2JVGA

Structure of c3-binding domain 4 of staphylococcus aureus protein sbi
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
72
structure length
72
Chain Sequence
GAMVSIEKAIVRHDERVKSANDAISKLNEKDSIENRRLAQREVNKAPMDVKEHLQKQLDALVAQKDAEKKVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords IgG-binding protein SBI
publication title Structure-function analysis of the C3 binding region of Staphylococcus aureus immune subversion protein Sbi.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
total genus 24
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11621 Sbi-IV C3 binding domain 4 of IgG-bind protein SBI
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1270 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2jvgA00
3D5SC 2WY8Q 3D5RC 2NOJB 2JVGA 2JVHA 2GOXB 2GOMA 2WY7Q
chains in the Genus database with same CATH superfamily
5D5WB 4ZZDA 2X1CA 4LGWA 3ZPLA 1SD4A 1Z67A 2EQRA 2F6CA 2LRDA 3PQKA 2RV8A 3CP2A 1TQMA 1S9HA 3D5RC 4RB3C 2L9VA 4B8XA 4EM1A 3DEWA 3K4LA 3OYEA 2IGKA 3A0BC 2KDOA 2H1LA 4OOIA 2Q8KA 2BXZA 2GWRA 2XSJC 1ETVA 3LSIA 1D1AA 4EQQA 3H9GA 4HF2A 3OS1A 1W0UA 4BKXA 1YIJI 2E2JJ 1A6IA 4HQEA 4YELA 4UVAA 1E3HA 5FLXZ 4YIFA 4OIOF 2UXNA 2R7TA 3GZNB 3QAHA 3L2VA 5JVGF 1LE8B 3S2DJ 3A01A 2CQNA 2R7RA 3K0LA 1PUFA 2XGXA 2Z5UA 1WPKA 4LLGF 3FM5A 3HKZA 1SFEA 1DGRM 2BY1A 2X6WA 2A05A 4ESJA 3LSHA 2OBPA 3BR5A 3GF2A 3LSTA 5F1RA 4ENKA 1VQ8I 4MEXF 1IO2A 2BY2A 2HVSA 2PEXA 3HRSA 3G1OA 2JPBA 3T8TA 2BXYA 3N05A 3BTLA 4Q47A 1LKXA 3V7RA 4XSZF 1XGSA 4ZJZA 4BHCA 1BIBA 4XLCA 3HPGA 3RDIA 4QTRA 4E4HA 2RQQA 1R49A 2QYOA 1QZEA 4XR6A 3CDHA 1AKHB 2M4KA 2BW3A 1G4DA 1ON1A 1XMXA 2KISA 2OF7A 1HKSA 1LJ9A 2LBFB 4AIDA 3F9KA 1FP2A 3DQVC 1RUOA 4LLNA 3AG1H 4HPQA 2IXSA 1JKOC 2LKSA 3D0SA 1BM9A 4NUBA 2OPTA 3SQNA 4I6ZA 4WXCA 2GOMA 4J01A 4B3XA 1W7PB 2Q2EA 5BQTA 1QVTA 1OR7A 4M3DA 1R5ID 3CCSI 1WJEA 1P7JA 2L3DA 4BS9A 2M1BA 3HOWJ 3VYRB 5IP7J 1ZREA 3LOCA 1W5CC 1FEXA 1WJAA 3FBIB 1ZG3A 3SHFA 4BDYA 3F8NA 2ELJA 3G71I 3BWGA 2GAUA 1EKEA 2R7VA 1T39A 2R0QC 1IV6A 2CSOA 2XAQA 4KYWA 4C3JJ 3Q0UA 2E7XA 3GFLA 4YFXF 3ERED 1APLC 3ERMA 3QU6A 4CUGA 1WH5A 2V1NA 3C1DA 2WAQA 1B8IA 1LDDA 2F5CA 3KE2A 4MQ9F 1MDMB 1WJ5A 4L5EA 4D5CA 2PLYA 4P5OA 2DFIA 2IPQX 4B48A 4D7MA 1XSXA 4H4KC 3S14J 3KEQA 2PJPA 2ACJA 3WGGA 4BEHA 2IRFG 1PYVA 2M45A 1SMTA 1TTYA 2XUBA 5EZGA 4NC7A 2PBIA 3HSEA 2L7KA 3BCAA 4HOBA 1POGA 1KU2A 2O61A 2XAGA 3MN2A 4Q4ZF 1E2XA 4W1UA 1T56A 2EBIA 3OIPA 5C4JJ 3KETA 2VLAA 2LYCA 2R7ZJ 1DPUA 3VPRA 5A2QK 1ODDA 2Z9OA 2L2OA 4BL0B 3RPUA 4ZYEA 2JA7J 5FD5A 2JQ7A 4GDFA 2AXLA 2CQQA 1HQCA 4XNFA 4J00A 5LBQA 5K5OA 3CJRB 5GTIC 3VYSB 4A2UA 2RVCA 4XKBA 5ICEA 2DK5A 1FTZA 4C3HJ 4AIJA 1PUEE 1P4XA 2X4HA 2ELKA 4OAZA 5J8CA 1YI2I 4HLXA 2GA2A 3CZ6A 3HUGB 1QHHD 1WFXA 1MMDA 4DBQA 4DW6A 4L5JA 4HYEA 3V7SA 2R7DA 1J09A 2CJJA 3WODF 1BOAA 2KZVA 1YG2A 3O3KA 1CF7B 1G59A 3ML6A 4CHUA 3RCOA 1FLIA 3P9CA 1KONA 1MSFC 3S1QJ 3TP3A 2F5FA 1FIAA 2H09A 3LL7A 4DYCA 1BW5A 1BC8C 2BVLA 4HX7A 3OIOA 1BR1A 3CCUI 3BZCA 2GZWA 3DP7A 2IS4A 3WU0A 4R1HA 5LGTA 2QSFX 5CVRA 4MTEA 2QGUA 3S15J 4QPQA 3EUAA 5FROA 2OJED 2W7NA 4K2EA 4HV5A 3FXOA 1X4OA 4E7HA 2W48A 3SXYA 4AWXB 3E1SA 2GXAA 4I99C 2STWA 1SD7A 2EZKA 5D4RA 2BHYA 3F8MA 5FFZA 1GHCA 3FKJA 2QLZA 2VOPA 2H27A 2JA6J 4BGDA 3JREA 1TW2A 4QPOA 2DAOA 1B72B 3RJPA 4IRHA 1F1ZA 1XN7A 3SJMA 4Y52J 4PDKA 3OOUA 1ETQA 1G6NA 2KHMA 3FK6A 4AYBA 5IY5H 5EF6A 4S05A 3I64A 3SFZA 2L5QA 1QO0D 2RKHA 3PO2J 1MKMA 2LY1A 3DLAA 2COBA 2Y0SN 2CV0A 4LITA 2EV6A 5BMZA 2HYJA 5C4XJ 2KIUA 4HAMA 4ITVA 3F8BA 3PM1A 3HDDA 3HKZN 1MBJA 4BE0A 2K85A 1IJWC 1JTYA 3S16J 1K4SA 4DIQA 3VDXA 4V2GA 5F0CA 1IZ1A 1Y8QB 2A5WA 4GFBA 3WHCA 3JSPA 4WX9A 1X2NA 1EF4A 3BR6A 4HV6A 2EV0A 1DDNA 4EJVA 3WG9A 4OMZA 4XLEA 2K9NA 4L9TA 1NH3A 2VQGA 2N8GA 3HHHA 2EZIA 4C9YA 1JXSA 3AKZA 2HFHA 2K40A 2L9RA 1FBSA 3I71A 2DK8A 3JW4A 4S0HB 2LH9A 2W84A 3HOTA 3CMEI 3IH2A 1YTYA 3RSNA 1JJ6C 2IGNA 4CZCA 3W3CA 1QGPA 4D9JA 5AIPA 4A3FJ 1E3PA 1U9OA 4U88A 5HDGA 1YHQI 4PSWA 3DLLF 1DU0A 3C3WA 5LHHA 5M3MJ 5GAHJ 2Y69H 2IP2A 3IWZA 2JMWA 4HA8A 3OOPA 3PUFA 2UUZA 2VBWA 3CCEI 2HEOA 3V8JA 5EG0A 1FBQA 1K78B 4Z6YA 1UG0A 4CCJA 1OYYA 5D5UB 3I54A 3LAPA 2JSPA 3DU6A 4WK8F 1FYKA 2DYSH 1B6AA 3HPHA 3UNGC 2BHZA 1X1BA 2X6OA 1WKMA 5AONA 4EJOA 3DF8A 1H88C 1YJWI 2ZB9A 4M6YA 5KVRA 2OV7A 3K4BA 3ECOA 1YS7A 2M8GX 5FLVA 2WAQN 2L02A 2XGDA 2OD5A 1RETA 3M7GA 5LD2C 3DEEA 4RB2C 1WQ2A 2BBYA 3MZHA 1QPIA 5BPIA 2DA3A 4LG0A 1OYIA 1VTNC 2FQ4A 3NEUA 5JHFA 2XV4S 1RESA 4DNCA 2P6TA 2EFWA 4A3MJ 2MD0A 3K4MA 1HW5A 3HRMA 3CJTB 1REPC 4IRGA 3QYEA 3LFKA 2TDXA 3BC8A 4A6EA 3DCFA 4A3LJ 3MKWB 2QWWA 3HIFA 4FX4A 1YOVB 3NRVA 1XG1A 1D5YA 3Q9SA 2OQGA 2DA1A 2E19A 1FYMA 2R7FA 1BI0A 4HG2A 3K4CA 4U0VA 5CYVA 1BL0A 2R92J 2OCEA 3M3YJ 1JUSA 2HQAA 3L2QA 3OR1C 4A3JJ 2ISZA 1H89C 1QBJA 4CXFA 2AQEA 3TW7A 5M5XJ 4NBQA 1EH6A 2ZNYA 2DMQA 4GYGA 2FF4A 4X0GA 1LFBA 4NHJA 4MLOA 4HF0A 5BNGA 4CCNA 2IA2A 1YJ9I 2JK3A 4A93J 1TT0A 2B0LA 5E3NA 2K9QA 3ZQLA 1IRFA 4EGYA 2WTEA 1Z91A 4A0YA 3KYDB 2BGCA 2LR8A 4A69C 1LE8A 2ZFUA 1I39A 1XCBA 2BY0A 2EIKH 4OIRF 3EUHC 1FP1D 3ZCOA 3WU2C 4IJAA 5KNLA 4E7JA 3M4OJ 1P4AA 4HX8A 4YIRX 3FXJA 1UCRA 2FX0A 1N77A 3LSPA 3MD2A 1SFKA 1S72I 4V19K 4UXNA 2CUEA 3PFYA 1HA8A 3CUQC 3CO6C 4Q5SF 1T8IA 1YRNB 3L00A 4XK4A 5BOXA 4PFOA 1YQAA 2P81A 2QBYB 3LMMA 5DEQA 3J80Z 2DN0A 4IKFA 2IEKA 3JCUC 4BJ6C 2H1KA 2DTZA 1ETWA 2HU9A 4GO1A 1UAAA 1D3YA 1S5LC 4X1EA 3H5RA 2LF7A 1W5TA 4M3GA 2LBFA 2CV1A 2YR2A 4E7LA 5HODA 4AYBN 2Y48A 3U1KA 2G9WA 4PJLA 1ZN2A 2M2EA 4UUSB 3PIOF 3GLLA 2KLOA 1X1DA 1J2XA 3L2UA 1XB4A 3B6AA 1W7PA 2D2WA 3LA7A 1VQ7I 4AU7A 1FBUA 1MBKA 2M0MA 5IPAA 3GTMJ 5D8KB 4BQQA 4G7HF 3HYIA 2E1NA 4AVZA 1B59A 2HKOA 1NK2P 2VUMJ 4LFUA 1S6LA 4JBAA 2HOEA 4JQFA 5JLXA 3P9IA 3E6DA 1HKTA 3OY9A 3F8FA 3KX2A 3SYTA 2ZXIA 3TL4X 2JZYA 2X51A 5D6FA 1B4AA 3IRQA 2DMNA 2PQ8A 1G3YA 1J7KA 4CSWA 2UV1A 2KL4A 2RGVA 3TP0A 4QIWN 3VYUB 3E5UA 4YFNF 3QPSA 2VL8A 2W57A 5LFAA 4XN3A 2BE5F 2L4AA 3LQQA 4MIMA 2B7EA 4UVBA 3N4MA 1MDMA 1D8KA 2DT7B 4C2UA 1Y1VJ 2DYRH 3S1RJ 3KPHA 1H8AC 4EGZA 1KA8A 2JUCA 1P2FA 2NS0A 1LNWA 4BQNA 2DXIA 3BJOA 1U2WA 2E1OA 2CUJA 3OYIA 4IQJA 1P4WA 5GP9A 5J8FA 2IBDA 3ABUA 3MKYB 1UB9A 1CGPA 3VB2A 1AU7A 3UR3C 2HDWA 1HW1A 3BPXA 1LDJA 3ZMVA 3Q9VA 2MH2A 5E3MA 1SFUA 4RS8A 1FOXA 2DBBA 5D6EA 3A02A 5F27A 2XPWA 4QWQA 1QNTA 1IXSB 4CDGA 3K70D 3NAUA 3S2WA 4RGRA 3GFIA 2MABA 5HS7A 1HKQA 4A0XA 2NVYJ 1MZBA 4EATA 2G7HA 2DOAA 3ZRGA 4XRFA 1A5JA 1U6GA 4I76A 3OSFA 2BVMA 1P9QC 3FMRA 1OR7C 5FKKA 3ONQA 1HSJA 1GLNA 1T33A 3HUGA 2NAZA 3GWZA 2XAUA 3OYDA 2P7CB 9ANTA 1MMNA 5C3EJ 1EH7A 3FIWA 1XMKA 5CLSA 3H5NA 2LD5A 1DP7P 4U0YA 1CF7A 4L0ZB 2JUGA 4O6JA 1Z05A 1HW2A 3HOYJ 4O3MA 4A3GJ 2DQLA 1ERDA 4LB5A 3Q5FA 1U0JA 1YW9A 5GADJ 2OTLI 2RREA 1LFUP 4Q48A 3EUHA 3HJEA 3JAMK 1FTTA 3T5XA 3OR2C 5DYMA 4CGZA 2KRHA 2VKEA 2KJCA 2P6SA 2M34A 1MGTA 2FMLA 1ZG1A 2NOGA 2E2HJ 5LHIA 1JJ8C 2PFBA 1XGNA 4M9XA 4O5VA 2ZJRF 3DXJF 2CQKA 3OSGA 1F36A 1TW3A 2DFHA 1GXPA 4XIDA 1KQ9A 3RIRA 3A03A 3BOQA 1B72A 2IW5A 2Z1DA 4MGRA 1E17A 1X19A 3M1CA 3FXLA 3ZOBA 5M5YJ 2IGOA 4BBRJ 1VQ4I 2V9VA 3M8EA 5DUKA 3OYLA 3ZMTA 3E5QA 2CWEA 3WGIA 3K70C 1ZH5A 4XOTA 1HF0A 4LIVA 2HGCA 2NRAC 1O3QA 1LDKB 3S1NJ 2JRTA 2EFNA 2K5CA 1ZQ3P 2XC7A 3BG7A 4FETA 4YEJA 2EH3A 2DT6A 5GAEJ 2XGCA 2DMPA 2M5WA 1Z7UA 1R6RA 4S04A 1OYWA 2AO9A 1RRJA 2QQ8A 3QOEA 2UWMA 5IYCJ 3D5SC 4MO7A 3HL2A 3IAM2 1F5TA 3MVPA 4QSHA 3ZMSA 4MQVA 5J4YA 3RYPA 3VEPA 2L54A 1JI8A 5H2FC 4IHTA 1VF9A 3IL2A 3DTKA 5AIQA 4ESBA 3RKQA 2FXAA 2GBYA 2OQRA 3BDDA 