The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
13
|
sequence length |
73
|
structure length |
73
|
Chain Sequence |
MTHHTEVFEGGTIDIEDDTSLTINGKEISYVHDAVKNKWSSRYLPYTQYDSLLDLARAIIRDTVEFSGVKEGS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Nitrosomonas europaea atcc 19718
|
| publication title |
Solution NMR structure of protein NE1242 from Nitrosomonas europaea.
rcsb |
| molecule keywords |
Uncharacterized protein NE1242
|
| total genus |
13
|
| structure length |
73
|
| sequence length |
73
|
| ec nomenclature | |
| pdb deposition date | 2007-09-12 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | protein ne1242 fold | protein ne1242 domain like |
#chains in the Genus database with same CATH superfamily 2ZMX B; 2ZMY B; 2ZWE B; 3AX0 B; 1WX4 B; 2ZWG B; 3AWY B; 2ZWF B; 2AHK B; 2ZWD B; 3AWX B; 2JV8 A; 3AWT B; 3AWV B; 1WX5 B; 3AWW B; 3AWU B; 2AHL B; 3AWZ B; 3AWS B; 1WXC B; 1WX2 B; 2ZMZ B; #chains in the Genus database with same CATH topology 4NBD A; 4NBA A; 1Z01 A; 2DE6 A; 2ZMX B; 2ZMY B; 2ZWE B; 3AX0 B; 1WX4 B; 4NBC A; 1Z03 A; 1Z02 A; 2ZWG B; 3AWY B; 2DE7 A; 2ZWF B; 2AHK B; 2ZWD B; 3AWX B; 3VMI A; 4NB9 A; 3GCF A; 4NBB A; 2JV8 A; 4NB8 A; 3AWT B; 3AWV B; 1WX5 B; 4NBE A; 2DE5 A; 3AWW B; 3AWU B; 4NBH A; 4NBG A; 2AHL B; 3VMH A; 3VMG A; 3AWZ B; 3AWS B; 1WXC B; 4NBF A; 3GKQ A; 1WX2 B; 2ZMZ B; 1WW9 A; #chains in the Genus database with same CATH homology 2ZMX B; 2ZMY B; 2ZWE B; 3AX0 B; 1WX4 B; 2ZWG B; 3AWY B; 2ZWF B; 2AHK B; 2ZWD B; 3AWX B; 2JV8 A; 3AWT B; 3AWV B; 1WX5 B; 3AWW B; 3AWU B; 2AHL B; 3AWZ B; 3AWS B; 1WXC B; 1WX2 B; 2ZMZ B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
