2JV9A

The solution structure of calponin homology domain from smoothelin-like 1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
GPLGSKNMLLEWCRAMTRNYEHVDIQNFSSSWSSGMAFCALIHKFFPEAFDYAELDPAKRRHNFTLAFSTAEKLADCAQLLEVDDMVRLAVPDSKCVYTYIQELYRSLVQKGLVKTKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Smoothelin-like 1
publication title Solution Structure of the Calponin Homology (CH) Domain from the Smoothelin-like 1 Protein: A UNIQUE APOCALMODULIN-BINDING MODE AND THE POSSIBLE ROLE OF THE C-TERMINAL TYPE-2 CH-DOMAIN IN SMOOTH MUSCLE RELAXATION.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein, protein binding
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.10 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Calponin-like domain 2jv9A01
4Q59A 4TXIA 3HOCA 4B7LA 1WKUA 1WYRA 3CO1A 2K2RA 2D88A 1DXXA 5A38A 2R0OA 1UEGA 3JAKM 5BVRA 1BKRA 1WJOA 3KMWB 4Q57B 1AA2A 2D85A 3JARM 5A37A 1QAGA 2YRNA 5A4BA 2RR8A 2QJZA 2WFNA 2D86A 2WA7A 5A36A 2EYIA 2K3SA 2EE7A 2VZCA 3HORA 4EDNA 1TJTA 2E9KA 1WYLA 1WYNA 3FERA 1SH5A 1WYPA 4EDLA 2WA5A 2VZGB 1BHDA 1WYOA 3JALM 2L3GA 1WIXA 4EDMA 2VZIB 3KY9A 2JV9A 2D89A 3HOPA 3KMUB 1MB8A 1PXYA 1VKAA 1WYQA 2R8UA 1H67A 2EYNA 4TXKA 1WYMA 1P2XA 1V5KA 1RT8A 3I6XA 1AOAA 1SH6A 1UJOA 3REPB 2QJXA 3F7PA 2WA6A 1PA7A 2VZDA 4Q58A 5J8EA 2DK9A 2D87A 5L0OA 1P5SA
chains in the Genus database with same CATH superfamily
4Q59A 4TXIA 3VP7A 3HOCA 4B7LA 1WKUA 4LVPA 1WYRA 3CO1A 2K2RA 2D88A 1DXXA 5A38A 2R0OA 1UEGA 3JAKM 5BVRA 1BKRA 1WJOA 3KMWB 4Q57B 1AA2A 2D85A 3JARM 5A37A 5FMTA 1QAGA 2YRNA 5A4BA 2RR8A 2QJZA 2WFNA 2D86A 2WA7A 2IGPA 5A36A 2EYIA 5FMUA 2K3SA 2EE7A 2VZCA 3HORA 2WDTA 4EDNA 1TJTA 2E9KA 1WYLA 1WYNA 2HL8A 1SH5A 3FERA 1WYPA 4EDLA 2WA5A 2VZGB 1BHDA 1WYOA 3JALM 2L3GA 1WIXA 2VE7A 4LVRA 2VZIB 4EDMA 3KY9A 2JV9A 2D89A 2VE7C 3HOPA 3KMUB 1MB8A 1PXYA 1VKAA 1WYQA 2R8UA 1H67A 2EYNA 4TXKA 1WYMA 1P2XA 1V5KA 3EAYA 1RT8A 3I6XA 2HKPA 1EUVA 1AOAA 1SH6A 2EQOA 1UJOA 3REPB 2QJXA 3F7PA 2WA6A 1PA7A 2HL9A 2VZDA 4Q58A 5J8EA 2WE6A 2DK9A 2D87A 4DDPA 5L0OA 1P5SA
chains in the Genus database with same CATH topology
4Q59A 4TXIA 3HOCA 4B7LA 1WKUA 1WYRA 3CO1A 2K2RA 2D88A 1DXXA 5A38A 2R0OA 1UEGA 3JAKM 5BVRA 1BKRA 1WJOA 3KMWB 4Q57B 1AA2A 2D85A 3JARM 5A37A 1QAGA 2YRNA 5A4BA 2RR8A 2QJZA 2WFNA 2D86A 2WA7A 5A36A 2EYIA 2K3SA 2EE7A 2VZCA 3HORA 4EDNA 1TJTA 2E9KA 1WYLA 1WYNA 3FERA 1SH5A 1WYPA 4EDLA 2WA5A 2VZGB 1BHDA 1WYOA 3JALM 2L3GA 1WIXA 4EDMA 2VZIB 3KY9A 2JV9A 2D89A 3HOPA 3KMUB 1MB8A 1PXYA 1VKAA 1WYQA 2R8UA 1H67A 2EYNA 4TXKA 1WYMA 1P2XA 1V5KA 1RT8A 3I6XA 1AOAA 1SH6A 1UJOA 3REPB 2QJXA 3F7PA 2WA6A 1PA7A 2VZDA 4Q58A 5J8EA 2DK9A 2D87A 5L0OA 1P5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q59 A;  4TXI A;  3HOC A;  4B7L A;  1WKU