4MEYF 3EPZA 1MD0A 1AA7A 3BTIA 3I58A 1ON2A 5FJ8J 2XPVA 2ZCWA 2LOOA 3DPLC 2H6BA 4OIQF 3H5AA 2RQPA 2LTPA 2HDCA 4HNUA 1I50J 3C2BA 1U5TC 2EWNA 1IN7A 4XM3A 1XDUA 1SVLA 2OA4A 4WXDA 2ECCA 3DBHB 3FK7A 1MBGA 3A2KA 1E3OC 2STTA 2EPFA 2P4WA 3LWFA 2FE3A 1Y8RB 1UHMA 1KU7A 1X1PA 3HOZJ 3CCLI 4BH9A 3GTQJ 4IOCF 1IV8A 2NXNB 1G3SA 4II3A 5L3FA 2H8WA 1XSDA 3NWTA 2EFQA 3H3UA 2A6EF 3JAMZ 3HG9A 3CCRI 4YG2F 4CA0A 4UVCA 3D5LA 5LGNA 1O7LA 3HTSB 2I8DA 4FQGA 2E1MB 1R4MB 1X58A 2ZMEB 2ZO4A 3OS0A 3PSFA 1USSA 1R22A 3CD6I 3O8GA 1K78A 2XPUA 1EV7A 4XKWA 3I4PA 3DV8A 3MWMA 2A6TA 4W97A 2K02A 3S3OA 4HRIA 2FOKA 3KP7A 1T08B 3VODA 4BY1J 2W4SA 2F4IA 1WJCA 1BN5A 4XKCA 5CVVA 4KJZA 4CCOA 3LAJA 3DWLE 3OIQA 3EYYA 5K7FA 3FXUA 1R1VA 1G8XA 1HBXG 3L7WA 3GZ5A 4RM3A 1XC5A 4M3BA 2KRCA 4L0YB 5IT9K 1WJDA 3IH4A 2YSRA 1QQIA 1YO5C 1IDZA 3CC7I 1S7EA 3KP6A 2MH9A 3TMOA 4E7IA 2K9SA 1LVAA 3OL3A 5FKMA 2DPDA 2JN6A 1R58A 2QUFA 3GTGJ 3E7LA 5CKTA 4IHXA 3G3ZA 1MBFA 3H3VK 2XHKA 2O8XA 3BPVA 4HNTA 4RB1A 4KFCA 3OV8A 3AL0C 2VBXA 2NYXA 4A3CJ 1A36A 1ULYA 5EEGA 3DPTA 5CVJA 4RB0A 2V1UA 1T0FA 3OWTA 4Y7NJ 5F08A 3WTWC 4U7DA 4IHSA 4PGHA 2CFOA 1DGWY 1UZCA 3SEQA 2H6CA 3ECHA 4UHTA 1FMWA 1ZR2A 1LUJB 1K83J 2BYVE 1FOWA 3ABKH 4C3IJ 2L7ZA 1KU9A 1Z9CA 2VE8A 3IC7A 4RAFA 1SEUA 2Y0MA 2WY7Q 1QU3A 4JX4A 2DO7A 3HOSA 4XLHA 3RKWA 4HNVA 3K1NA 5LLQA 1NG7A 2FNPA 2KRFA 3AFHA 5KAFC 1QA6A 4Y33A 1R7JA 1HSTA 3PNVA 2R7OA 2TCTA 3LSMA 1P6RA 4BY7J 3TGNA 4CZZA 4F52A 2M7BA 3S17J 4U87A 2CUFA 1WCMJ 1WH7A 4AC0A 2XGEA 5TJJA 3TOBA 3L1PA 1BJAA 2CYYA 2MC3A 1YRNA 4I98B 2VPRA 2P5LC 1SVOA 2CFXA 3PIPF 4IPAA 2QBYA 2ECBA 1N75A 3JR9A 2NVQJ 1XGOA 1BI2A 2Y75A 2Y2ZA 2Y30A 2HNHA 4XRSA 1IRGA 4RMNA 2Q0OA 2VXDA 5DUIA 1EJ9A 1FJLA 1TQIA 3RI4A 3IP4B 1O57A 1Y39A 2KIFA 4RAYA 2Y9ZA 1MJ9A 3HZJA 4XORA 1U5TA 4KUMA 2X48A 1W7PD 5KHDA 2EJRA 3BT9A 3K9TA 3HSRA 3IAS2 1Z3XA 1Y0NA 2LKPA 4KICA 2LMDA 2K86A 1PVEA 2VT2A 4UUSA 5IT9Z 2ZC2A 3FXMA 1JE8A 3IHUA 3J7AY 2EFPA 3FISA 3R60A 5E3LA 3QU3A 1X3ZB 2EA4A 1XS9A 3BR1A 1HCRA 1FSEA 1JUPA 3TDZC 2F2EA 2HZDA 4BHPA 4XQFA 2H8RA 2QZ8A 2VOOA 4LOCA 1PJRA 1Z77A 4M9ZA 3RPQA 2XAFA 5IYBJ 4KIFA 3CCVI 3I55I 2JVGA 4B44A 4ETSA 1XD7A 1T6SA 2V4JC 1MJAA 2LKXA 3CTAA 3DBRB 3LA3A 2O03A 1RKTA 2PMZA 2JSCA 3I59B 4RBOA 4BQOA 2OCCH 2HOTA 1J0RA 1TNTA 1XSVA 3FMSA 2R5YB 2JVHA 1BI3A 4QLCU 5JFRA 5C44J 1SMYF 3OYHA 4UV8A 2Z16A 3GBGA 5B5EC 3GEZA 2XSDC 1JKQC 2E34A 5A2QZ 3WGHA 5FRMA 4H0EA 2OZUA 3ZMDA 2G7UA 1ZG5A 2F4MB 4XLAA 4B47A 2X0LA 3DU5A 2XF7A 1D5VA 2WB1A 2QQ9A 3FX3A 2Q1ZB 2VB6A 4M9SA 2V6EA 5JI6A 5ICGA 4XBFA 1S7OA 3NWSA 3FF5A 4ENJA 2E1CA 3ZP5A 4CH7A 3PFIA 1UFMA 2HWVA 1LEAA 2IVMA 3JRCA 1ETYA 1VQPI 3QP6A 4IF4A 4FASD 1JT0A 5J47A 4DYQA 3WTTC 2W1OA 2MLGA 5DS9A 2X85A 1T2KA 2E1MC 3GZ6A 5FLMJ 4PGGA 1IAWA 3CJQB 3HEFA 2MD5A 3KLNA 4KITB 1OCZH 3BP8A 2VODA 3V7CA 5IYDJ 4OINF 3OYGA 2V1XA 1YITI 4BXUA 1R71A 2YX7A 3BCBA 2XIGA 2F5DA 4ZYHA 1O7FA 1S3JA 4BE2A 5TGTA 1VQ6I 5HS8A 2CQXA 2JA2A 1V55H 1JUMA 4KIBA 2I10A 4I0BA 3FMQA 2RN7A 4G6TB 4I0AA 1UHWA 4ON0A 2M87A 1N25A 4F3QA 2F4OB 1PP7U 3WTXC 3V8KA 3RKXA 2KIMA 3W6VA 4UB6C 1DU6A 1CQTA 3L2RA 2I5UA 3KEYA 2WADA 2O0YA 1USTA 3HBLA 3X2QH 1NHAA 1VI0A 2YS9A 4B4CA 1M1EB 2LDUA 4XLPF 4FT8A 3S93A 1X2MA 2EA2A 2HQNA 1E0EA 1MH4A 5FRNA 4L18B 4BDZA 3HRUA 3VSKA 2DA7A 3O2PE 2ETHA 3AG2H 5CJ9A 3J81K 4BNCA 2OU2A 4ZYDA 1J9IA 3ZN1A 3HRTA 1HOMA 2EILH 4ZDOA 4B43A 5DCMB 3ZR8X 1VFCA 5DDGA 1OMIA 3I9V2 2W85A 4B09A 3E3VA 4A3BJ 3VSLA 3V4GA 3I56I 3VOEA 2JWTA 4F7ZA 3O8HA 4G8XA 1GDTA 2EZLA 3RZOJ 2HZTA 1SVMA 1MBHA 5E79C 2P5KA 2HPMA 1D0YA 3KCCA 5L3DA 3JRBA 1KU3A 1X1CA 1FY7A 1FMVA 5B3SH 3G1MA 5FKOA 3ZN0A 1OQYA 2DJIA 1R9TJ 3O6BB 1JGSA 2GA1A 4G6DA 3TDUC 2X9DA 4IOAF 1ORKA 1D1CA 1OCPA 4BEHB 1ZAOA 1RPWA 4G9YA 3TO7A 4ZZLA 1MSEC 3PNTA 5GTHC 3W2WA 2RC4A 2RAEA 5LGUA 2QVOA 1T98A 2YU3A 5L3BA 1I1SA 3L09A 2VBZA 1WVRA 1RKWA 1HDPA 2ELHA 3LSJA 3G2BA 4G6QA 4JX5A 4EJTA 2DT5A 4HZFA 5HNHA 3CF5F 4OIPF 3FKIJ 2OUMA 4M3EA 1TP4A 1OKRA 3IKTA 4ZYAA 3ROUA 2HTSA 3ZQFA 3HB9A 2KP6A 2LK2A 4PJNA 4A3EJ 2KJBA 3FZVA 1SAXA 4A6DA 3QPTA 5GAGJ 2QCOA 4RGSA 2CV2A 3DKYA 3F6VA 2VKVA 3H36A 3CDLA 4N9HA 4RGUA 2A61A 5L3EA 3JRFA 2XKPA 1IUYA 2GQQA 2FBKA 3CF2A 5F6FA 3WTUC 2WAEA 2LVSA 5LRSA 2UZKA 1ZGWA 1WHUA 1LEBA 2VQHA 3FM3A 3MMYB 2ZXWH 3SDGA 2K7LA 3E97A 2K9LA 1D1BA 4RA2A 2HS5A 1AKHA 1R36A 5ERIA 2LP0A 4CICA 3QOPA 2HPIA 2CUZA 1I3QJ 1VNDA 1Z0XA 2YU9J 3GTLJ 2ICWG 2BV6A 2FUG2 3KP5A 4GYIA 2M0CA 1RC9A 3OYMA 3GW2A 4CYDA 2F5VA 1SD5A 2ZMEA 3SFIA 1V54H 1KYWA 1DP3A 3F3XA 2DA6A 3F22A 3F23A 2X6XA 1IDYA 1I5ZA 1TBXA 1U8BA 1Q1HA 3RZDJ 2QQBA 2L0KA 2KIQA 4L5IA 4LLLA 2PMZN 1QHGA 3KP3A 2E71A 3ZQIA 4ZDPA 1UG2A 2J5PA 1IN8A 2X1DA 1Y1WJ 3R6SA 5EYRA 2CRGA 1B9NA 1LQ1A 1FZPB 1OLTA 1BI1A 1ENHA 5E3OA 4BE1A 1H0MA 1LB2A 2Y31A 1XX5A 3GYHX 5E8IA 3ISPA 4LJZF 2M4GA 4Y13A 4NB5A 4C2MJ 4I09A 3S32A 3M8FA 4BAYA 3GTPJ 3HOVJ 2GLOA 2VBYA 2VKDA 1Z3YA 4M72A 2EK5A 3H9QA 1S29A 4PCQA 2HOSA 3MZ8A 5FFXA 2VT3A 4EV0A 3MFKA 4J19A 2NVUB 3CCJI 2FBHA 2AS5F 2KDZA 3CDIA 2YX4A 2V6CA 2KT0A 3S1MJ 3OYJA 3PUBA 4ENMA 2DA5A 4BXFA 4DOZA 2VJ5A 3A1YA 1ZHFA 3ASOH 3BLYA 3U2RA 5GPCA 4DZJA 2ZJQF 1PP8F 1D0XA 5FGMA 3TW6A 3PO3J 2W24A 2MFZA 2CW8A 2FBIA 3DPUA 2FU4A 3KZZA 1STZA 3VWBA 3GVAA 3OYAA 2JTVA 1FIPA 3KFWX 1IN4A 4KT6A 2DU9A 4KNYA 1BR4A 3H0GJ 3VFZA 4P1WA 1V3FA 2NS8A 2DQRA 2VONA 3TOAA 3G73A 3EDPA 5J1YA 4HQMA 1RUNA 1MMGA 4DZPA 2R5ZB 1TT5B 2VN2A 4AVPA 1IXRC 1EA3A 1R4NB 1EH8A 4NDLA 2XB0X 5D4SA 5FLXK 2QA4I 4LK1F 3H35A 5FB2A 2RDPA 2DA4A 3B6CA 4HLYA 2ZJPF 1D0ZA 2CU7A 2FRHA 3EQLF 3OYBA 1VZ0A 4KMUX 3K2AA 5DD4A 1RZ4A 4FX0A 2FNAA 1Q1VA 4IRIA 1TZLA 1Z7LA 2QQAA 2BEOA 2FEZA 1Y0UA 4IHVA 1D8JA 1SANA 2NVXJ 4UUTA 2LY9A 2JA8J 1X3WB 1Y6IA 3SZPA 3BJ6A 4D0PA 4IQ4A 1JKRC 2XAHA 4N9IA 3P9KA 5IOYA 2CG4A 4X6AJ 4A12A 5E17F 2HQRA 2MC4A 2ESNA 3BROA 2PN6A 3BR3A 1RR7A 4NQWB 1T0FC 3ASNH 3DFGA 5E18F 2OZ6A 4CO8A 2IS6A 4KMFA 2LREA 4ZTFA 4RM2A 2MLKA 3IV5A 4F91B 1G3WA 4ZYGA 4M6VA 5F0FA 1R00A 4IZZA 4F92B 2O5RA 3PL8A 4BACA 2XF5A 4UB8C 4IXAA 1W36D 2E35A 1KQ8A 4AIKA 3SEZA 3I4NJ 1XTAA 2XASA 4EMSA 2LG4A 1KQ0A 2A5YB 3AG3H 1SFOJ 4EM0B 3BG9A 2W82A 2JJ7A 3GMEA 1QZYA 2CW7A 1UELB 2A3SA 3JRIA 2L7MP 3CQZJ 3RQIA 2JT1A 3IWFA 4WF2A 3ZQ7A 4L9JA 5FO5A 3R0AA 3C18A 4PJMA 2JPCA 3BZ6A 4EJUA 2MYSA 2V26A 2MSYA 5JLWA 5EGOB 1VQ5I 3T8RA 1K6YA 2JRMA 5H6QA 2R5YA 1IN6A 4L9NA 3F0CA 1T38A 5LEKA 2LY2A 4RAGA 1YW8A 4XKVA 2PI0A 1K61A 2KZGA 1BIAA 3OYCA 2XAJA 3CJNA 4HF1A 1TWCJ 4OAYA 3ZQQA 3BTJA 3F6OA 4IO9F 4N4NB 2XF6A 3ZXSA 3KLOA 4HDVA 1V5EA 1ZLJA 1V4RA 5J40A 2GIVA 2QEXI 2H94A 1X3UA 1C0WA 3LSRA 5KCMA 3UKGA 2V9KA 1LVKA 3I53A 2WV0A 2XRNA 2HKXA 4M74A 3NQOA 3K7AJ 4G94A 4A3IJ 5HDNA 2ME0A 1IC8A 2R3SA 1Z6RA 2Z99A 3HOUJ 1ZLKA 2Y0SA 2ZBKA 1J59A 3L2CA 1SD6A 1YE9A 1BR2A 2LFBA 1YX5A 5IT3A 2V9PA 4A3KJ 4KIGA 2VI6A 2P0WA 2YPRA 4XOPA 3QYBA 1RNLA 1UHSA 2WAFA 1F9NA 4MFEA 3CMYA 2GM4A 4BQAA 3L2WA 5E20A 2EINH 3P7NA 2DW4A 4E70A 2V79A 3DTEA 3U1DA 4ESFA 2QM3A 3WE2A 5B66C 3QRFF 1TWHJ 2WC2A 3E5XA 4P96A 2LC2A 3B02A 2ZSIB 3BJAA 1O4XA 3GO5A 3KP2A 2R7UA 3IH3A 1W36C 3OS2A 2Y9YA 1F43A 1XGMA 2VKHA 3REOA 5ILVA 1A35A 1XDSA 3WTZA 5BS6A 2KMUA 1OCRH 4UV9A 2M3AA 1WJBA 1G3TA 2JA5J 4ZH4F 3V8LA 1TNSA 4V2FA 3RKYA 1YX3A 4CYCB 2NNYA 4II2A 4JOMA 3EUKL 4HSTA 1BOBA 3WTVC 4I7HA 4LD5A 2CS3A 4YRVA 2O8KA 2L01A 1K79A 2DDAA 3B73A 3W6JB 2VQCA 2ZFWA 5F0HA 4UNOA 5K5QA 1R5GA 2FOWA 4MHGA 5ILUA 1B1BA 3KZYA 4A0ZA 5CQEA 1OJLA 2VC0A 5K1YA 2IGMA 4FISA 2PMUA 2BOLA 2ZSHB 1ZKGA 5DCMA 1NK3P 1KGSA 5CVIA 3CMAI 2DOEA 1BA5A 3KYCB 2J5OA 2HR3A 2WA0A 1IGNA 3SZGA 