;  3IP4 B;  2DL0 A;  1COK A;  2BKE A;  2ALZ A;  2C2R A;  4RNM A;  4NLN A;  2HOI A;  5AIC A;  5ALL A;  4KLS A;  4B9N A;  2ES6 A;  5KAI U;  1NJW A;  4M6W B;  2Y9U A;  3I76 A;  5C5J A;  2W9M A;  1ZQP A;  2FMP A;  4RQ8 A;  2KZZ A;  3PW0 A;  1TK5 A;  2MRL A;  4QW9 A;  1DXS A;  4R8U B;  1KQQ A;  3MFI A;  1PK1 B;  5AM2 A;  1Z4N A;  3FC4 A;  3IM1 A;  3L4P A;  1N5W A;  4NLG A;  2J6S A;  2YY6 A;  1Q46 A;  1NKC A;  1SV0 C;  2YX8 A;  2ZIX A;  4O3P A;  2ZIU B;  3M9O B;  1B4F A;  2HDO A;  3T79 A;  3T5L A;  8ICC A;  2KOB A;  3KHH A;  2AXT U;  5CA7 A;  1CEZ A;  2F2A B;  5KFY A;  1NOM A;  3CW2 C;  1V38 A;  1ZQL A;  2K89 A;  4JV1 A;  4YG2 A;  2I6X A;  4QZ9 A;  2BZF A;  4ECX A;  2WF8 A;  5AK6 A;  2MAX A;  1A6S A;  4K4G A;  5ALF A;  1KDH A;  2FMS A;  1ZOL A;  3C29 A;  2G08 A;  3IG8 A;  3DV9 A;  8ICO A;  4EBE A;  4M9N A;  1MC8 A;  4IC9 A;  4UW9 A;  4EX6 A;  3QU9 A;  2ZIV B;  2WB1 C;  1SKS A;  1TFR A;  1C20 A;  2LYH A;  2KJ8 A;  4YD1 A;  1MN8 A;  3RH6 A;  3OTQ A;  1MSW D;  4XA5 A;  2W7O A;  1ZQV A;  5KT6 A;  1T94 A;  5EE3 A;  7ICM A;  2E8P A;  5CP2 A;  3HPO A;  4F4Y A;  2A3V A;  4B9M A;  2KP7 A;  3QUB A;  3ORY A;  4QNL A;  5KFU A;  5KNI A;  5D4B A;  5KFQ A;  1N2X A;  4P4O A;  5KG3 A;  5DB6 A;  2RHF A;  1HEK A;  1L3T A;  2W55 A;  1Z1B A;  2R8G A;  8ICQ A;  2E8M A;  2YTU A;  3MAB A;  2PFP A;  4XQ8 A;  4P2H A;  2XGP A;  1TKD A;  4YMO A;  3F2C A;  1U45 A;  2AGP A;  3MBY A;  3KKA A;  3H4D A;  4CF3 A;  4RUA A;  5G5G A;  4MFC A;  2LM4 A;  5IIL A;  4Y2Y A;  1FO4 A;  2OHF A;  3MGI A;  4JWM A;  1N62 A;  4B9T A;  4ECT A;  2XC9 A;  1Q3V A;  4QWE A;  1ZQO A;  5HMM A;  2FPK A;  2Q0Z X;  4Y2Q A;  1D8Y A;  2E5S A;  2FJ6 A;  1D9D A;  2L5Y A;  1S77 D;  2HBL A;  5KFS A;  2DPI A;  2AQ0 A;  1HUZ A;  9ICS A;  4DFP A;  3M9N B;  2Y0S F;  4PH5 A;  1EXN A;  4ICA A;  3V7K A;  3SAG A;  2EAP A;  4ZH4 A;  4DL2 A;  1L3U A;  5KT2 A;  3UXN A;  2RP5 A;  4KLH A;  1JI7 A;  3ZDE A;  5KFN A;  9ICW A;  3K1Z A;  2V9W A;  3BS5 A;  2ZTD A;  5DG8 A;  3AQF A;  9ICC A;  3RAQ A;  4LJX A;  2ASD A;  1N61 A;  1XSP A;  4DSK A;  1ZQS A;  3K4G A;  4F5N A;  4QWC A;  4PHP A;  2AH5 A;  4Y2R A;  5KFL A;  1Z00 A;  3EYZ A;  3I1Y A;  3KHR A;  3TAQ A;  4CCH A;  1PZN A;  1S0M A;  