A;  1WYR A;  3CO1 A;  2K2R A;  2D88 A;  1DXX A;  5A38 A;  2R0O A;  1UEG A;  3JAK M;  5BVR A;  1BKR A;  1WJO A;  3KMW B;  4Q57 B;  1AA2 A;  2D85 A;  3JAR M;  5A37 A;  1QAG A;  2YRN A;  5A4B A;  2RR8 A;  2QJZ A;  2WFN A;  2D86 A;  2WA7 A;  5A36 A;  2EYI A;  2K3S A;  2EE7 A;  2VZC A;  3HOR A;  4EDN A;  1TJT A;  2E9K A;  1WYL A;  1WYN A;  3FER A;  1SH5 A;  1WYP A;  4EDL A;  2WA5 A;  2VZG B;  1BHD A;  1WYO A;  3JAL M;  2L3G A;  1WIX A;  4EDM A;  2VZI B;  3KY9 A;  2JV9 A;  2D89 A;  3HOP A;  3KMU B;  1MB8 A;  1PXY A;  1VKA A;  1WYQ A;  2R8U A;  1H67 A;  2EYN A;  4TXK A;  1WYM A;  1P2X A;  1V5K A;  1RT8 A;  3I6X A;  1AOA A;  1SH6 A;  1UJO A;  3REP B;  2QJX A;  3F7P A;  2WA6 A;  1PA7 A;  2VZD A;  4Q58 A;  5J8E A;  2DK9 A;  2D87 A;  5L0O A;  1P5S A; 
#chains in the Genus database with same CATH topology
 4Q59 A;  4TXI A;  3VP7 A;  3HOC A;  4B7L A;  1WKU A;  4LVP A;  1WYR A;  3CO1 A;  2K2R A;  2D88 A;  1DXX A;  5A38 A;  2R0O A;  1UEG A;  3JAK M;  5BVR A;  1BKR A;  1WJO A;  3KMW B;  4Q57 B;  1AA2 A;  2D85 A;  3JAR M;  5A37 A;  5FMT A;  1QAG A;  2YRN A;  5A4B A;  2RR8 A;  2QJZ A;  2WFN A;  2D86 A;  2WA7 A;  2IGP A;  5A36 A;  2EYI A;  5FMU A;  2K3S A;  2EE7 A;  2VZC A;  3HOR A;  2WDT A;  4EDN A;  1TJT A;  2E9K A;  1WYL A;  1WYN A;  2HL8 A;  1SH5 A;  3FER A;  1WYP A;  4EDL A;  2WA5 A;  2VZG B;  1BHD A;  1WYO A;  3JAL M;  2L3G A;  1WIX A;  2VE7 A;  4LVR A;  2VZI B;  4EDM A;  3KY9 A;  2JV9 A;  2D89 A;  2VE7 C;  3HOP A;  3KMU B;  1MB8 A;  1PXY A;  1VKA A;  1WYQ A;  2R8U A;  1H67 A;  2EYN A;  4TXK A;  1WYM A;  1P2X A;  1V5K A;  3EAY A;  1RT8 A;  3I6X A;  2HKP A;  1EUV A;  1AOA A;  1SH6 A;  2EQO A;  1UJO A;  3REP B;  2QJX A;  3F7P A;  2WA6 A;  1PA7 A;  2HL9 A;  2VZD A;  4Q58 A;  5J8E A;  2WE6 A;  2DK9 A;  2D87 A;  4DDP A;  5L0O A;  1P5S A; 
#chains in the Genus database with same CATH homology
 4Q59 A;  4TXI A;  3HOC A;  4B7L A;  1WKU A;  1WYR A;  3CO1 A;  2K2R A;  2D88 A;  1DXX A;  5A38 A;  2R0O A;  1UEG A;  3JAK M;  5BVR A;  1BKR A;  1WJO A;  3KMW B;  4Q57 B;  1AA2 A;  2D85 A;  3JAR M;  5A37 A;  1QAG A;  2YRN A;  5A4B A;  2RR8 A;  2QJZ A;  2WFN A;  2D86 A;  2WA7 A;  5A36 A;  2EYI A;  2K3S A;  2EE7 A;  2VZC A;  3HOR A;  4EDN A;  1TJT A;  2E9K A;  1WYL A;  1WYN A;  3FER A;  1SH5 A;  1WYP A;  4EDL A;  2WA5 A;  2VZG B;  1BHD A;  1WYO A;  3JAL M;  2L3G A;  1WIX A;  4EDM A;  2VZI B;  3KY9 A;  2JV9 A;  2D89 A;  3HOP A;  3KMU B;  1MB8 A;  1PXY A;  1VKA A;  1WYQ A;  2R8U A;  1H67 A;  2EYN A;  4TXK A;  1WYM A;  1P2X A;  1V5K A;  1RT8 A;  3I6X A;  1AOA A;  1SH6 A;  1UJO A;  3REP B;  2QJX A;  3F7P A;  2WA6 A;  1PA7 A;  2VZD A;  4Q58 A;  5J8E A;  2DK9 A;  2D87 A;  5L0O A;  1P5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...