2JV8A

Solution structure of protein ne1242 from nitrosomonas europaea. northeast structural genomics consortium target net4
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
MTHHTEVFEGGTIDIEDDTSLTINGKEISYVHDAVKNKWSSRYLPYTQYDSLLDLARAIIRDTVEFSGVKEGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein NE1242
publication title Solution NMR structure of protein NE1242 from Nitrosomonas europaea.
rcsb
source organism Nitrosomonas europaea atcc 19718
molecule tags Structural genomics, unknown function
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 2jv8A00
3AWWB 1WX2B 2ZMZB 3AWTB 3AWSB 3AWUB 2ZMXB 3AWYB 1WX5B 2AHLB 2ZWGB 1WXCB 3AWZB 2ZWFB 2AHKB 3AWXB 3AWVB 2JV8A 2ZMYB 2ZWDB 3AX0B 1WX4B 2ZWEB
chains in the Genus database with same CATH superfamily
4NBHA 2DE5A 1Z02A 1WW9A 4NBCA 3VMHA 3VMGA 3AWWB 4NBBA 1Z03A 4NBDA 4NB9A 1WX2B 2ZMZB 3AWTB 3GKQA 4NBGA 3AWSB 3AWUB 2ZMXB 3AWYB 4NBFA 1WX5B 2AHLB 2ZWGB 1Z01A 2DE6A 1WXCB 2DE7A 3AWZB 2ZWFB 2AHKB 3AWXB 3AWVB 2JV8A 2ZMYB 2ZWDB 3AX0B 4NB8A 4NBEA 4NBAA 1WX4B 3GCFA 2ZWEB 3VMIA
chains in the Genus database with same CATH topology
3AWWB 1WX2B 2ZMZB 3AWTB 3AWSB 3AWUB 2ZMXB 3AWYB 1WX5B 2AHLB 2ZWGB 1WXCB 3AWZB 2ZWFB 2AHKB 3AWXB 3AWVB 2JV8A 2ZMYB 2ZWDB 3AX0B 1WX4B 2ZWEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AWW B;  1WX2 B;  2ZMZ B;  3AWT B;  3AWS B;  3AWU B;  2ZMX B;  3AWY B;  1WX5 B;  2AHL B;  2ZWG B;  1WXC B;  3AWZ B;  2ZWF B;  2AHK B;  3AWX B;  3AWV B;  2JV8 A;  2ZMY B;  2ZWD B;  3AX0 B;  1WX4 B;  2ZWE B; 
#chains in the Genus database with same CATH topology
 4NBH A;  2DE5 A;  1Z02 A;  1WW9 A;  4NBC A;  3VMH A;  3VMG A;  3AWW B;  4NBB A;  1Z03 A;  4NBD A;  4NB9 A;  1WX2 B;  2ZMZ B;  3AWT B;  3GKQ A;  4NBG A;  3AWS B;  3AWU B;  2ZMX B;  3AWY B;  4NBF A;  1WX5 B;  2AHL B;  2ZWG B;  1Z01 A;  2DE6 A;  1WXC B;  2DE7 A;  3AWZ B;  2ZWF B;  2AHK B;  3AWX B;  3AWV B;  2JV8 A;  2ZMY B;  2ZWD B;  3AX0 B;  4NB8 A;  4NBE A;  4NBA A;  1WX4 B;  3GCF A;  2ZWE B;  3VMI A; 
#chains in the Genus database with same CATH homology
 3AWW B;  1WX2 B;  2ZMZ B;  3AWT B;  3AWS B;  3AWU B;  2ZMX B;  3AWY B;  1WX5 B;  2AHL B;  2ZWG B;  1WXC B;  3AWZ B;  2ZWF B;  2AHK B;  3AWX B;  3AWV B;  2JV8 A;  2ZMY B;  2ZWD B;  3AX0 B;  1WX4 B;  2ZWE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...