2KD1 A;  4U7C A;  2R8I A;  2Y0S C;  4J9O A;  4RQM A;  3EPG A;  2HVH A;  4DFM A;  1BPZ A;  3Q8Q B;  3AQE A;  9ICT A;  2F44 A;  2P66 A;  5AKX A;  1RM6 C;  3RH4 A;  1LVH A;  4P0P A;  3NVV A;  4IQV A;  2HSZ A;  4IR1 A;  4CDG A;  4UQG A;  3NGD A;  9ICN A;  5EWG A;  1S0V A;  3VC8 A;  2JH7 A;  2UVV A;  2ZJ5 A;  2VAN A;  2QAR B;  2XCP A;  1S9F A;  4YR2 A;  3SR6 A;  3KFU F;  2ZUD A;  4J03 A;  2EAO A;  3D2S A;  1OW5 A;  2A1J B;  2G07 A;  5CR0 A;  1Z19 A;  1PK3 A;  4QW8 A;  5CB1 A;  1JUD A;  3Q8M A;  3R9K A;  4IRC A;  4DOA A;  2KJ9 A;  4YCX A;  1SV0 A;  4RPZ A;  1J2M A;  3N97 B;  2AJQ A;  3ETL A;  4KMO B;  1FIQ A;  2BQU A;  1JX4 A;  4UB4 A;  1XU4 A;  2XY6 A;  3N4M B;  5KFA A;  4O3O A;  1VDV A;  3TAD A;  3F2D A;  1D8L A;  5DB9 A;  1KN5 A;  2KG5 A;  4BUG A;  4F4Z A;  8ICK A;  3PR4 A;  3GV8 B;  5KTQ A;  4Q43 A;  1IG6 A;  1ZQX A;  2NRX A;  5DLG A;  3TAR A;  5J2F A;  4FFD A;  5D49 A;  4NLZ A;  2HHX A;  7ICO A;  4Z6E A;  7ICH A;  5L1I A;  4ED7 A;  5KFP A;  2KSO B;  3C1Y A;  3UMC A;  1MA7 A;  4BDP A;  2ASL A;  4I28 A;  4JWN A;  4RQ6 A;  5KFZ A;  2DBY A;  5CJ7 A;  5AM4 A;  3BZC A;  2G06 A;  4BXO B;  4NXZ A;  1NK6 A;  4UB8 U;  1KRP A;  1UT8 A;  5AK3 A;  2WF7 A;  1FFV A;  1ZQU A;  1A77 A;  2MSN A;  3RJK A;  3HRD D;  4NL9 A;  3SD7 A;  4ELV A;  1TE2 A;  2FE9 A;  4EEN A;  3E2E A;  2Z7J A;  3PVX A;  3UQ0 A;  4R66 A;  2F8K A;  4ECW A;  4IS7 A;  2HHW A;  1YT3 A;  1Y88 A;  4F50 A;  4ACO A;  5F9N A;  3HX0 A;  4NM1 A;  5KFF A;  5J2G A;  2KKV A;  3G6X A;  2G0A A;  3DEE A;  2QB0 A;  5HHI A;  3TAD C;  4RQ4 A;  3PW7 A;  4DQP A;  3H40 A;  1S97 A;  2KMD A;  5KFM A;  2KV2 A;  3TAN A;  2P35 A;  4DS4 A;  4DWI A;  3C2L A;  4DF4 A;  4P0Q B;  3V6H A;  2LPE A;  4P0Q A;  1NK7 A;  1QQ6 A;  8ICT A;  1JXL A;  3AUO A;  1SIJ A;  4PZN A;  3ZI4 A;  1RXV A;  4UAR A;  7ICQ A;  2HHV A;  2FDR A;  5ALY A;  2F77 X;  2E1F A;  3MR5 A;  4OD0 A;  2RRD A;  3SZ2 A;  7ICT A;  4KN7 A;  1ZD4 A;  3WK8 A;  4ED3 A;  2F1I A;  3ONN A;  3D2N A;  2W8K A;  3T3F A;  2ZIV A;  1ECW A;  4F5Q A;  2KFZ A;  3OJS A;  5KL1 B;  3FAH A;  5ALS A;  2OM6 A;  3PZP A;  4OJL A;  2KNJ A;  1Z4O A;  1S0O A;  5KG2 A;  2ASJ A;  3QUC A;  4QZA A;  4M9G A;  4I2B A;  9ICI A;  1T7P A;  2J6T A;  2XID A;  