3M07A 1IUFA 5FD6A 5J4VA 2DOFA 4KN4X 5HLHA 3CO7C 2XRLA 5CQGA 2XKOA 1G2HA 5L3CA 1JGGA 3GLXA 3K69A 2IS1A 2M9HA 3IKVA 2NS7A 3JTGA 3QYFA 1OISA 4R79A 1HXDA 2GXGA 3JTHA 1U3EM 2A07F 1Y56A 2MBFA 4P9UA 1YIOA 3ZQCA 2QSHX 2PG4A 3WHBA 3FXRA 3ESWB 2VIXA 4KT5C 2A6HF 3KIOA 3NARA 1ZRDA 2OC6A 2RNJA 3SZTA 3ZQHA 3PJRA 3LQRA 5HS9A 1S7AA 4JX6A 4XMYA 3GTJJ 2M30A 2B9SA 3HM5A 2PMHA 5K7ZA 3HGYA 1WRJA 3A4CA 3G4SI 2HXOA 5E8GA 1GUUA 2CW0F 4BHBA 3LNQA 2XVCA 2Z33A 3FBNB 1WWXA 3J7YJ 3I4MJ 1FSHA 3ULQB 3GUDA 4XRSG 4F55A 2DTRA 2WV1A 4D7NA 4M73A 3LSKA 3R4KA 4LK0F 4CCLA 2K3PA 3M1EA 1U9NA 2GIZA 3K10A 3CLQA 4JK1X 4BXXJ 2W25A 5FKNA 1HC8A 2FA5A 2LF8A 4M71A 4XICA 3WTSC 3JRGA 2R7XA 4U0WA 1KYZA 4C30A 3AG4H 2VJJA 4WWCA 2EIJH 3MZYA 1WI3A 5J3LA 3N97A 5KK1A 3IRRA 1SC7A 1W5SA 2HYFA 4IHWA 1OPCA 3ZGKA 3CESA 1DQUA 3BTCA 4GRIA 4PJ0C 1U78A 5IOZA 4LMYA 1ZR4A 1P92A 4DBRA 5ED4A 3JRHA 5F1JA 2P7VB 1I1GA 4GXOA 4FE7A 4AD9A 4I02A 1MNEA 2DMTA 3FXQA 4AUXA 5FKLA 3TO6A 1AWCA 4EVIA 5JVTA 2DPUA 4B3AA 1VQOI 1GVJA 3BR0A 1O3SA 3C7JA 1SAUA 3CUQB 1ITYA 2X1EA 1WI9A 1GXQA 4FCYA 3MKLA 2FJ1A 2WY8Q 3F72A 3BQYA 1RI7A 4BUPA 4IX7A 5EEHA 5EEAA 5ICCA 2D1VA 2UXXA 1GVDA 4GGGA 2L4MA 2DFFA 2VASA 1ZYRF 3M9AA 2PJRB 2IA1A 2VXZA 2D45A 4OMYA 1IN5A 4RGXA 4OWRB 3FWEA 1WSUA 3H0DA 4P9FA 4JYKA 2QKLB 3QQAA 5DCFA 4EJWA 1W0TA 1TLHB 1ETXA 1LFPA 1J75A 1ONVA 5LHGA 2ADUA 3H92A 1MBEA 2IJLA 1YS6A 2VJIA 3KEOA 2WWYA 4Z2YA 1O3TA 1TWAJ 1QRYA 3Q0WA 3R0JA 1QVUA 1ETKA 2XB5A 3J7ZI 2HXIA 3S3NA 5M3FJ 3C2HA 1VQKI 2AQFA 1X4PA 4JP0A 3TKYA 4E7ZA 5LEJA 4RLFA 2WBMA 1YLFA 4ENNA 4C2TA 2DCEA 3QODA 3H3ZA 2ZMEC 1ETOA 5J1UA 1DUXC 2E36A 3A01B 3ABTA 5DTDA 2ZXJA 3OYKA 1A04A 1F4KA 3IUOA 1PUFB 2K9MA 1GV2A 5J1RA 1KZHA 1ACIA 3K1PA 2K4JA 2R4GA 3E0JB 4PFPA 3ZQGA 3F21A 3DBLB 2R5ZA 2GXBA 3RQ4A 2ESHA 4HBLA 1PDNC 1VQNI 5IP9J 1L0OC 1FOKA 2EZHA 2LNBA 3PQJA 5HNFA 3HOXJ 1R5HA 3FXKA 3MKZA 1IW7F 4CCKA 3TBIA 3QP5A 2XROA 3I3LA 3S3MA 1ZGAA 3CC4I 1A31A 4D1QA 2IA0A 3VYTB 4MFDA 2BW3B 4ZC3A 4G12A 3OYNA 2COMA 2LLKA 4EM2A 1FC3A 1NG6A 2F5EA 3CCMI 3K4KA 1ZTRA 4P55A 1LPQA 4XSXF 1DPRA 4I2OA 2Z3YA 2O7OA 3MEXA 6PAXA 2VJ4A 3BY6A 3J80K 2P8TA 2HI3A 1H9GA 2MG4A 1HDDC 1I6HJ 2Q2EB 3MCZA 2ZNZA 1Z6TA 2CO5A 2M7AA 2DA2A 4NQWA 2OTJI 2ISYA 2OAZA 1TL8A 4IL6C 1K4TA 1R1UA 1WJFA 1OFCX 1VQLI 5F04A 5TRDA 1JKPC 4LIUA 2V1DA 4XLNF 5K7HA 2P5VA 1YYVA 2A69F 4RLQA 1IXCA 2KFDA 2EV5A 4PZJA 4LB6B 1L3LA 3J7AO 3W6KB 3ABLH 4RDUA 4BJ5C 4E6KG 4Y15A 5KAIC 2CH0A 4N4OB 5HVQC 2K27A 2K3FA 1NTCA 3AAFA 3DEUA 4LG3A 3U21A 3G6EI 3GXOA 1B8IB 2FMYA 5E1ZB 4ASNA 5DM6F 4WCGA 4BU2A 5EGOA 1FYLA 1OCCH 3GFMA 2HVRA 4M6XA 2E5NA 1GT0C 2QSGX 5DM7F 1BC7C 4CCMA 5J6XA 3WU1B 3F8CA 4HW0A 2VQLA 3PSIA 4A5MA 3BZKA 2R7SA 5E1WA 2E7WA 1WZ2A 3MQ0A 2VC1A 3LSGA 1FOYA 4FTHA 4EEFG 1YJNI 1MH3A 3ZMUA 1S8NA 3Q0VA 4A3DJ 4FE4A 4ABZA 2NNNA 1MW7A 2ID3A 4HDUA 3FHZA 3H9JA 1VQ9I 4N0BA 3BG5A 2VE9A 5K5RA 1H9TA 3CCQI 1VQMI 1FX7A 5HLGA 4YIIA 2G0EA 3CC2I 1ZK8A 1ZGJA 2BZTA 2KPMA 3A0HC 3L9FA 1RIOH 2V7FA 1W1WE 3W2VA 2ZXHA 1Z1DA 2HVQA 1YFHA 2QKMB 3K2ZA 3GFJA 4FHTA 4OU0A 4E7SA 3HSFA 3RTRA 2KQRA 2NVTJ 1R23A 2EB7A 2GOXB 1IG7A 4HSRA 3DTIA 2DODA 2MGQA 4AM3A 2L9NA 1OCTC 2ID6A 3E6MA 4M3FA 2DDBA 3CP8A 1QPMA 1OCOH 3FDYA 3QWLA 3I0TA 1IF1A 4I01A 3S2HJ 4G7ZF 3OMYA 3M8JA 3KZIC 1UJ8A 5HOOA 5BPDA 1FWZA 2X6YA 3J81Z 4ZDLA 3CUOA 1RR8C 4ZTJA 2MA3A 3H1CA 4BYYA 1U5TB 1V5FA 1XPXA 4DQ2A 4Y17A 1MIJA 5ILSA 4CYCA 4B1RA 2DI3A 4DJAA 4A5NA 1R1TA 3GCMA 1AOYA 1JTXA 2IS2A 3QPLA 4KISA 1MMSA 4KN7X 1XCVA 5B1BH 2NOJB 3S8PA 4MNUA 1Z21A 2L7FP 4XN0A 2WB1N 2E5ZA 1U8RA 1I6XA 4WXHA 3E6BA 1MNMC 4BBSJ 1BW6A 3SDBA 1XMAA 3EYIA 4U7BA 4TV7A 2R93J 2AXTC 1K6OA 2AHQA 5DD8A 5HDKA 5EZHA 3BG3A 4AIHA 3FHNA 1YW7A 5F64A 1K7AA 1MJBA 1JHFA 1ZARA 4DGWB 2R7WA 3HHGA 3OL4A 4UUVA 1J5YA 4XLFA 2PX9A 1BBYA 1X1AA 3EETA 2FQ3A 3T0YA 3V42A 3JRDA 4D5FA 3P5JA 5L3GA 2F48A 2ZKZA 4E7KA 2HQ5A 2HTJA 4XRMA 3GX4X 2CQ7A 3DKXA 2IT0A 3WG7H 1N78A 1I3AA 4DYRA 3KYLA 2D5VA 2D1HA 5ICFA 2QF7A 1I27A 5H6RA 2KKOA 2RNGA 1MMAA 4R8HA 3WE3A 1ZRCA 4G7OF 4Y3OA 3ELKA 1IRZA 5JHUA 2DJNA 3TQNA 3RPUD 4UY8I 5M5WJ 3HGGA 2IAIA 1IRXA 3ABMH 4PJJA 3JRAA 1MNDA 3BQZA 1T95A 4GCVA 2O6GE 3K4JA 3TEDA 4F93B 4Y4RA 2TRTA 1V5GA 3QPHA 2MW8A 4XL9A 2DFEA 3CCYA 3AL0B 4KA4A 1TQPA 4IEJA 3CLOA 5B1AH 5EDNA 3COAC 4KDPA 2DMUA 1QZZA 1W4MA 3W2AA 4IVNA 3Q3SA 5H20A 3G1LA 1JHHA 3HC7A 2A68F 2ZJ2A 1P7IA 3K1MA 2XDVA 2HDDA 2M8EA 1UMQA 4MTDA 1SFXA 3R61A 1TC3C 5D5XB 1GV5A 1HLVA 3U9GA 2VPLA 3K6GA 1ZELA 5EG0B 3I5UA 3MAJA 2L9SA 5IP6A 4NC8A 2QENA 2O9LA 2HYGD 3BR2A 3PNYA 3HTUA 4NC6A 3BG6A 5LRRA 5CPRB 4PK4A 2E2IJ 5HLIA 5GPAA 3C2GA 5HLTA 5D5VB 2Z2SB 1JT6A 4NNJA 5EJCA 3CMMA 5DV5A 4HEA2 1A6QA 5CVUA 1TWFJ 1ZRFA 2YUSA 3TO9A 1WGXA 3GTKJ 5E1XA 3K4NA 1FNNA 5TISC 1TWGJ 4ANJA 3OYFA 3D1NI 1FT9A 2R7QA 4IHYA 2BY3A 2EIMH 4YFKF 4LG0B 2E60A 4L9VA 4HX4A 2FSWA 4PUSA 2C6YA 3GTOJ 3CUQA 5JR3A 1O3RA 1FPQA 3WTYC 2LSOA 1BJZA 3T1BA 3DKWA 2O3FA 2HOAA 3LFUA 3ZMZA 3JSOA 3HXLA 2CGPA 1AHDP 2DLLA 2EFOA 2B63J 3I59A 4XONA 3E6CC 4RAZA 2PJRA 4BJTA 2K4BA 2W00A 2FD5A 3KP4A 2CMPA 3RYRA 4PSXA 2ME6A 3LA2A 5D8LB 1B9MA
chains in the Genus database with same CATH topology
3PJRA 2M0MA 2X1CA 4BQQA 4XMYA 4G6TB 2F6CA 2LRDA 4AVZA 3CP2A 1S9HA 3A4CA 3D5RC 4F3QA 3K4LA 4JQFA 3OYEA 2IGKA 2KDOA 3L2RA 3FBNB 2WADA 2XSJC 3KEYA 3LSIA 3OY9A 1D1AA 3KX2A 3SYTA 4F55A 2ZXIA 3H9GA 3TL4X 3OS1A 3S93A 3LSKA 2X51A 4YELA 4CCLA 2K3PA 4CSWA 1E0EA 5FRNA 2UV1A 2KL4A 2R7TA 3K10A 3VYUB 2VL8A 3L2VA 4BDZA 5LFAA 2R7XA 4XN3A 3VSKA 4C30A 2R7RA 2DT7B 2VJJA 4C2UA 4BQNA 3HKZA 2DXIA 1DGRM 2CUJA 2X6WA 3OYIA 4IQJA 3MKYB 3LSHA 4ZDOA 3ZGKA 3CESA 1DQUA 4GRIA 4B43A 3ZR8X 3UR3C 2HDWA 3I9V2 2HVSA 4DBRA 3N05A 3VSLA 1LKXA 1MNEA 4ZJZA 2HPMA 4XLCA 3HPGA 1D0YA 4E4HA 2RQQA 3K70D 1SAUA 2X1EA 4XR6A 1X1CA 1FMVA 2M4KA 2WY8Q 2BW3A 2MABA 2DJIA 4BUPA 4IX7A 4EATA 2LBFB 2DOAA 3ZRGA 3F9KA 1D1CA 3DQVC 2BVMA 1P9QC 1OR7C 2VASA 4BEHB 4HPQA 2IXSA 3ONQA 3PNTA 2PJRB 1GLNA 2VXZA 3W2WA 3OYDA 2XAUA 4NUBA 4OWRB 1MMNA 3H0DA 2GOMA 2QKLB 4J01A 4B3XA 3G2BA 3H5NA 5HNHA 2JUGA 2OUMA 1LFPA 1WJEA 4BS9A 1ERDA 1U0JA 3VYRB 4ZYAA 2KP6A 4PJNA 1WJAA 3FBIB 2VJIA 2RREA 4BDYA 2ELJA 2R7VA 2CV2A 3DKYA 3S3NA 3OR2C 3C2HA 2AQFA 1X4PA 2KRHA 3CF2A 4E7ZA 2WAEA 4RLFA 2WBMA 2VQHA 4C2TA 3MMYB 4CUGA 2DCEA 3QODA 2V1NA 2WAQA 2K9LA 1D1BA 1WJ5A 4P5OA 3OYKA 2HPIA 3IUOA 2CUZA 4B48A 2K9MA 2FUG2 4H4KC 3OYMA 2F5VA 4PFPA 2R4GA 3E0JB 4BEHA 1PYVA 1DP3A 3RQ4A 2X6XA 2Z1DA 1X19A 3M1CA 4NC7A 2L7KA 3BCAA 5HNFA 2IGOA 1QHGA 3MKZA 3OIPA 4ZDPA 2VLAA 3OYLA 4CCKA 2LYCA 2X1DA 3TBIA 3K70C 3I3LA 3S3MA 4XOTA 1OLTA 4LIVA 4BE1A 2L2OA 4BL0B 1LDKB 4D1QA 3VYTB 2K5CA 2XC7A 2BW3B 2M4GA 4ZC3A 3BG7A 4FETA 4YEJA 3OYNA 2DT6A 4XNFA 3S32A 4J00A 1NG6A 3CJRB 1R6RA 3VYSB 3K4KA 4XKBA 3QOEA 2UWMA 2VKDA 1Z3YA 3D5SC 4OAZA 3HL2A 3IAM2 3CZ6A 3HUGB 3H9QA 1QHHD 1WFXA 1MMDA 4DBQA 2VJ4A 1JI8A 1J09A 2Q2EB 3DTKA 2KZVA 2M7AA 1G59A 3EPZA 3RCOA 3OYJA 1AA7A 3PUBA 1KONA 1WJFA 4BXFA 2LOOA 3DPLC 3LL7A 4DOZA 2VJ5A 3A1YA 2BVLA 3H5AA 3BLYA 4LIUA 1BR1A 4HNUA 1D0XA 2IS4A 4RLQA 2MFZA 2CW8A 4XM3A 3DPUA 3VWBA 4BJ5C 4E6KG 4QPQA 3A2KA 2CH0A 4N4OB 5HVQC 3EUAA 3OYAA 4LG3A 5FROA 3U21A 2W7NA 1X4OA 4E7HA 3E1SA 4KT6A 4II3A 4BU2A 1BR4A 3NWTA 2HVRA 3FKJA 2E5NA 4P1WA 3HG9A 4CA0A 3D5LA 2I8DA 4BGDA 2E1MB 4QPOA 1MMGA 4CCMA 3OS0A 3PSFA 1EA3A 4XKWA 2VQLA 3PSIA 3H35A 2A6TA 3OOUA 3S3OA 4HRIA 2R7SA 2KHMA 4AYBA 1D0ZA 3LSGA 2W4SA 2F4IA 1WJCA 2L5QA 3OYBA 1VZ0A 2LY1A 4XKCA 4KJZA 4CCOA 1MW7A 3DLAA 3DWLE 3OIQA 1TZLA 1Z7LA 3H9JA 4LITA 2CV0A 1G8XA 4RM3A 4ITVA 2KRCA 