3HJE A;  4YP3 A;  1XO1 A;  4NY8 A;  3RJF A;  3RB4 A;  4DS5 A;  5JRT A;  9ICH A;  8ICM A;  2K4P A;  3NVY A;  2RDI A;  2LI6 A;  4Z6F A;  3N7R C;  4KLT A;  4E0D A;  8ICA A;  5KFE A;  5AM3 A;  5ALM A;  4XUS A;  4ECY A;  4Q8E A;  4C4S A;  4M2Y A;  2ZXH A;  5ALO A;  3J81 j;  1MQ2 A;  5GTH U;  4AYB C;  3F2B A;  4BWJ A;  5J0Q A;  4MHV A;  4I2F A;  2LM1 A;  4RPY A;  3TI0 A;  2BHN A;  5KFG A;  1HIW A;  4B9V A;  4TQR A;  4OJO A;  2NRW A;  5AIB A;  5AIA A;  2H3V A;  4QZG A;  1XSN A;  2KFN A;  3RJE A;  5KG1 A;  2H3Q A;  4RQ2 A;  5AM0 A;  1N60 A;  1OXJ A;  4C7Z A;  4F5O A;  3ISD A;  5DDY A;  2A1J A;  4DSI A;  5EWE A;  4F3O A;  3RRH A;  1ZQJ A;  2WF9 A;  1NNL A;  5CHG A;  2AHO B;  2WAQ F;  2ZTC A;  4RQN A;  3Q8L A;  1ZQK A;  2IOF K;  5JU5 A;  4CGZ A;  2HW3 A;  2LHT A;  3C1Z A;  5J2I A;  2FPL A;  1SKR A;  2KIC A;  2E8O A;  3GV5 B;  3JPQ A;  1V97 A;  5KT5 A;  4CE6 A;  5AI0 A;  1RYS A;  4IQT A;  3MDA A;  4TUP A;  4EYH B;  3ZD8 A;  1NI3 A;  2V4R A;  3AU2 A;  4ECR A;  5L1K A;  3UQ2 A;  2BPC A;  3SAF A;  3ED5 A;  1SL1 A;  1NJY A;  2KSO A;  3RFA A;  4RQ1 A;  3RR8 A;  1PVQ A;  2XI9 A;  3FDS A;  1U49 A;  1T3Q A;  5DB7 A;  2P6U A;  4YR0 A;  2DF4 B;  2A1A A;  3ZD9 A;  1ZRM A;  1L7M A;  3PX0 A;  4NLK A;  3MR6 A;  2AQ4 A;  4PGX A;  1LKY A;  4EBD A;  1H38 A;  2IMW P;  4CRX A;  3BQ0 A;  2OWO A;  4R63 A;  4GXI A;  1GO3 F;  5III A;  4O0I A;  2KZM A;  5H2F U;  4B9L A;  1OUQ A;  4F2S A;  1QCK A;  4OO1 J;  3PO4 A;  3SQI A;  1S5L U;  3WKC A;  5L1L A;  3GFK B;  9ICU A;  3KHL A;  2G5H B;  4C8K A;  2HBJ A;  1V85 A;  2I5H A;  4DLE A;  4I2G A;  4FS1 A;  4F93 B;  2IA6 A;  5DBC A;  4UAY A;  9ICR A;  2DWQ A;  2N1R A;  5KFV A;  2QAR A;  3H0L B;  3RJJ A;  5HR6 A;  4C80 A;  3H4B A;  4DL3 A;  3H8M A;  2W3R A;  2VKQ A;  1NZB A;  5TIS U;  5T14 A;  1COO A;  2ISP A;  2ZIU A;  1L6N A;  2ZJA A;  1B43 A;  5J0X A;  5ALQ A;  3GV7 B;  4DSL A;  2UVW A;  3RAX A;  4BJQ A;  4DSF A;  4Y2U A;  1DRG A;  4BGD A;  3BJY A;  4YFK A;  2VJ4 A;  4F5P A;  5ALN A;  7ICS A;  4I2C A;  4YMN A;  2ZIX B;  4QZC A;  4C7Y A;  2JGA A;  4DO9 A;  4EEK A;  1KSP A;  5AI9 A;  2BQ3 A;  2E8N A;  5IIK A;  4KLG A;  1BNO A;  3QU4 A;  5KFK A;  4DQS A;  2KIW A;  2LYA A;  2JZB B;  4GXK A;  4PL1 A;  1BPE A;  2K60 A;  4PGY A;  4K4I A;  3UXO A;  3RH5 A;  3QXG A;  4QZD A;  3PNC A;  3JPP A;  4O3S A;  3D6J A;  1WG8 A;  7ICR A;  4RPX A;  9ICG A;  4A8E A;  2EQY A;  5DQH A;  3Q8P B;  2PI4 A;  3PSI A;  5J0S A;  4RQ7 A;  2CPR A;  1UHU A;  4DQQ A;  2K4I A;  4CF4 A;  2AGQ A;  3C28 A;  4CF5 A;  1N56 A;  4US9 A;  2PFN A;  2YB1 A;  3ALR A;  3PW2 A;  4BXO A;  2PMZ F;  4C8N A;  1X6J A;  1MQ3 A;  7ICK A;  4GXJ A;  5DLF A;  2ATL A;  5AK4 A;  1QQ7 A;  2DKZ A;  3M1Y A;  4EZ9 A;  2UVU A;  4PGQ A;  1BNP A;  5EWF A;  1Z1V A;  1DGJ A;  3GIL A;  4M47 A;  1X40 A;  3ZDA A;  4NJ8 A;  2QB0 B;  5EOZ A;  7ICF A;  3SMV A;  1S8O A;  4UB1 A;  5F3X B;  1SL2 A;  5AKK A;  5DQI A;  4PJ0 U;  2WF6 A;  3E0F A;  1N5X A;  1RQL A;  1NKE A;  4F72 A;  4RNN A;  1T8E A;  1JMS A;  1QSL A;  3PW4 A;  4JK1 A;  4ECZ A;  4P4M A;  5AKI A;  2K8B B;  3S6J A;  3PR5 B;  4I2E A;  3H0R B;  2WF5 A;  3RB0 A;  3OSN A;  8ICP A;  2VA8 A;  3CNH A;  2O6K A;  1WCL A;  4P0P B;  3NTU A;  4KMU A;  3GQC A;  3M9M B;  2PFO A;  3JPO A;  3RJG A;  1PVR A;  2GOL A;  2BCV A;  3BDP A;  2W9A A;  1CRX A;  5KFC A;  9ICV A;  4C0Z A;  3I28 A;  2M0N A;  2I1Q A;  2XGQ A;  3GZF A;  5J8Y C;  1ZQD A;  5HR7 A;  3IDW A;  4I29 A;  1NK4 A;  7ICV A;  4MF8 A;  4FZM A;  1ZQR A;  3QZ7 A;  4KLQ A;  5D46 A;  4QWA A;  2VJ5 A;  1KFD A;  8ICZ A;  1VJ5 A;  2BDU A;  3BS5 B;  2JR5 A;  1BPB A;  9ICJ A;  5ALR A;  1UPH A;  5J2B A;  1XO0 A;  4WJ3 B;  4YMM A;  4IRD A;  5B66 U;  1A0P A;  1NKB A;  1F44 A;  2EZZ A;  4KX5 A;  3QU2 A;  3AN1 A;  4NWI A;  5J0W A;  3TFS A;  4LZD A;  2HI0 A;  5ALG A;  2EAN A;  4RT3 A;  1D9F A;  1ZYQ A;  4IQW A;  2HOF A;  1PK1 A;  3NRW A;  5KFJ A;  2JH1 A;  4F4W A;  4UAV A;  3L5K A;  4UBC A;  2OH2 A;  4RNO A;  3ETR A;  5HNK A;  2IOF A;  4KLU A;  7ICL A;  4NL9 C;  5AKZ A;  4F71 A;  4J9Q A;  3A0H U;  1DOQ A;  4MEX A;  1QTM A;  2BQR A;  2PFQ A;  2OXO A;  3RJI A;  1KBU A;  2V4Q A;  5J2J A;  1PVP A;  1TAU A;  1L7O A;  2HOQ A;  4RT2 A;  8ICN A;  5J29 A;  8ICE A;  1JXE A;  7ICP A;  1SB3 C;  2W7P A;  1RZT A;  3BZK A;  2JHD A;  5DKW A;  2W9B A;  4RZR A;  4YXJ A;  2KHQ A;  2E3T A;  3KKA C;  5L9X A;  3FM9 A;  2EDU A;  4KLM A;  2I9G A;  4NV0 A;  1UQV A;  5ALE A;  3BQ1 A;  3KZX A;  2W9B B;  