1WJDA 1Y6IA 2KPMA 4IQ4A 4BE0A 2V7FA 3W2VA 2ZXHA 2HVQA 4DIQA 3VDXA 2QKMB 3TMOA 4E7IA 2MC4A 2A5WA 3OL3A 4E7SA 3RTRA 5CKTA 4NQWB 2KQRA 1T0FC 2GOXB 2IS6A 4HSRA 2LREA 3DTIA 4HNTA 4ZTFA 4RM2A 4XLEA 3AL0C 4F91B 2VQGA 2L9NA 3DPTA 4IZZA 4F92B 2O5RA 3PL8A 4C9YA 2XF5A 4BACA 3AKZA 1W36D 3CP8A 3SEZA 3OWTA 3FDYA 2LG4A 3OMYA 3M8JA 5HOOA 2W82A 2X6YA 2CFOA 4ZDLA 1DGWY 2CW7A 2LH9A 1UELB 3HOTA 4ZTJA 3RSNA 3SEQA 2IGNA 1V5FA 4CZCA 1FMWA 3W3CA 4D9JA 4DJAA 4PJMA 4PSWA 2MYSA 2V26A 2IS2A 2WY7Q 1K6YA 4KISA 3HOSA 1QU3A 4XLHA 2UUZA 2NOJB 2LY2A 3S8PA 1Z21A 4XN0A 2E5ZA 4XKVA 3OYCA 1NG7A 1UG0A 3AFHA 4OAYA 3ZQQA 4CCJA 4N4NB 4Y33A 2XF6A 3SDBA 3ZXSA 2JSPA 3DU6A 3PNVA 4U7BA 1V5EA 2R7OA 3LSMA 3UNGC 3HPHA 4F52A 2M7BA 1X1BA 5KCMA 2V9KA 4U87A 1LVKA 2OV7A 3K4BA 3FHNA 4DGWB 2R7WA 3OL4A 5LD2C 3DEEA 4XLFA 1X1AA 1N75A 3V42A 5JHFA 2HNHA 2Y0SA 2MD0A 4RMNA 3K4MA 2VXDA 4E7KA 1YE9A 1BR2A 1YX5A 3DKXA 3IP4B 2P0WA 1N78A 4XOPA 3QYBA 3QYEA 5KHDA 3KYLA 2WAFA 4XORA 3BC8A 3L2WA 3IAS2 1Z3XA 2RNGA 1MMAA 3DTEA 3MKWB 4Y3OA 2LC2A 2ZSIB 4HG2A 3J7AY 3K4CA 3RPUD 2R7UA 1IRXA 4PJJA 2HQAA 3L2QA 1MNDA 3OR1C 1T95A 1W36C 3OS2A 3K4JA 2AQEA 2HZDA 4Y4RA 4XQFA 4F93B 1V5GA 2VKHA 4XL9A 3AL0B 1PJRA 4X0GA 2KMUA 2M3AA 1WJBA 2JVGA 4MLOA 4B44A 3W2AA 2V4JC 4CCNA 3HC7A 2PMZA 1YX3A 1TT0A 2XDVA 4II2A 4JOMA 4BQOA 3EUKL 4HSTA 1BOBA 2CS3A 4YRVA 2VPLA 2JVHA 2VQCA 3K6GA 2ZFUA 3OYHA 2Z16A 3GBGA 1ZELA 2L9SA 3EUHC 5FRMA 4NC8A 3ZCOA 5KNLA 3PNYA 4XLAA 3BG6A 4B47A 4E7JA 5CPRB 4PK4A 5CQEA 3DU5A 2IGMA 3C2GA 2XF7A 5HLTA 2BOLA 2WB1A 2ZSHB 2Q1ZB 2VB6A 2Z2SB 4NNJA 1N77A 3MD2A 2V6EA 1SFKA 3CMMA 3NWSA 4HEA2 3PFYA 1HA8A 2WA0A 3SZGA 4CH7A 3K4NA 5CQGA 4ANJA 4FASD 4PFOA 3OYFA 2R7QA 3LMMA 2IS1A 2E60A 2W1OA 2X85A 4IKFA 4PUSA 2E1MC 4BJ6C 3CJQB 2HU9A 3QYFA 4R79A 1UAAA 3H5RA 4KITB 1Y56A 3LFUA 2LBFA 2CV1A 3HXLA 3OYGA 4E7LA 4XONA 4PJLA 3BCBA 2PJRA 4BJTA 2W00A 4BE2A 2VIXA 2CMPA 2KLOA 1X1DA 3L2UA 4PSXA 2OC6A 5TGTA 2JA2A 4AU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D5S C;  2WY8 Q;  3D5R C;  2NOJ B;  2JVG A;  2JVH A;  2GOX B;  2GOM A;  2WY7 Q; 
#chains in the Genus database with same CATH topology
 5D5W B;  4ZZD A;  2X1C A;  4LGW A;  3ZPL A;  1SD4 A;  1Z67 A;  2EQR A;  2F6C A;  2LRD A;  3PQK A;  2RV8 A;  3CP2 A;  1TQM A;  1S9H A;  3D5R C;  4RB3 C;  2L9V A;  4B8X A;  4EM1 A;  3DEW A;  3K4L A;  3OYE A;  2IGK A;  3A0B C;  2KDO A;  2H1L A;  4OOI A;  2Q8K A;  2BXZ A;  2GWR A;  2XSJ C;  1ETV A;  3LSI A;  1D1A A;  4EQQ A;  3H9G A;  4HF2 A;  3OS1 A;  1W0U A;  4BKX A;  1YIJ I;  2E2J J;  1A6I A;  4HQE A;  4YEL A;  4UVA A;  1E3H A;  5FLX Z;  4YIF A;  4OIO F;  2UXN A;  2R7T A;  3GZN B;  3QAH A;  3L2V A;  5JVG F;  1LE8 B;  3S2D J;  3A01 A;  2CQN A;  2R7R A;  3K0L A;  1PUF A;  2XGX A;  2Z5U A;  1WPK A;  4LLG F;  3FM5 A;  3HKZ A;  1SFE A;  1DGR M;  2BY1 A;  2X6W A;  2A05 A;  4ESJ A;  3LSH A;  2OBP A;  3BR5 A;  3GF2 A;  3LST A;  5F1R A;  4ENK A;  1VQ8 I;  4MEX F;  1IO2 A;  2BY2 A;  2HVS A;  2PEX A;  3HRS A;  3G1O A;  2JPB A;  3T8T A;  2BXY A;  3N05 A;  3BTL A;  4Q47 A;  1LKX A;  3V7R A;  4XSZ F;  1XGS A;  4ZJZ A;  4BHC A;  1BIB A;  4XLC A;  3HPG A;  3RDI A;  4QTR A;  4E4H A;  2RQQ A;  1R49 A;  2QYO A;  1QZE A;  4XR6 A;  3CDH A;  1AKH B;  2M4K A;  2BW3 A;  1G4D A;  1ON1 A;  1XMX A;  2KIS A;  2OF7 A;  1HKS A;  1LJ9 A;  2LBF B;  4AID A;  3F9K A;  1FP2 A;  3DQV C;  1RUO A;  4LLN A;  3AG1 H;  4HPQ A;  2IXS A;  1JKO C;  2LKS A;  3D0S A;  1BM9 A;  4NUB A;  2OPT A;  3SQN A;  4I6Z A;  4WXC A;  2GOM A;  4J01 A;  4B3X A;  1W7P B;  2Q2E A;  5BQT A;  1QVT A;  1OR7 A;  4M3D A;  1R5I D;  3CCS I;  1WJE A;  1P7J A;  2L3D A;  4BS9 A;  2M1B A;  3HOW J;  3VYR B;  5IP7 J;  1ZRE A;  3LOC A;  1W5C C;  1FEX A;  1WJA A;  3FBI B;  1ZG3 A;  3SHF A;  4BDY A;  3F8N A;  2ELJ A;  3G71 I;  3BWG A;  2GAU A;  1EKE A;  2R7V A;  1T39 A;  2R0Q C;  1IV6 A;  2CSO A;  2XAQ A;  4KYW A;  4C3J J;  3Q0U A;  2E7X A;  3GFL A;  4YFX F;  3ERE D;  1APL C;  3ERM A;  3QU6 A;  4CUG A;  1WH5 A;  2V1N A;  3C1D A;  2WAQ A;  1B8I A;  1LDD A;  2F5C A;  3KE2 A;  4MQ9 F;  1MDM B;  1WJ5 A;  4L5E A;  4D5C A;  2PLY A;  4P5O A;  2DFI A;  2IPQ X;  4B48 A;  4D7M A;  1XSX A;  4H4K C;  3S14 J;  3KEQ A;  2PJP A;  2ACJ A;  3WGG A;  4BEH A;  2IRF G;  1PYV A;  2M45 A;  1SMT A;  1TTY A;  2XUB A;  5EZG A;  4NC7 A;  2PBI A;  3HSE A;  2L7K A;  3BCA A;  4HOB A;  1POG A;  1KU2 A;  2O61 A;  2XAG A;  3MN2 A;  4Q4Z F;  1E2X A;  4W1U A;  1T56 A;  2EBI A;  3OIP A;  5C4J J;  3KET A;  2VLA A;  2LYC A;  2R7Z J;  1DPU A;  3VPR A;  5A2Q K;  1ODD A;  2Z9O A;  2L2O A;  4BL0 B;  3RPU A;  4ZYE A;  2JA7 J;  5FD5 A;  2JQ7 A;  4GDF A;  2AXL A;  2CQQ A;  1HQC A;  4XNF A;  4J00 A;  5LBQ A;  5K5O A;  3CJR B;  5GTI C;  3VYS B;  4A2U A;  2RVC A;  4XKB A;  5ICE A;  2DK5 A;  1FTZ A;  4C3H J;  4AIJ A;  1PUE E;  1P4X A;  2X4H A;  2ELK A;  4OAZ A;  5J8C A;  1YI2 I;  4HLX A;  2GA2 A;  3CZ6 A;  3HUG B;  1QHH D;  1WFX A;  1MMD A;  4DBQ A;  4DW6 A;  4L5J A;  4HYE A;  3V7S A;  2R7D A;  1J09 A;  2CJJ A;  3WOD F;  1BOA A;  2KZV A;  1YG2 A;  3O3K A;  1CF7 B;  1G59 A;  3ML6 A;  4CHU A;  3RCO A;  1FLI A;  3P9C A;  1KON A;  1MSF C;  3S1Q J;  3TP3 A;  2F5F A;  1FIA A;  2H09 A;  3LL7 A;  4DYC A;  1BW5 A;  1BC8 C;  2BVL A;  4HX7 A;  3OIO A;  1BR1 A;  3CCU I;  3BZC A;  2GZW A;  3DP7 A;  2IS4 A;  3WU0 A;  4R1H A;  5LGT A;  2QSF X;  5CVR A;  4MTE A;  2QGU A;  3S15 J;  4QPQ A;  3EUA A;  5FRO A;  2OJE D;  2W7N A;  4K2E A;  4HV5 A;  3FXO A;  1X4O A;  4E7H A;  2W48 A;  3SXY A;  4AWX B;  3E1S A;  2GXA A;  4I99 C;  2STW A;  1SD7 A;  2EZK A;  5D4R A;  2BHY A;  3F8M A;  5FFZ A;  1GHC A;  3FKJ A;  2QLZ A;  2VOP A;  2H27 A;  2JA6 J;  4BGD A;  3JRE A;  1TW2 A;  4QPO A;  2DAO A;  1B72 B;  3RJP A;  4IRH A;  1F1Z A;  1XN7 A;  3SJM A;  4Y52 J;  4PDK A;  3OOU A;  1ETQ A;  1G6N A;  2KHM A;  3FK6 A;  4AYB A;  5IY5 H;  5EF6 A;  4S05 A;  3I64 A;  3SFZ A;  2L5Q A;  1QO0 D;  2RKH A;  3PO2 J;  1MKM A;  2LY1 A;  3DLA A;  2COB A;  2Y0S N;  2CV0 A;  4LIT A;  2EV6 A;  5BMZ A;  2HYJ A;  5C4X J;  2KIU A;  4HAM A;  4ITV A;  3F8B A;  3PM1 A;  3HDD A;  3HKZ N;  1MBJ A;  4BE0 A;  2K85 A;  1IJW C;  1JTY A;  3S16 J;  1K4S A;  4DIQ A;  3VDX A;  4V2G A;  5F0C A;  1IZ1 A;  1Y8Q B;  2A5W A;  4GFB A;  3WHC A;  3JSP A;  4WX9 A;  1X2N A;  1EF4 A;  3BR6 A;  4HV6 A;  2EV0 A;  1DDN A;  4EJV A;  3WG9 A;  4OMZ A;  4XLE A;  2K9N A;  4L9T A;  1NH3 A;  2VQG A;  2N8G A;  3HHH A;  2EZI A;  4C9Y A;  1JXS A;  3AKZ A;  2HFH A;  2K40 A;  2L9R A;  1FBS A;  3I71 A;  2DK8 A;  3JW4 A;  4S0H B;  2LH9 A;  2W84 A;  3HOT A;  3CME I;  3IH2 A;  1YTY A;  3RSN A;  1JJ6 C;  2IGN A;  4CZC A;  3W3C A;  1QGP A;  4D9J A;  5AIP A;  4A3F J;  1E3P A;  1U9O A;  4U88 A;  5HDG A;  1YHQ I;  4PSW A;  3DLL F;  1DU0 A;  3C3W A;  5LHH A;  5M3M J;  5GAH J;  2Y69 H;  2IP2 A;  3IWZ A;  2JMW A;  4HA8 A;  3OOP A;  3PUF A;  2UUZ A;  2VBW A;  3CCE I;  2HEO A;  3V8J A;  5EG0 A;  1FBQ A;  1K78 B;  4Z6Y A;  1UG0 A;  4CCJ A;  1OYY A;  5D5U B;  3I54 A;  3LAP A;  2JSP A;  3DU6 A;  4WK8 F;  1FYK A;  2DYS H;  1B6A A;  3HPH A;  3UNG C;  2BHZ A;  1X1B A;  2X6O A;  1WKM A;  5AON A;  4EJO A;  3DF8 A;  1H88 C;  1YJW I;  2ZB9 A;  4M6Y A;  5KVR A;  2OV7 A;  3K4B A;  3ECO A;  1YS7 A;  2M8G X;  5FLV A;  2WAQ N;  2L02 A;  2XGD A;  2OD5 A;  1RET A;  3M7G A;  5LD2 C;  3DEE A;  4RB2 C;  1WQ2 A;  2BBY A;  3MZH A;  1QPI A;  5BPI A;  2DA3 A;  4LG0 A;  1OYI A;  1VTN C;  2FQ4 A;  3NEU A;  