4UAS A;  5J2K A;  1ZQI A;  2W3S A;  2ZIW B;  1UCV A;  4UB2 A;  3IHQ B;  1IM4 A;  4UAZ A;  8ICG A;  3PML A;  3KBB A;  1SKW A;  5HML A;  4R65 A;  2WAQ C;  4YR3 A;  3G6V A;  1IIP A;  4J9L A;  1ZQY A;  4ECU A;  4B9U A;  3OSP A;  3SV4 A;  4KN4 A;  4PL2 A;  4DOC A;  4ECV A;  7ICN A;  2GH1 A;  1SXE A;  5J2C A;  1NJX A;  3GDX A;  1K1Q A;  5KL8 B;  4O3Q A;  3BQT A;  2M9N A;  4DF8 A;  4DOB A;  5KFO A;  3EZ5 A;  3TQ1 A;  1NK9 A;  1ZD5 A;  4ED1 A;  3QUQ A;  2AGO A;  4KLI A;  3JPN A;  2A19 A;  2YN4 A;  3BQ2 A;  8ICR A;  3EW9 A;  2NO4 A;  1Z3E B;  2HHQ A;  3HKZ F;  3V7J A;  3AL0 B;  3NVW A;  4C8L A;  1YZ6 A;  2VA2 A;  2JEI A;  8ICH A;  3WK5 A;  4FZL A;  1Q3U A;  4UB5 A;  2LKY A;  5KG4 A;  4ELU A;  4UB3 A;  4FO6 A;  3Q8R B;  4NLC A;  3QYP A;  2B21 A;  1S0N A;  3M6Z A;  5J0P A;  4JV0 A;  4DFD A;  1SXD A;  1JAL A;  3QU7 A;  8ICF A;  3BS7 A;  3LVW A;  3EWA A;  3H0M B;  5ALU A;  1SZH A;  1UA1 A;  4F91 B;  4XRH A;  9ICX A;  1SWV A;  2FPM A;  4O9M A;  3CYM A;  9ICF A;  3QNM A;  1ZRN A;  4I2A A;  3F5E A;  4HYK A;  2Y9T A;  3EUB 2;  4PHD A;  4NLB A;  4O5E A;  4DEZ A;  1SV4 A;  8ICW A;  3LWM A;  4ECS A;  3MFH A;  2W9C B;  2W43 A;  2C2E A;  4GFJ A;  4USA A;  3GIK A;  2NV3 A;  4OCZ A;  3T5K A;  1X2I A;  2YMP A;  4K4H A;  1RQN A;  3KTQ A;  3TAP A;  3IG5 A;  1TAM A;  4IRK A;  1ARO P;  2HHS A;  3UMB A;  3ZDB A;  3OHB A;  5J2E A;  3C21 A;  4C8O A;  4JB3 A;  4MFA A;  3WK7 A;  4Y2P A;  3MR3 A;  4O3N A;  3PW5 A;  1M6Y A;  5FP0 A;  4X5V A;  1ZD3 A;  1IXR A;  2ZIW A;  2HBM A;  1U9L A;  4KLJ A;  1RDF A;  1WUD A;  4F2R A;  1F5S A;  2HHU A;  1O08 A;  1Z00 B;  4M9H A;  2JV3 A;  2NO5 A;  4I2H A;  3E58 A;  1DK2 A;  5ALJ A;  5J0R A;  1N63 A;  8ICY A;  1KFT A;  1JN3 A;  2WFA A;  2IHM A;  2G5I B;  3WKB A;  5ALZ A;  2NYV A;  3DDH A;  3KOO A;  2W54 A;  4M6W A;  5DGB A;  2KEY A;  4QIW F;  4UB6 U;  4DSJ A;  4DSE A;  3A0B U;  4QZ8 A;  1J97 A;  2ZJ8 A;  1ZQE A;  4HAI A;  2RLT A;  4ED2 A;  1RG6 A;  9ICQ A;  5KAF U;  4F4K A;  2F76 X;  2C28 A;  4ZOH C;  1SZP A;  3RJH A;  9ICP A;  3F5A A;  4J9S A;  5JTI A;  4DL4 A;  2H5X A;  5KFR A;  2YQE A;  2CN1 A;  1SGG A;  3SAH A;  1ZQW A;  2H3F A;  2DQN B;  5HHH A;  3SYZ A;  1X42 A;  5KFX A;  3NRZ A;  1KL9 A;  4JUZ A;  2HBK A;  9ICE A;  5J0Y A;  4O3R A;  5KFT A;  4KIT B;  5AI8 A;  5AI5 A;  8ICS A;  8ICV A;  1KW4 A;  2Y1I A;  2ZTE A;  3PST A;  4DFK A;  4C4R A;  2FMQ A;  2OCE A;  4EBC A;  5DG9 A;  1ZQH A;  3HIL A;  1NK8 A;  2BCS A;  5HP4 A;  3N28 A;  5AI6 A;  8ICU A;  2K4H A;  2YB4 A;  5IIM A;  1TV9 A;  2LBO A;  1RYU A;  5GTI U;  1JRP A;  2NRZ A;  1N48 A;  2WHE A;  2GO7 A;  4O3M A;  4AYB F;  4EX7 A;  1QLN A;  2BCU A;  2EAM A;  2MU2 A;  3G6Y A;  4FBU A;  3AM9 A;  2PI5 A;  1K5O A;  4ED6 A;  3LVV A;  4BX9 C;  3PV8 A;  4F92 B;  2C22 A;  4I2I A;  3UMG A;  3C23 A;  5ALT A;  1CI4 A;  1L8O A;  2KHV A;  3EPI A;  4AP9 A;  3LDA A;  5AHX A;  1KEJ A;  1BGX T;  2YMM A;  4I27 A;  3B0Y A;  3BQ7 A;  4M0A A;  1TK0 A;  2WTF A;  1NK5 A;  5J2A A;  3GU3 A;  3K75 D;  3SEN A;  2QLT A;  1KLN A;  3V6K A;  3H8J A;  8ICX A;  4YVZ A;  2BCQ A;  4DLG A;  1X6I A;  2B6G A;  3ISB A;  2XVT A;  2RQ5 A;  3ISC A;  4OJP A;  5AKJ A;  1DGS A;  1QH9 A;  1K1S A;  4J9P A;  1YZ7 A;  3TAC B;  4M04 A;  1L5U A;  4Q44 A;  4ED0 A;  5IIN A;  3N7P D;  1WYG A;  9ICA A;  1XS9 D;  3Q8S B;  5F9L A;  5KFB A;  4JV2 A;  1RPL A;  3B9J A;  4IQU A;  5J2D A;  5DG7 A;  1ZJN A;  3IN5 A;  5E79 U;  3HWT A;  3SV3 A;  4DFJ A;  1JIH A;  2PKE A;  2NRT A;  2YML A;  4C8M A;  2C2D A;  3M7D A;  1C7Y A;  1U4B A;  3JPS A;  2BPG A;  4MEY A;  5L1M A;  1JRO A;  2DGZ A;  2IBK A;  2K4E A;  4ED8 A;  1RXW A;  3OHA A;  1L7P A;  1IV8 A;  3TKA A;  2JEJ A;  1XSL A;  2F3N A;  3PY8 A;  4O5K A;  4QZE A;  3LWL A;  3QX7 A;  3IRU A;  4FE3 A;  5J8Y A;  4RU9 A;  2HMX A;  2R18 A;  2F1J A;  3WKE A;  3WK6 A;  1ZXI A;  4GIB A;  9ICL A;  4YXM A;  2P6R A;  1TK8 A;  1J2N A;  5CEH A;  1L3V A;  5C0Y A;  1SL0 A;  2PXI A;  3M8S A;  2JZB A;  1LB2 B;  1URJ A;  5AKE A;  4QZB A;  2D6F C;  2IOH A;  9ICM A;  4EYI B;  2KKP A;  5KG6 A;  1D8B A;  3SEI A;  2DUY A;  4TUQ A;  2GWS A;  3RBD A;  3M6K A;  4R8U A;  5BOM A;  3TFR A;  4GC6 A;  1DK3 A;  1VLB A;  4I2D A;  3PMN A;  3RF9 A;  3HW8 A;  2VA3 A;  1KKX A;  1B22 A;  1P7D A;  5KT4 A;  1XWL A;  2H3I A;  2FLL A;  2DPJ A;  3WK4 A;  5IIO A;  1X9M A;  3H7I A;  1QSS A;  4LZG A;  5BOL A;  5J0O A;  4QZF A;  3RB3 A;  4DQI A;  5ALK A;  2EH9 A;  4MFF A;  4Z6C A;  2G09 A;  1U47 A;  5AKG A;  