5JHF A;  2XV4 S;  1RES A;  4DNC A;  2P6T A;  2EFW A;  4A3M J;  2MD0 A;  3K4M A;  1HW5 A;  3HRM A;  3CJT B;  1REP C;  4IRG A;  3QYE A;  3LFK A;  2TDX A;  3BC8 A;  4A6E A;  3DCF A;  4A3L J;  3MKW B;  2QWW A;  3HIF A;  4FX4 A;  1YOV B;  3NRV A;  1XG1 A;  1D5Y A;  3Q9S A;  2OQG A;  2DA1 A;  2E19 A;  1FYM A;  2R7F A;  1BI0 A;  4HG2 A;  3K4C A;  4U0V A;  5CYV A;  1BL0 A;  2R92 J;  2OCE A;  3M3Y J;  1JUS A;  2HQA A;  3L2Q A;  3OR1 C;  4A3J J;  2ISZ A;  1H89 C;  1QBJ A;  4CXF A;  2AQE A;  3TW7 A;  5M5X J;  4NBQ A;  1EH6 A;  2ZNY A;  2DMQ A;  4GYG A;  2FF4 A;  4X0G A;  1LFB A;  4NHJ A;  4MLO A;  4HF0 A;  5BNG A;  4CCN A;  2IA2 A;  1YJ9 I;  2JK3 A;  4A93 J;  1TT0 A;  2B0L A;  5E3N A;  2K9Q A;  3ZQL A;  1IRF A;  4EGY A;  2WTE A;  1Z91 A;  4A0Y A;  3KYD B;  2BGC A;  2LR8 A;  4A69 C;  1LE8 A;  2ZFU A;  1I39 A;  1XCB A;  2BY0 A;  2EIK H;  4OIR F;  3EUH C;  1FP1 D;  3ZCO A;  3WU2 C;  4IJA A;  5KNL A;  4E7J A;  3M4O J;  1P4A A;  4HX8 A;  4YIR X;  3FXJ A;  1UCR A;  2FX0 A;  1N77 A;  3LSP A;  3MD2 A;  1SFK A;  1S72 I;  4V19 K;  4UXN A;  2CUE A;  3PFY A;  1HA8 A;  3CUQ C;  3CO6 C;  4Q5S F;  1T8I A;  1YRN B;  3L00 A;  4XK4 A;  5BOX A;  4PFO A;  1YQA A;  2P81 A;  2QBY B;  3LMM A;  5DEQ A;  3J80 Z;  2DN0 A;  4IKF A;  2IEK A;  3JCU C;  4BJ6 C;  2H1K A;  2DTZ A;  1ETW A;  2HU9 A;  4GO1 A;  1UAA A;  1D3Y A;  1S5L C;  4X1E A;  3H5R A;  2LF7 A;  1W5T A;  4M3G A;  2LBF A;  2CV1 A;  2YR2 A;  4E7L A;  5HOD A;  4AYB N;  2Y48 A;  3U1K A;  2G9W A;  4PJL A;  1ZN2 A;  2M2E A;  4UUS B;  3PIO F;  3GLL A;  2KLO A;  1X1D A;  1J2X A;  3L2U A;  1XB4 A;  3B6A A;  1W7P A;  2D2W A;  3LA7 A;  1VQ7 I;  4AU7 A;  1FBU A;  1MBK A;  2M0M A;  5IPA A;  3GTM J;  5D8K B;  4BQQ A;  4G7H F;  3HYI A;  2E1N A;  4AVZ A;  1B59 A;  2HKO A;  1NK2 P;  2VUM J;  4LFU A;  1S6L A;  4JBA A;  2HOE A;  4JQF A;  5JLX A;  3P9I A;  3E6D A;  1HKT A;  3OY9 A;  3F8F A;  3KX2 A;  3SYT A;  2ZXI A;  3TL4 X;  2JZY A;  2X51 A;  5D6F A;  1B4A A;  3IRQ A;  2DMN A;  2PQ8 A;  1G3Y A;  1J7K A;  4CSW A;  2UV1 A;  2KL4 A;  2RGV A;  3TP0 A;  4QIW N;  3VYU B;  3E5U A;  4YFN F;  3QPS A;  2VL8 A;  2W57 A;  5LFA A;  4XN3 A;  2BE5 F;  2L4A A;  3LQQ A;  4MIM A;  2B7E A;  4UVB A;  3N4M A;  1MDM A;  1D8K A;  2DT7 B;  4C2U A;  1Y1V J;  2DYR H;  3S1R J;  3KPH A;  1H8A C;  4EGZ A;  1KA8 A;  2JUC A;  1P2F A;  2NS0 A;  1LNW A;  4BQN A;  2DXI A;  3BJO A;  1U2W A;  2E1O A;  2CUJ A;  3OYI A;  4IQJ A;  1P4W A;  5GP9 A;  5J8F A;  2IBD A;  3ABU A;  3MKY B;  1UB9 A;  1CGP A;  3VB2 A;  1AU7 A;  3UR3 C;  2HDW A;  1HW1 A;  3BPX A;  1LDJ A;  3ZMV A;  3Q9V A;  2MH2 A;  5E3M A;  1SFU A;  4RS8 A;  1FOX A;  2DBB A;  5D6E A;  3A02 A;  5F27 A;  2XPW A;  4QWQ A;  1QNT A;  1IXS B;  4CDG A;  3K70 D;  3NAU A;  3S2W A;  4RGR A;  3GFI A;  2MAB A;  5HS7 A;  1HKQ A;  4A0X A;  2NVY J;  1MZB A;  4EAT A;  2G7H A;  2DOA A;  3ZRG A;  4XRF A;  1A5J A;  1U6G A;  4I76 A;  3OSF A;  2BVM A;  1P9Q C;  3FMR A;  1OR7 C;  5FKK A;  3ONQ A;  1HSJ A;  1GLN A;  1T33 A;  3HUG A;  2NAZ A;  3GWZ A;  2XAU A;  3OYD A;  2P7C B;  9ANT A;  1MMN A;  5C3E J;  1EH7 A;  3FIW A;  1XMK A;  5CLS A;  3H5N A;  2LD5 A;  1DP7 P;  4U0Y A;  1CF7 A;  4L0Z B;  2JUG A;  4O6J A;  1Z05 A;  1HW2 A;  3HOY J;  4O3M A;  4A3G J;  2DQL A;  1ERD A;  4LB5 A;  3Q5F A;  1U0J A;  1YW9 A;  5GAD J;  2OTL I;  2RRE A;  1LFU P;  4Q48 A;  3EUH A;  3HJE A;  3JAM K;  1FTT A;  3T5X A;  3OR2 C;  5DYM A;  4CGZ A;  2KRH A;  2VKE A;  2KJC A;  2P6S A;  2M34 A;  1MGT A;  2FML A;  1ZG1 A;  2NOG A;  2E2H J;  5LHI A;  1JJ8 C;  2PFB A;  1XGN A;  4M9X A;  4O5V A;  2ZJR F;  3DXJ F;  2CQK A;  3OSG A;  1F36 A;  1TW3 A;  2DFH A;  1GXP A;  4XID A;  1KQ9 A;  3RIR A;  3A03 A;  3BOQ A;  1B72 A;  2IW5 A;  2Z1D A;  4MGR A;  1E17 A;  1X19 A;  3M1C A;  3FXL A;  3ZOB A;  5M5Y J;  2IGO A;  4BBR J;  1VQ4 I;  2V9V A;  3M8E A;  5DUK A;  3OYL A;  3ZMT A;  3E5Q A;  2CWE A;  3WGI A;  3K70 C;  1ZH5 A;  4XOT A;  1HF0 A;  4LIV A;  2HGC A;  2NRA C;  1O3Q A;  1LDK B;  3S1N J;  2JRT A;  2EFN A;  2K5C A;  1ZQ3 P;  2XC7 A;  3BG7 A;  4FET A;  4YEJ A;  2EH3 A;  2DT6 A;  5GAE J;  2XGC A;  2DMP A;  2M5W A;  1Z7U A;  1R6R A;  4S04 A;  1OYW A;  2AO9 A;  1RRJ A;  2QQ8 A;  3QOE A;  2UWM A;  5IYC J;  3D5S C;  4MO7 A;  3HL2 A;  3IAM 2;  1F5T A;  3MVP A;  4QSH A;  3ZMS A;  4MQV A;  5J4Y A;  3RYP A;  3VEP A;  2L54 A;  1JI8 A;  5H2F C;  4IHT A;  1VF9 A;  3IL2 A;  3DTK A;  5AIQ A;  4ESB A;  3RKQ A;  2FXA A;  2GBY A;  2OQR A;  3BDD A;  4MEY F;  3EPZ A;  1MD0 A;  1AA7 A;  3BTI A;  3I58 A;  1ON2 A;  5FJ8 J;  2XPV A;  2ZCW A;  2LOO A;  3DPL C;  2H6B A;  4OIQ F;  3H5A A;  2RQP A;  2LTP A;  2HDC A;  4HNU A;  1I50 J;  3C2B A;  1U5T C;  2EWN A;  1IN7 A;  4XM3 A;  1XDU A;  1SVL A;  2OA4 A;  4WXD A;  2ECC A;  3DBH B;  3FK7 A;  1MBG A;  3A2K A;  1E3O C;  2STT A;  2EPF A;  2P4W A;  3LWF A;  2FE3 A;  1Y8R B;  1UHM A;  1KU7 A;  1X1P A;  3HOZ J;  3CCL I;  4BH9 A;  3GTQ J;  4IOC F;  1IV8 A;  2NXN B;  1G3S A;  4II3 A;  5L3F A;  2H8W A;  1XSD A;  3NWT A;  2EFQ A;  3H3U A;  2A6E F;  3JAM Z;  3HG9 A;  3CCR I;  4YG2 F;  4CA0 A;  4UVC A;  3D5L A;  5LGN A;  1O7L A;  3HTS B;  2I8D A;  4FQG A;  2E1M B;  1R4M B;  1X58 A;  2ZME B;  2ZO4 A;  3OS0 A;  3PSF A;  1USS A;  1R22 A;  3CD6 I;  3O8G A;  1K78 A;  2XPU A;  1EV7 A;  4XKW A;  3I4P A;  3DV8 A;  3MWM A;  2A6T A;  4W97 A;  2K02 A;  3S3O A;  4HRI A;  2FOK A;  3KP7 A;  1T08 B;  3VOD A;  4BY1 J;  2W4S A;  2F4I A;  1WJC A;  1BN5 A;  4XKC A;  5CVV A;  4KJZ A;  4CCO A;  3LAJ A;  3DWL E;  3OIQ A;  3EYY A;  5K7F A;  3FXU A;  1R1V A;  1G8X A;  1HBX G;  3L7W A;  3GZ5 A;  4RM3 A;  1XC5 A;  4M3B A;  2KRC A;  4L0Y B;  5IT9 K;  1WJD A;  3IH4 A;  2YSR A;  1QQI A;  1YO5 C;  1IDZ A;  3CC7 I;  1S7E A;  3KP6 A;  2MH9 A;  3TMO A;  4E7I A;  2K9S A;  1LVA A;  3OL3 A;  5FKM A;  2DPD A;  2JN6 A;  1R58 A;  2QUF A;  3GTG J;  3E7L A;  5CKT A;  4IHX A;  3G3Z A;  1MBF A;  3H3V K;  2XHK A;  2O8X A;  3BPV A;  4HNT A;  4RB1 A;  4KFC A;  3OV8 A;  3AL0 C;  2VBX A;  2NYX A;  4A3C J;  1A36 A;  1ULY A;  5EEG A;  3DPT A;  5CVJ A;  4RB0 A;  2V1U A;  1T0F A;  3OWT A;  4Y7N J;  5F08 A;  3WTW C;  4U7D A;  4IHS A;  4PGH A;  2CFO A;  1DGW Y;  1UZC A;  3SEQ A;  2H6C A;  3ECH A;  4UHT A;  1FMW A;  1ZR2 A;  1LUJ B;  1K83 J;  2BYV E;  1FOW A;  3ABK H;  4C3I J;  2L7Z A;  1KU9 A;  1Z9C A;  2VE8 A;  3IC7 A;  4RAF A;  1SEU A;  2Y0M A;  2WY7 Q;  1QU3 A;  4JX4 A;  2DO7 A;  3HOS A;  4XLH A;  3RKW A;  4HNV A;  3K1N A;  5LLQ A;  1NG7 A;  2FNP A;  2KRF A;  3AFH A;  5KAF C;  1QA6 A;  4Y33 A;  1R7J A;  1HST A;  3PNV A;  2R7O A;  2TCT A;  3LSM A;  1P6R A;  4BY7 J;  3TGN A;  4CZZ A;  4F52 A;  2M7B A;  3S17 J;  4U87 A;  2CUF A;  1WCM J;  1WH7 A;  4AC0 A;  2XGE A;  5TJJ A;  3TOB A;  3L1P A;  1BJA A;  2CYY A;  2MC3 A;  1YRN A;  4I98 B;  2VPR A;  2P5L C;  1SVO A;  2CFX A;  3PIP F;  4IPA A;  2QBY A;  2ECB A;  1N75 A;  3JR9 A;  2NVQ J;  1XGO A;  1BI2 A;  2Y75 A;  2Y2Z A;  2Y30 A;  2HNH A;  4XRS A;  1IRG A;  4RMN A;  2Q0O A;  2VXD A;  5DUI A;  1EJ9 A;  1FJL A;  1TQI A;  3RI4 A;  3IP4 B;  1O57 A;  1Y39 A;  2KIF A;  4RAY A;  2Y9Z A;  1MJ9 A;  3HZJ A;  4XOR A;  1U5T A;  4KUM A;  2X48 A;  1W7P D;  5KHD A;  2EJR A;  3BT9 A;  3K9T A;  3HSR A;  3IAS 2;  1Z3X A;  1Y0N A;  2LKP A;  4KIC A;  2LMD A;  2K86 A;  1PVE A;  2VT2 A;  4UUS A;  5IT9 Z;  2ZC2 A;  3FXM A;  1JE8 A;  3IHU A;  3J7A Y;  2EFP A;  3FIS A;  3R60 A;  5E3L A;  