3HT3 A;  4TQS A;  4OJ5 A;  2H3Z A;  3MDC A;  1BPX A;  5AKY A;  4RQ3 A;  4PZO A;  4DL7 A;  1NK0 A;  5DGA A;  4UAT A;  3Q8K A;  4M9J A;  5ALP A;  2W8L A;  1QQ5 A;  3C2M A;  2XO7 A;  1RYR A;  5DQG A;  5A0L A;  4PHE A;  4GLX A;  4US8 A;  3WKD A;  3GII A;  2XCA A;  1ZQQ A;  1SWW A;  4Y2J A;  5DDM A;  4U6P A;  2B0C A;  2BCR A;  3UPQ A;  1BPY A;  4JMU A;  2BPF A;  1A76 A;  1XC9 A;  2W03 A;  2KTQ A;  3QE9 Y;  2J6U A;  3H8S A;  2KN7 A;  4YD2 A;  2PMZ C;  8ICB A;  3NAS A;  1ZD2 P;  5TZV A;  3M8R A;  2FLN A;  3QEA Z;  1WWV A;  3V7L A;  1WCN A;  3C2K A;  1ZQG A;  1X9X A;  4TUS A;  4QZH A;  1QSY A;  2R8J A;  2NRV A;  3LYS A;  1TVA A;  5AM1 A;  5J0T A;  2KE7 A;  1LV5 A;  5AI4 A;  4Q8F A;  2MUT A;  2WB1 F;  3HKZ C;  5DBB A;  3F53 A;  4EEL A;  3C5F A;  4EZ6 A;  1ED1 A;  1V9P A;  5EE1 A;  5DB8 A;  5J0U A;  3THV A;  2OEH A;  5ALV A;  5EE0 A;  4EEY A;  2ISO A;  4B6J A;  2QKQ A;  2OYY A;  3KHG A;  3H8W A;  4ELT A;  2MA1 A;  1WWU A;  4M9L A;  5ALD A;  4J9R A;  4Y2V A;  2Q4T A;  3PSP A;  3KD3 A;  3MC1 A;  4J9N A;  3O0F A;  5JUM A;  2HVI A;  4F4X A;  1ZJM A;  4QWB A;  1KTQ A;  3HP6 A;  3JPR A; 
#chains in the Genus database with same CATH homology
 1JI7 A;  1PK1 A;  4RQN A;  2LMR A;  5L1M A;  5JU5 A;  4PZO A;  3BS5 A;  2F3N A;  2E8O A;  1X66 A;  2DL0 A;  2EAM A;  1COK A;  2KSO B;  4NL9 C;  2DKX A;  2QB1 A;  2JV3 A;  2ES6 A;  5J8Y A;  2Y9U A;  2E8P A;  2E8N A;  5KNI A;  2KSO A;  1SXD A;  2K60 A;  1DXS A;  3BQ7 A;  4NL9 A;  4RQM A;  5JRT A;  2E8M A;  1B0X A;  2YTU A;  2K4P A;  3BS7 A;  2FE9 A;  2F44 A;  1PK1 B;  3KKA C;  1WWV A;  2F8K A;  4IS7 A;  1X9X A;  5J8Y C;  1RG6 A;  3IDW A;  3K1R B;  3SEN A;  1LKY A;  3KKA A;  1SV0 C;  1UQV A;  2KE7 A;  3SEI A;  5JTI A;  1B4F A;  2QAR B;  2B6G A;  1SGG A;  2Y9T A;  2EAO A;  4MHV A;  1OW5 A;  2D3D A;  1UCV A;  2QB0 A;  3TAD C;  1F0M A;  1PK3 A;  3BS5 B;  2D8C A;  1LKY B;  1SV4 A;  1V85 A;  3TAC B;  2KMD A;  1KW4 A;  2L5Y A;  2QKQ A;  1SV0 A;  1V38 A;  2DKZ A;  2LPE A;  2ESE A;  1WWU A;  2GLE A;  1Z1V A;  1SXE A;  2QAR A;  3HIL A;  1OXJ A;  1X40 A;  4PZN A;  4NJ8 A;  2QB0 B;  2EAP A;  2KIV A;  3H8M A;  5F3X B;  3TAD A;  2EAN A;  2KG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...