3QU3 A;  1X3Z B;  2EA4 A;  1XS9 A;  3BR1 A;  1HCR A;  1FSE A;  1JUP A;  3TDZ C;  2F2E A;  2HZD A;  4BHP A;  4XQF A;  2H8R A;  2QZ8 A;  2VOO A;  4LOC A;  1PJR A;  1Z77 A;  4M9Z A;  3RPQ A;  2XAF A;  5IYB J;  4KIF A;  3CCV I;  3I55 I;  2JVG A;  4B44 A;  4ETS A;  1XD7 A;  1T6S A;  2V4J C;  1MJA A;  2LKX A;  3CTA A;  3DBR B;  3LA3 A;  2O03 A;  1RKT A;  2PMZ A;  2JSC A;  3I59 B;  4RBO A;  4BQO A;  2OCC H;  2HOT A;  1J0R A;  1TNT A;  1XSV A;  3FMS A;  2R5Y B;  2JVH A;  1BI3 A;  4QLC U;  5JFR A;  5C44 J;  1SMY F;  3OYH A;  4UV8 A;  2Z16 A;  3GBG A;  5B5E C;  3GEZ A;  2XSD C;  1JKQ C;  2E34 A;  5A2Q Z;  3WGH A;  5FRM A;  4H0E A;  2OZU A;  3ZMD A;  2G7U A;  1ZG5 A;  2F4M B;  4XLA A;  4B47 A;  2X0L A;  3DU5 A;  2XF7 A;  1D5V A;  2WB1 A;  2QQ9 A;  3FX3 A;  2Q1Z B;  2VB6 A;  4M9S A;  2V6E A;  5JI6 A;  5ICG A;  4XBF A;  1S7O A;  3NWS A;  3FF5 A;  4ENJ A;  2E1C A;  3ZP5 A;  4CH7 A;  3PFI A;  1UFM A;  2HWV A;  1LEA A;  2IVM A;  3JRC A;  1ETY A;  1VQP I;  3QP6 A;  4IF4 A;  4FAS D;  1JT0 A;  5J47 A;  4DYQ A;  3WTT C;  2W1O A;  2MLG A;  5DS9 A;  2X85 A;  1T2K A;  2E1M C;  3GZ6 A;  5FLM J;  4PGG A;  1IAW A;  3CJQ B;  3HEF A;  2MD5 A;  3KLN A;  4KIT B;  1OCZ H;  3BP8 A;  2VOD A;  3V7C A;  5IYD J;  4OIN F;  3OYG A;  2V1X A;  1YIT I;  4BXU A;  1R71 A;  2YX7 A;  3BCB A;  2XIG A;  2F5D A;  4ZYH A;  1O7F A;  1S3J A;  4BE2 A;  5TGT A;  1VQ6 I;  5HS8 A;  2CQX A;  2JA2 A;  1V55 H;  1JUM A;  4KIB A;  2I10 A;  4I0B A;  3FMQ A;  2RN7 A;  4G6T B;  4I0A A;  1UHW A;  4ON0 A;  2M87 A;  1N25 A;  4F3Q A;  2F4O B;  1PP7 U;  3WTX C;  3V8K A;  3RKX A;  2KIM A;  3W6V A;  4UB6 C;  1DU6 A;  1CQT A;  3L2R A;  2I5U A;  3KEY A;  2WAD A;  2O0Y A;  1UST A;  3HBL A;  3X2Q H;  1NHA A;  1VI0 A;  2YS9 A;  4B4C A;  1M1E B;  2LDU A;  4XLP F;  4FT8 A;  3S93 A;  1X2M A;  2EA2 A;  2HQN A;  1E0E A;  1MH4 A;  5FRN A;  4L18 B;  4BDZ A;  3HRU A;  3VSK A;  2DA7 A;  3O2P E;  2ETH A;  3AG2 H;  5CJ9 A;  3J81 K;  4BNC A;  2OU2 A;  4ZYD A;  1J9I A;  3ZN1 A;  3HRT A;  1HOM A;  2EIL H;  4ZDO A;  4B43 A;  5DCM B;  3ZR8 X;  1VFC A;  5DDG A;  1OMI A;  3I9V 2;  2W85 A;  4B09 A;  3E3V A;  4A3B J;  3VSL A;  3V4G A;  3I56 I;  3VOE A;  2JWT A;  4F7Z A;  3O8H A;  4G8X A;  1GDT A;  2EZL A;  3RZO J;  2HZT A;  1SVM A;  1MBH A;  5E79 C;  2P5K A;  2HPM A;  1D0Y A;  3KCC A;  5L3D A;  3JRB A;  1KU3 A;  1X1C A;  1FY7 A;  1FMV A;  5B3S H;  3G1M A;  5FKO A;  3ZN0 A;  1OQY A;  2DJI A;  1R9T J;  3O6B B;  1JGS A;  2GA1 A;  4G6D A;  3TDU C;  2X9D A;  4IOA F;  1ORK A;  1D1C A;  1OCP A;  4BEH B;  1ZAO A;  1RPW A;  4G9Y A;  3TO7 A;  4ZZL A;  1MSE C;  3PNT A;  5GTH C;  3W2W A;  2RC4 A;  2RAE A;  5LGU A;  2QVO A;  1T98 A;  2YU3 A;  5L3B A;  1I1S A;  3L09 A;  2VBZ A;  1WVR A;  1RKW A;  1HDP A;  2ELH A;  3LSJ A;  3G2B A;  4G6Q A;  4JX5 A;  4EJT A;  2DT5 A;  4HZF A;  5HNH A;  3CF5 F;  4OIP F;  3FKI J;  2OUM A;  4M3E A;  1TP4 A;  1OKR A;  3IKT A;  4ZYA A;  3ROU A;  2HTS A;  3ZQF A;  3HB9 A;  2KP6 A;  2LK2 A;  4PJN A;  4A3E J;  2KJB A;  3FZV A;  1SAX A;  4A6D A;  3QPT A;  5GAG J;  2QCO A;  4RGS A;  2CV2 A;  3DKY A;  3F6V A;  2VKV A;  3H36 A;  3CDL A;  4N9H A;  4RGU A;  2A61 A;  5L3E A;  3JRF A;  2XKP A;  1IUY A;  2GQQ A;  2FBK A;  3CF2 A;  5F6F A;  3WTU C;  2WAE A;  2LVS A;  5LRS A;  2UZK A;  1ZGW A;  1WHU A;  1LEB A;  2VQH A;  3FM3 A;  3MMY B;  2ZXW H;  3SDG A;  2K7L A;  3E97 A;  2K9L A;  1D1B A;  4RA2 A;  2HS5 A;  1AKH A;  1R36 A;  5ERI A;  2LP0 A;  4CIC A;  3QOP A;  2HPI A;  2CUZ A;  1I3Q J;  1VND A;  1Z0X A;  2YU9 J;  3GTL J;  2ICW G;  2BV6 A;  2FUG 2;  3KP5 A;  4GYI A;  2M0C A;  1RC9 A;  3OYM A;  3GW2 A;  4CYD A;  2F5V A;  1SD5 A;  2ZME A;  3SFI A;  1V54 H;  1KYW A;  1DP3 A;  3F3X A;  2DA6 A;  3F22 A;  3F23 A;  2X6X A;  1IDY A;  1I5Z A;  1TBX A;  1U8B A;  1Q1H A;  3RZD J;  2QQB A;  2L0K A;  2KIQ A;  4L5I A;  4LLL A;  2PMZ N;  1QHG A;  3KP3 A;  2E71 A;  3ZQI A;  4ZDP A;  1UG2 A;  2J5P A;  1IN8 A;  2X1D A;  1Y1W J;  3R6S A;  5EYR A;  2CRG A;  1B9N A;  1LQ1 A;  1FZP B;  1OLT A;  1BI1 A;  1ENH A;  5E3O A;  4BE1 A;  1H0M A;  1LB2 A;  2Y31 A;  1XX5 A;  3GYH X;  5E8I A;  3ISP A;  4LJZ F;  2M4G A;  4Y13 A;  4NB5 A;  4C2M J;  4I09 A;  3S32 A;  3M8F A;  4BAY A;  3GTP J;  3HOV J;  2GLO A;  2VBY A;  2VKD A;  1Z3Y A;  4M72 A;  2EK5 A;  3H9Q A;  1S29 A;  4PCQ A;  2HOS A;  3MZ8 A;  5FFX A;  2VT3 A;  4EV0 A;  3MFK A;  4J19 A;  2NVU B;  3CCJ I;  2FBH A;  2AS5 F;  2KDZ A;  3CDI A;  2YX4 A;  2V6C A;  2KT0 A;  3S1M J;  3OYJ A;  3PUB A;  4ENM A;  2DA5 A;  4BXF A;  4DOZ A;  2VJ5 A;  3A1Y A;  1ZHF A;  3ASO H;  3BLY A;  3U2R A;  5GPC A;  4DZJ A;  2ZJQ F;  1PP8 F;  1D0X A;  5FGM A;  3TW6 A;  3PO3 J;  2W24 A;  2MFZ A;  2CW8 A;  2FBI A;  3DPU A;  2FU4 A;  3KZZ A;  1STZ A;  3VWB A;  3GVA A;  3OYA A;  2JTV A;  1FIP A;  3KFW X;  1IN4 A;  4KT6 A;  2DU9 A;  4KNY A;  1BR4 A;  3H0G J;  3VFZ A;  4P1W A;  1V3F A;  2NS8 A;  2DQR A;  2VON A;  3TOA A;  3G73 A;  3EDP A;  5J1Y A;  4HQM A;  1RUN A;  1MMG A;  4DZP A;  2R5Z B;  1TT5 B;  2VN2 A;  4AVP A;  1IXR C;  1EA3 A;  1R4N B;  1EH8 A;  4NDL A;  2XB0 X;  5D4S A;  5FLX K;  2QA4 I;  4LK1 F;  3H35 A;  5FB2 A;  2RDP A;  2DA4 A;  3B6C A;  4HLY A;  2ZJP F;  1D0Z A;  2CU7 A;  2FRH A;  3EQL F;  3OYB A;  1VZ0 A;  4KMU X;  3K2A A;  5DD4 A;  1RZ4 A;  4FX0 A;  2FNA A;  1Q1V A;  4IRI A;  1TZL A;  1Z7L A;  2QQA A;  2BEO A;  2FEZ A;  1Y0U A;  4IHV A;  1D8J A;  1SAN A;  2NVX J;  4UUT A;  2LY9 A;  2JA8 J;  1X3W B;  1Y6I A;  3SZP A;  3BJ6 A;  4D0P A;  4IQ4 A;  1JKR C;  2XAH A;  4N9I A;  3P9K A;  5IOY A;  2CG4 A;  4X6A J;  4A12 A;  5E17 F;  2HQR A;  2MC4 A;  2ESN A;  3BRO A;  2PN6 A;  3BR3 A;  1RR7 A;  4NQW B;  1T0F C;  3ASN H;  3DFG A;  5E18 F;  2OZ6 A;  4CO8 A;  2IS6 A;  4KMF A;  2LRE A;  4ZTF A;  4RM2 A;  2MLK A;  3IV5 A;  4F91 B;  1G3W A;  4ZYG A;  4M6V A;  5F0F A;  1R00 A;  4IZZ A;  4F92 B;  2O5R A;  3PL8 A;  4BAC A;  2XF5 A;  4UB8 C;  4IXA A;  1W36 D;  2E35 A;  1KQ8 A;  4AIK A;  3SEZ A;  3I4N J;  1XTA A;  2XAS A;  4EMS A;  2LG4 A;  1KQ0 A;  2A5Y B;  3AG3 H;  1SFO J;  4EM0 B;  3BG9 A;  2W82 A;  2JJ7 A;  3GME A;  1QZY A;  2CW7 A;  1UEL B;  2A3S A;  3JRI A;  2L7M P;  3CQZ J;  3RQI A;  2JT1 A;  3IWF A;  4WF2 A;  3ZQ7 A;  4L9J A;  5FO5 A;  3R0A A;  3C18 A;  4PJM A;  2JPC A;  3BZ6 A;  4EJU A;  2MYS A;  2V26 A;  2MSY A;  5JLW A;  5EGO B;  1VQ5 I;  3T8R A;  1K6Y A;  2JRM A;  5H6Q A;  2R5Y A;  1IN6 A;  4L9N A;  3F0C A;  1T38 A;  5LEK A;  2LY2 A;  4RAG A;  1YW8 A;  4XKV A;  2PI0 A;  1K61 A;  2KZG A;  1BIA A;  3OYC A;  2XAJ A;  3CJN A;  4HF1 A;  1TWC J;  4OAY A;  3ZQQ A;  3BTJ A;  3F6O A;  4IO9 F;  4N4N B;  2XF6 A;  3ZXS A;  3KLO A;  4HDV A;  1V5E A;  1ZLJ A;  1V4R A;  5J40 A;  2GIV A;  2QEX I;  2H94 A;  1X3U A;  1C0W A;  3LSR A;  5KCM A;  3UKG A;  2V9K A;  1LVK A;  3I53 A;  2WV0 A;  2XRN A;  2HKX A;  4M74 A;  3NQO A;  3K7A J;  4G94 A;  4A3I J;  5HDN A;  2ME0 A;  1IC8 A;  2R3S A;  1Z6R A;  2Z99 A;  3HOU J;  1ZLK A;  2Y0S A;  2ZBK A;  1J59 A;  3L2C A;  1SD6 A;  1YE9 A;  1BR2 A;  2LFB A;  1YX5 A;  5IT3 A;  2V9P A;  4A3K J;  4KIG A;  2VI6 A;  2P0W A;  2YPR A;  4XOP A;  3QYB A;  1RNL A;  1UHS A;  2WAF A;  1F9N A;  4MFE A;  3CMY A;  2GM4 A;  4BQA A;  3L2W A;  5E20 A;  2EIN H;  3P7N A;  2DW4 A;  4E70 A;  2V79 A;  3DTE A;  3U1D A;  4ESF A;  2QM3 A;  3WE2 A;  5B66 C;  3QRF F;  1TWH J;  2WC2 A;  3E5X A;  4P96 A;  2LC2 A;  3B02 A;  2ZSI B;  3BJA A;  1O4X A;  3GO5 A;  3KP2 A;  2R7U A;  3IH3 A;  1W36 C;  3OS2 A;  2Y9Y A;  1F43 A;  1XGM A;  2VKH A;  3REO A;  5ILV A;  1A35 A;  1XDS A;  3WTZ A;  5BS6 A;  2KMU A;  1OCR H;  4UV9 A;  2M3A A;  1WJB A;  1G3T A;  2JA5 J;  4ZH4 F;  3V8L A;  1TNS A;  4V2F A;  3RKY A;  1YX3 A;  4CYC B;  2NNY A;  4II2 A;  4JOM A;  3EUK L;  4HST A;  1BOB A;  3WTV C;  4I7H A;  4LD5 A;  2CS3 A;  4YRV A;  2O8K A;  2L01 A;  1K79 A;  2DDA A;  3B73 A;  3W6J B;  2VQC A;  2ZFW A;  5F0H A;  4UNO A;  5K5Q A;  1R5G A;  2FOW A;  4MHG A;  5ILU A;  1B1B A;  3KZY A;  4A0Z A;  5CQE A;  1OJL A;  2VC0 A;  5K1Y A;  2IGM A;  4FIS A;  2PMU A;  2BOL A;  2ZSH B;  1ZKG A;  5DCM A;  1NK3 P;  1KGS A;  5CVI A;  3CMA I;  2DOE A;  1BA5 A;  3KYC B;  2J5O A;  2HR3 A;  2WA0 A;  1IGN A;  3SZG A;  3M07 A;  1IUF A;  5FD6 A;  5J4V A;  2DOF A;  4KN4 X;  5HLH A;  3CO7 C;  2XRL A;  5CQG A;  2XKO A;  1G2H A;  5L3C A;  1JGG A;  3GLX A;  3K69 A;  2IS1 A;  2M9H A;  3IKV A;  2NS7 A;  3JTG A;  3QYF A;  1OIS A;  4R79 A;  1HXD A;  2GXG A;  3JTH A;  1U3E M;  2A07 F;  1Y56 A;  2MBF A;  4P9U A;  1YIO A;  3ZQC A;  2QSH X;  2PG4 A;  3WHB A;  3FXR A;  3ESW B;  2VIX A;  4KT5 C;  2A6H F;  3KIO A;  3NAR A;  1ZRD A;  2OC6 A;  2RNJ A;  3SZT A;  3ZQH A;  3PJR A;  3LQR A;  5HS9 A;  1S7A A;  4JX6 A;  4XMY A;  3GTJ J;  2M30 A;  2B9S A;  3HM5 A;  2PMH A;  5K7Z A;  3HGY A;  1WRJ A;  3A4C A;  3G4S I;  2HXO A;  5E8G A;  1GUU A;  2CW0 F;  4BHB A;  3LNQ A;  2XVC A;  2Z33 A;  3FBN B;  1WWX A;  3J7Y J;  3I4M J;  1FSH A;  3ULQ B;  3GUD A;  4XRS G;  4F55 A;  2DTR A;  2WV1 A;  4D7N A;  4M73 A;  3LSK A;  3R4K A;  4LK0 F;  4CCL A;  2K3P A;  3M1E A;  1U9N A;  2GIZ A;  3K10 A;  3CLQ A;  4JK1 X;  4BXX J;  2W25 A;  5FKN A;  1HC8 A;  2FA5 A;  2LF8 A;  4M71 A;  4XIC A;  3WTS C;  3JRG A;  2R7X A;  4U0W A;  1KYZ A;  4C30 A;  3AG4 H;  2VJJ A;  4WWC A;  2EIJ H;  3MZY A;  1WI3 A;  5J3L A;  3N97 A;  5KK1 A;  3IRR A;  1SC7 A;  1W5S A;  2HYF A;  4IHW A;  1OPC A;  3ZGK A;  3CES A;  1DQU A;  3BTC A;  4GRI A;  4PJ0 C;  1U78 A;  5IOZ A;  4LMY A;  1ZR4 A;  1P92 A;  4DBR A;  5ED4 A;  3JRH A;  5F1J A;  2P7V B;  1I1G A;  4GXO A;  4FE7 A;  4AD9 A;  4I02 A;  1MNE A;  2DMT A;  3FXQ A;  4AUX A;  5FKL A;  3TO6 A;  1AWC A;  4EVI A;  5JVT A;  2DPU A;  4B3A A;  1VQO I;  1GVJ A;  3BR0 A;  1O3S A;  3C7J A;  1SAU A;  3CUQ B;  1ITY A;  2X1E A;  1WI9 A;  1GXQ A;  4FCY A;  3MKL A;  2FJ1 A;  2WY8 Q;  3F72 A;  3BQY A;  1RI7 A;  4BUP A;  4IX7 A;  5EEH A;  5EEA A;  5ICC A;  2D1V A;  2UXX A;  1GVD A;  4GGG A;  2L4M A;  2DFF A;  2VAS A;  1ZYR F;  3M9A A;  2PJR B;  2IA1 A;  2VXZ A;  2D45 A;  4OMY A;  1IN5 A;  4RGX A;  4OWR B;  3FWE A;  1WSU A;  3H0D A;  4P9F A;  4JYK A;  2QKL B;  3QQA A;  5DCF A;  4EJW A;  1W0T A;  1TLH B;  1ETX A;  1LFP A;  1J75 A;  1ONV A;  5LHG A;  2ADU A;  3H92 A;  1MBE A;  2IJL A;  1YS6 A;  2VJI A;  3KEO A;  2WWY A;  4Z2Y A;  1O3T A;  1TWA J;  1QRY A;  3Q0W A;  3R0J A;  1QVU A;  1ETK A;  2XB5 A;  3J7Z I;  2HXI A;  3S3N A;  5M3F J;  3C2H A;  1VQK I;  2AQF A;  1X4P A;  4JP0 A;  3TKY A;  4E7Z A;  5LEJ A;  4RLF A;  2WBM A;  1YLF A;  4ENN A;  4C2T A;  2DCE A;  3QOD A;  3H3Z A;  2ZME C;  1ETO A;  5J1U A;  1DUX C;  2E36 A;  3A01 B;  3ABT A;  5DTD A;  2ZXJ A;  3OYK A;  1A04 A;  1F4K A;  3IUO A;  1PUF B;  2K9M A;  1GV2 A;  5J1R A;  1KZH A;  1ACI A;  3K1P A;  2K4J A;  2R4G A;  3E0J B;  4PFP A;  3ZQG A;  3F21 A;  3DBL B;  2R5Z A;  2GXB A;  3RQ4 A;  2ESH A;  4HBL A;  1PDN C;  1VQN I;  5IP9 J;  1L0O C;  1FOK A;  2EZH A;  2LNB A;  3PQJ A;  5HNF A;  3HOX J;  1R5H A;  3FXK A;  3MKZ A;  1IW7 F;  4CCK A;  3TBI A;  3QP5 A;  2XRO A;  3I3L A;  3S3M A;  1ZGA A;  3CC4 I;  1A31 A;  4D1Q A;  2IA0 A;  3VYT B;  4MFD A;  2BW3 B;  4ZC3 A;  4G12 A;  3OYN A;  2COM A;  2LLK A;  4EM2 A;  1FC3 A;  1NG6 A;  2F5E A;  3CCM I;  3K4K A;  1ZTR A;  4P55 A;  1LPQ A;  4XSX F;  1DPR A;  4I2O A;  2Z3Y A;  2O7O A;  3MEX A;  6PAX A;  2VJ4 A;  3BY6 A;  3J80 K;  2P8T A;  2HI3 A;  1H9G A;  2MG4 A;  1HDD C;  1I6H J;  2Q2E B;  3MCZ A;  2ZNZ A;  1Z6T A;  2CO5 A;  2M7A A;  2DA2 A;  4NQW A;  2OTJ I;  2ISY A;  2OAZ A;  1TL8 A;  4IL6 C;  1K4T A;  1R1U A;  1WJF A;  1OFC X;  1VQL I;  5F04 A;  5TRD A;  1JKP C;  4LIU A;  2V1D A;  4XLN F;  5K7H A;  2P5V A;  1YYV A;  2A69 F;  4RLQ A;  1IXC A;  2KFD A;  2EV5 A;  4PZJ A;  4LB6 B;  1L3L A;  3J7A O;  3W6K B;  3ABL H;  4RDU A;  4BJ5 C;  4E6K G;  4Y15 A;  5KAI C;  2CH0 A;  4N4O B;  5HVQ C;  2K27 A;  2K3F A;  1NTC A;  3AAF A;  3DEU A;  4LG3 A;  3U21 A;  3G6E I;  3GXO A;  1B8I B;  2FMY A;  5E1Z B;  4ASN A;  5DM6 F;  4WCG A;  4BU2 A;  5EGO A;  1FYL A;  1OCC H;  3GFM A;  2HVR A;  4M6X A;  2E5N A;  1GT0 C;  2QSG X;  5DM7 F;  1BC7 C;  4CCM A;  5J6X A;  3WU1 B;  3F8C A;  4HW0 A;  2VQL A;  3PSI A;  4A5M A;  3BZK A;  2R7S A;  5E1W A;  2E7W A;  1WZ2 A;  3MQ0 A;  2VC1 A;  3LSG A;  1FOY A;  4FTH A;  4EEF G;  1YJN I;  1MH3 A;  3ZMU A;  1S8N A;  3Q0V A;  4A3D J;  4FE4 A;  4ABZ A;  2NNN A;  1MW7 A;  2ID3 A;  4HDU A;  3FHZ A;  3H9J A;  1VQ9 I;  4N0B A;  3BG5 A;  2VE9 A;  5K5R A;  1H9T A;  3CCQ I;  1VQM I;  1FX7 A;  5HLG A;  4YII A;  2G0E A;  3CC2 I;  1ZK8 A;  1ZGJ A;  2BZT A;  2KPM A;  3A0H C;  3L9F A;  1RIO H;  2V7F A;  1W1W E;  3W2V A;  2ZXH A;  1Z1D A;  2HVQ A;  1YFH A;  2QKM B;  3K2Z A;  3GFJ A;  4FHT A;  4OU0 A;  4E7S A;  3HSF A;  3RTR A;  2KQR A;  2NVT J;  1R23 A;  2EB7 A;  2GOX B;  1IG7 A;  4HSR A;  3DTI A;  2DOD A;  2MGQ A;  4AM3 A;  2L9N A;  1OCT C;  2ID6 A;  3E6M A;  4M3F A;  2DDB A;  3CP8 A;  1QPM A;  1OCO H;  3FDY A;  3QWL A;  3I0T A;  1IF1 A;  4I01 A;  3S2H J;  4G7Z F;  3OMY A;  3M8J A;  3KZI C;  1UJ8 A;  5HOO A;  5BPD A;  1FWZ A;  2X6Y A;  3J81 Z;  4ZDL A;  3CUO A;  1RR8 C;  4ZTJ A;  2MA3 A;  3H1C A;  4BYY A;  1U5T B;  1V5F A;  1XPX A;  4DQ2 A;  4Y17 A;  1MIJ A;  5ILS A;  4CYC A;  4B1R A;  2DI3 A;  4DJA A;  4A5N A;  1R1T A;  3GCM A;  1AOY A;  1JTX A;  2IS2 A;  3QPL A;  4KIS A;  1MMS A;  4KN7 X;  1XCV A;  5B1B H;  2NOJ B;  3S8P A;  4MNU A;  1Z21 A;  2L7F P;  4XN0 A;  2WB1 N;  2E5Z A;  1U8R A;  1I6X A;  4WXH A;  3E6B A;  1MNM C;  4BBS J;  1BW6 A;  3SDB A;  1XMA A;  3EYI A;  4U7B A;  4TV7 A;  2R93 J;  2AXT C;  1K6O A;  2AHQ A;  5DD8 A;  5HDK A;  5EZH A;  3BG3 A;  4AIH A;  3FHN A;  1YW7 A;  5F64 A;  1K7A A;  1MJB A;  1JHF A;  1ZAR A;  4DGW B;  2R7W A;  3HHG A;  3OL4 A;  4UUV A;  1J5Y A;  4XLF A;  2PX9 A;  1BBY A;  1X1A A;  3EET A;  2FQ3 A;  3T0Y A;  3V42 A;  3JRD A;  4D5F A;  3P5J A;  5L3G A;  2F48 A;  2ZKZ A;  4E7K A;  2HQ5 A;  2HTJ A;  4XRM A;  3GX4 X;  2CQ7 A;  3DKX A;  2IT0 A;  3WG7 H;  1N78 A;  1I3A A;  4DYR A;  3KYL A;  2D5V A;  2D1H A;  5ICF A;  2QF7 A;  1I27 A;  5H6R A;  2KKO A;  2RNG A;  1MMA A;  4R8H A;  3WE3 A;  1ZRC A;  4G7O F;  4Y3O A;  3ELK A;  1IRZ A;  5JHU A;  2DJN A;  3TQN A;  3RPU D;  4UY8 I;  5M5W J;  3HGG A;  2IAI A;  1IRX A;  3ABM H;  4PJJ A;  3JRA A;  1MND A;  3BQZ A;  1T95 A;  4GCV A;  2O6G E;  3K4J A;  3TED A;  4F93 B;  4Y4R A;  2TRT A;  1V5G A;  3QPH A;  2MW8 A;  4XL9 A;  2DFE A;  3CCY A;  3AL0 B;  4KA4 A;  1TQP A;  4IEJ A;  3CLO A;  5B1A H;  5EDN A;  3COA C;  4KDP A;  2DMU A;  1QZZ A;  1W4M A;  3W2A A;  4IVN A;  3Q3S A;  5H20 A;  3G1L A;  1JHH A;  3HC7 A;  2A68 F;  2ZJ2 A;  1P7I A;  3K1M A;  2XDV A;  2HDD A;  2M8E A;  1UMQ A;  4MTD A;  1SFX A;  3R61 A;  1TC3 C;  5D5X B;  1GV5 A;  1HLV A;  3U9G A;  2VPL A;  3K6G A;  1ZEL A;  5EG0 B;  3I5U A;  3MAJ A;  2L9S A;  5IP6 A;  4NC8 A;  2QEN A;  2O9L A;  2HYG D;  3BR2 A;  3PNY A;  3HTU A;  4NC6 A;  3BG6 A;  5LRR A;  5CPR B;  4PK4 A;  2E2I J;  5HLI A;  5GPA A;  3C2G A;  5HLT A;  5D5V B;  2Z2S B;  1JT6 A;  4NNJ A;  5EJC A;  3CMM A;  5DV5 A;  4HEA 2;  1A6Q A;  5CVU A;  1TWF J;  1ZRF A;  2YUS A;  3TO9 A;  1WGX A;  3GTK J;  5E1X A;  3K4N A;  1FNN A;  5TIS C;  1TWG J;  4ANJ A;  3OYF A;  3D1N I;  1FT9 A;  2R7Q A;  4IHY A;  2BY3 A;  2EIM H;  4YFK F;  4LG0 B;  2E60 A;  4L9V A;  4HX4 A;  2FSW A;  4PUS A;  2C6Y A;  3GTO J;  3CUQ A;  5JR3 A;  1O3R A;  1FPQ A;  3WTY C;  2LSO A;  1BJZ A;  3T1B A;  3DKW A;  2O3F A;  2HOA A;  3LFU A;  3ZMZ A;  3JSO A;  3HXL A;  2CGP A;  1AHD P;  2DLL A;  2EFO A;  2B63 J;  3I59 A;  4XON A;  3E6C C;  4RAZ A;  2PJR A;  4BJT A;  2K4B A;  2W00 A;  2FD5 A;  3KP4 A;  2CMP A;  3RYR A;  4PSX A;  2ME6 A;  3LA2 A;  5D8L B;  1B9M A; 
#chains in the Genus database with same CATH homology
 3PJR A;  2M0M A;  2X1C A;  4BQQ A;  4XMY A;  4G6T B;  2F6C A;  2LRD A;  4AVZ A;  3CP2 A;  1S9H A;  3A4C A;  3D5R C;  4F3Q A;  3K4L A;  4JQF A;  3OYE A;  2IGK A;  2KDO A;  3L2R A;  3FBN B;  2WAD A;  2XSJ C;  3KEY A;  3LSI A;  3OY9 A;  1D1A A;  3KX2 A;  3SYT A;  4F55 A;  2ZXI A;  3H9G A;  3TL4 X;  3OS1 A;  3S93 A;  3LSK A;  2X51 A;  4YEL A;  4CCL A;  2K3P A;  4CSW A;  1E0E A;  5FRN A;  2UV1 A;  2KL4 A;  2R7T A;  3K10 A;  3VYU B;  2VL8 A;  3L2V A;  4BDZ A;  5LFA A;  2R7X A;  4XN3 A;  3VSK A;  4C30 A;  2R7R A;  2DT7 B;  2VJJ A;  4C2U A;  4BQN A;  3HKZ A;  2DXI A;  1DGR M;  2CUJ A;  2X6W A;  3OYI A;  4IQJ A;  3MKY B;  3LSH A;  4ZDO A;  3ZGK A;  3CES A;  1DQU A;  4GRI A;  4B43 A;  3ZR8 X;  3UR3 C;  2HDW A;  3I9V 2;  2HVS A;  4DBR A;  3N05 A;  3VSL A;  1LKX A;  1MNE A;  4ZJZ A;  2HPM A;  4XLC A;  3HPG A;  1D0Y A;  4E4H A;  2RQQ A;  3K70 D;  1SAU A;  2X1E A;  4XR6 A;  1X1C A;  1FMV A;  2M4K A;  2WY8 Q;  2BW3 A;  2MAB A;  2DJI A;  4BUP A;  4IX7 A;  4EAT A;  2LBF B;  2DOA A;  3ZRG A;  3F9K A;  1D1C A;  3DQV C;  2BVM A;  1P9Q C;  1OR7 C;  2VAS A;  4BEH B;  4HPQ A;  2IXS A;  3ONQ A;  3PNT A;  2PJR B;  1GLN A;  2VXZ A;  3W2W A;  3OYD A;  2XAU A;  4NUB A;  4OWR B;  1MMN A;  3H0D A;  2GOM A;  2QKL B;  4J01 A;  4B3X A;  3G2B A;  3H5N A;  5HNH A;  2JUG A;  2OUM A;  1LFP A;  1WJE A;  4BS9 A;  1ERD A;  1U0J A;  3VYR B;  4ZYA A;  2KP6 A;  4PJN A;  1WJA A;  3FBI B;  2VJI A;  2RRE A;  4BDY A;  2ELJ A;  2R7V A;  2CV2 A;  3DKY A;  3S3N A;  3OR2 C;  3C2H A;  2AQF A;  1X4P A;  2KRH A;  3CF2 A;  4E7Z A;  2WAE A;  4RLF A;  2WBM A;  2VQH A;  4C2T A;  3MMY B;  4CUG A;  2DCE A;  3QOD A;  2V1N A;  2WAQ A;  2K9L A;  1D1B A;  1WJ5 A;  4P5O A;  3OYK A;  2HPI A;  3IUO A;  2CUZ A;  4B48 A;  2K9M A;  2FUG 2;  4H4K C;  3OYM A;  2F5V A;  4PFP A;  2R4G A;  3E0J B;  4BEH A;  1PYV A;  1DP3 A;  3RQ4 A;  2X6X A;  2Z1D A;  1X19 A;  3M1C A;  4NC7 A;  2L7K A;  3BCA A;  5HNF A;  2IGO A;  1QHG A;  3MKZ A;  3OIP A;  4ZDP A;  2VLA A;  3OYL A;  4CCK A;  2LYC A;  2X1D A;  3TBI A;  3K70 C;  3I3L A;  3S3M A;  4XOT A;  1OLT A;  4LIV A;  4BE1 A;  2L2O A;  4BL0 B;  1LDK B;  4D1Q A;  3VYT B;  2K5C A;  2XC7 A;  2BW3 B;  2M4G A;  4ZC3 A;  3BG7 A;  4FET A;  4YEJ A;  3OYN A;  2DT6 A;  4XNF A;  3S32 A;  4J00 A;  1NG6 A;  3CJR B;  1R6R A;  3VYS B;  3K4K A;  4XKB A;  3QOE A;  2UWM A;  2VKD A;  1Z3Y A;  3D5S C;  4OAZ A;  3HL2 A;  3IAM 2;  3CZ6 A;  3HUG B;  3H9Q A;  1QHH D;  1WFX A;  1MMD A;  4DBQ A;  2VJ4 A;  1JI8 A;  1J09 A;  2Q2E B;  3DTK A;  2KZV A;  2M7A A;  1G59 A;  3EPZ A;  3RCO A;  3OYJ A;  1AA7 A;  3PUB A;  1KON A;  1WJF A;  4BXF A;  2LOO A;  3DPL C;  3LL7 A;  4DOZ A;  2VJ5 A;  3A1Y A;  2BVL A;  3H5A A;  3BLY A;  4LIU A;  1BR1 A;  4HNU A;  1D0X A;  2IS4 A;  4RLQ A;  2MFZ A;  2CW8 A;  4XM3 A;  3DPU A;  3VWB A;  4BJ5 C;  4E6K G;  4QPQ A;  3A2K A;  2CH0 A;  4N4O B;  5HVQ C;  3EUA A;  3OYA A;  4LG3 A;  5FRO A;  3U21 A;  2W7N A;  1X4O A;  4E7H A;  3E1S A;  4KT6 A;  4II3 A;  4BU2 A;  1BR4 A;  3NWT A;  2HVR A;  3FKJ A;  2E5N A;  4P1W A;  3HG9 A;  4CA0 A;  3D5L A;  2I8D A;  4BGD A;  2E1M B;  4QPO A;  1MMG A;  4CCM A;  3OS0 A;  3PSF A;  1EA3 A;  4XKW A;  2VQL A;  3PSI A;  3H35 A;  2A6T A;  3OOU A;  3S3O A;  4HRI A;  2R7S A;  2KHM A;  4AYB A;  1D0Z A;  3LSG A;  2W4S A;  2F4I A;  1WJC A;  2L5Q A;  3OYB A;  1VZ0 A;  2LY1 A;  4XKC A;  4KJZ A;  4CCO A;  1MW7 A;  3DLA A;  3DWL E;  3OIQ A;  1TZL A;  1Z7L A;  3H9J A;  4LIT A;  2CV0 A;  1G8X A;  4RM3 A;  4ITV A;  2KRC A;  1WJD A;  1Y6I A;  2KPM A;  4IQ4 A;  4BE0 A;  2V7F A;  3W2V A;  2ZXH A;  2HVQ A;  4DIQ A;  3VDX A;  2QKM B;  3TMO A;  4E7I A;  2MC4 A;  2A5W A;  3OL3 A;  4E7S A;  3RTR A;  5CKT A;  4NQW B;  2KQR A;  1T0F C;  2GOX B;  2IS6 A;  4HSR A;  2LRE A;  3DTI A;  4HNT A;  4ZTF A;  4RM2 A;  4XLE A;  3AL0 C;  4F91 B;  2VQG A;  2L9N A;  3DPT A;  4IZZ A;  4F92 B;  2O5R A;  3PL8 A;  4C9Y A;  2XF5 A;  4BAC A;  3AKZ A;  1W36 D;  3CP8 A;  3SEZ A;  3OWT A;  3FDY A;  2LG4 A;  3OMY A;  3M8J A;  5HOO A;  2W82 A;  2X6Y A;  2CFO A;  4ZDL A;  1DGW Y;  2CW7 A;  2LH9 A;  1UEL B;  3HOT A;  4ZTJ A;  3RSN A;  3SEQ A;  2IGN A;  1V5F A;  4CZC A;  1FMW A;  3W3C A;  4D9J A;  4DJA A;  4PJM A;  4PSW A;  2MYS A;  2V26 A;  2IS2 A;  2WY7 Q;  1K6Y A;  4KIS A;  3HOS A;  1QU3 A;  4XLH A;  2UUZ A;  2NOJ B;  2LY2 A;  3S8P A;  1Z21 A;  4XN0 A;  2E5Z A;  4XKV A;  3OYC A;  1NG7 A;  1UG0 A;  3AFH A;  4OAY A;  3ZQQ A;  4CCJ A;  4N4N B;  4Y33 A;  2XF6 A;  3SDB A;  3ZXS A;  2JSP A;  3DU6 A;  3PNV A;  4U7B A;  1V5E A;  2R7O A;  3LSM A;  3UNG C;  3HPH A;  4F52 A;  2M7B A;  1X1B A;  5KCM A;  2V9K A;  4U87 A;  1LVK A;  2OV7 A;  3K4B A;  3FHN A;  4DGW B;  2R7W A;  3OL4 A;  5LD2 C;  3DEE A;  4XLF A;  1X1A A;  1N75 A;  3V42 A;  5JHF A;  2HNH A;  2Y0S A;  2MD0 A;  4RMN A;  3K4M A;  2VXD A;  4E7K A;  1YE9 A;  1BR2 A;  1YX5 A;  3DKX A;  3IP4 B;  2P0W A;  1N78 A;  4XOP A;  3QYB A;  3QYE A;  5KHD A;  3KYL A;  2WAF A;  4XOR A;  3BC8 A;  3L2W A;  3IAS 2;  1Z3X A;  2RNG A;  1MMA A;  3DTE A;  3MKW B;  4Y3O A;  2LC2 A;  2ZSI B;  4HG2 A;  3J7A Y;  3K4C A;  3RPU D;  2R7U A;  1IRX A;  4PJJ A;  2HQA A;  3L2Q A;  1MND A;  3OR1 C;  1T95 A;  1W36 C;  3OS2 A;  3K4J A;  2AQE A;  2HZD A;  4Y4R A;  4XQF A;  4F93 B;  1V5G A;  2VKH A;  4XL9 A;  3AL0 B;  1PJR A;  4X0G A;  2KMU A;  2M3A A;  1WJB A;  2JVG A;  4MLO A;  4B44 A;  3W2A A;  2V4J C;  4CCN A;  3HC7 A;  2PMZ A;  1YX3 A;  1TT0 A;  2XDV A;  4II2 A;  4JOM A;  4BQO A;  3EUK L;  4HST A;  1BOB A;  2CS3 A;  4YRV A;  2VPL A;  2JVH A;  2VQC A;  3K6G A;  2ZFU A;  3OYH A;  2Z16 A;  3GBG A;  1ZEL A;  2L9S A;  3EUH C;  5FRM A;  4NC8 A;  3ZCO A;  5KNL A;  3PNY A;  4XLA A;  3BG6 A;  4B47 A;  4E7J A;  5CPR B;  4PK4 A;  5CQE A;  3DU5 A;  2IGM A;  3C2G A;  2XF7 A;  5HLT A;  2BOL A;  2WB1 A;  2ZSH B;  2Q1Z B;  2VB6 A;  2Z2S B;  4NNJ A;  1N77 A;  3MD2 A;  2V6E A;  1SFK A;  3CMM A;  3NWS A;  4HEA 2;  3PFY A;  1HA8 A;  2WA0 A;  3SZG A;  4CH7 A;  3K4N A;  5CQG A;  4ANJ A;  4FAS D;  4PFO A;  3OYF A;  2R7Q A;  3LMM A;  2IS1 A;  2E60 A;  2W1O A;  2X85 A;  4IKF A;  4PUS A;  2E1M C;  4BJ6 C;  3CJQ B;  2HU9 A;  3QYF A;  4R79 A;  1UAA A;  3H5R A;  4KIT B;  1Y56 A;  3LFU A;  2LBF A;  2CV1 A;  3HXL A;  3OYG A;  4E7L A;  4XON A;  4PJL A;  3BCB A;  2PJR A;  4BJT A;  2W00 A;  4BE2 A;  2VIX A;  2CMP A;  2KLO A;  1X1D A;  3L2U A;  4PSX A;  2OC6 A;  5TGT A;  2JA2 A;  4AU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...