2JVGA

Structure of c3-binding domain 4 of staphylococcus aureus protein sbi
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
72
structure length
72
Chain Sequence
GAMVSIEKAIVRHDERVKSANDAISKLNEKDSIENRRLAQREVNKAPMDVKEHLQKQLDALVAQKDAEKKVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-function analysis of the C3 binding region of Staphylococcus aureus immune subversion protein Sbi.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
molecule keywords IgG-binding protein SBI
total genus 24
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11621 Sbi-IV C3 binding domain 4 of IgG-bind protein SBI
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1270 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2jvgA00
2GOXB 2JVHA 2JVGA 2WY7Q 2GOMA 3D5SC 3D5RC 2NOJB 2WY8Q
chains in the Genus database with same CATH superfamily
2HQ5A 1VQ6I 3OYLA 1FT9A 4MQ9F 5DCMA 1OPCA 3HSRA 3HRTA 4MEXF 3LSJA 4OIQF 2K7LA 4XR6A 3PO3J 3PUFA 1TQIA 4CA0A 3KYCB 4CYDA 1DU6A 3W3CA 2UWMA 1YJWI 4R79A 2PJPA 1SVOA 2KIMA 3KP5A 2W24A 3PQKA 2L02A 1QHHD 2OD5A 3ULQB 5HNHA 1W0TA 4XOTA 3JTHA 5IT9K 2DA6A 4Y4RA 3I71A 4UVBA 2RN7A 2R7FA 1FTZA 3AG2H 4L18B 2DPDA 3LAJA 3K4NA 4XIDA 5M5XJ 1IN8A 3NARA 5BNGA 4XKCA 5EF6A 3VYUB 5E1ZB 1POGA 2KL4A 1P2FA 4GXOA 3L09A 4ZDPA 4GO1A 2E2JJ 5D5XB 3GTJJ 1STZA 1I1GA 3MZ8A 3QU3A 2HOAA 2CFOA 3K69A 3NQOA 3KP2A 1QRYA 4WCGA 3R0JA 5K7ZA 2QSFX 1GLNA 2DT7B 2KISA 3TQNA 1HW1A 2YU9J 3FMQA 2EWNA 4JOMA 2CQKA 3OV8A 1MMNA 5EGOA 3GTLJ 2P7CB 1UHMA 1MNMC 3E5XA 3DU6A 3ZQLA 5J1RA 4JBAA 2R7UA 1Q1VA 2COMA 3GLXA 1JUMA 4L9VA 3ZMVA 1J75A 4P55A 3LA3A 4DYQA 2VOPA 2JA2A 4NC8A 2EPFA 3SFIA 1ETVA 5KCMA 3T8TA 3OS2A 1N75A 2LYCA 4RM3A 2LOOA 1W5TA 5ICGA 3S17J 3TO6A 2ZSIB 1Z7UA 1I27A 3CUOA 3ASOH 2X0LA 3JSPA 2HZDA 3TW7A 4PDKA 3OYGA 1FWZA 3S14J 1X4OA 5HDNA 2P0WA 3U1KA 2OTJI 3RQIA 3ZQHA 2EFOA 2OU2A 3IAM2 1LPQA 3ZMUA 4O6JA 1B72A 1Y1WJ 2WB1A 1SEUA 2M3AA 3PO2J 1MJBA 1UG2A 4RLFA 1DQUA 4IHVA 2R7DA 3F8FA 2JJ7A 2JTVA 1ZGWA 3GFLA 2XAHA 2BEOA 2DJNA 4HLXA 3DCFA 4HX4A 2E2IJ 5KNLA 3OOPA 4AD9A 5HLHA 4S04A 4EEFG 1Y6IA 2DYRH 3QYBA 3CJRB 2QGUA 1KU9A 1GVDA 4B4CA 5LEKA 4EJTA 2VONA 1LFBA 2OPTA 2STTA 3HIFA 3BJAA 3J7YJ 1R36A 4XLAA 3IV5A 2Q8KA 3FX3A 3S3MA 1IN5A 4ZH4F 2QQBA 5EG0B 3KLNA 3Q3SA 1S3JA 1F9NA 3E7LA 2GIZA 5IOZA 1BI2A 3DU5A 3IAS2 2ZBKA 1NG6A 4XSZF 3SQNA 5ED4A 1SMTA 2BXYA 1ZARA 3FF5A 2L7KA 4BJTA 4FHTA 1Z0XA 2QKLB 4FQGA 4BACA 3J81K 2QF7A 1ZGJA 4XRFA 2VQHA 2BVLA 3BJ6A 3F6VA 3KZYA 3L2QA 2EJRA 3JR9A 2C6YA 1YQAA 1ODDA 3K4CA 5F0HA 4Y15A 3GZ5A 1R49A 3C2HA 3IH3A 3RDIA 4U7BA 4LGWA 2VL8A 4A12A 1BIAA 1MMDA 3CCSI 2RNGA 4XN3A 2JVGA 1OR7A 1MH4A 3H35A 1QHGA 2DMNA 2UXNA 5FKMA 3GF2A 2KHMA 5IYBJ 2O0YA 2VT2A 1R4NB 1ETYA 2CG4A 2Y9YA 2XAUA 3WU0A 1ETOA 1DUXC 3MKLA 1EH6A 4M73A 1C0WA 4AWXB 2AQEA 3G3ZA 4FX4A 2YSRA 4PGHA 1XGNA 3CMEI 3FXRA 1Z77A 1MGTA 3ZMSA 1ZG5A 2XAQA 1LDJA 3HGGA 1NK2P 1BW6A 4KUMA 1MBEA 1MD0A 1P4AA 2X1CA 3PL8A 1WFXA 2UV1A 4YRVA 3M07A 4BL0B 4A3MJ 4EGZA 3CLQA 3E6DA 2EV0A 4A3DJ 2LR8A 3LSPA 5LHGA 2IEKA 2JN6A 2ZXIA 5B66C 4IQ4A 3KX2A 3FWEA 1TWFJ 2KDOA 1EH7A 3WTUC 2PX9A 2ECBA 3K4JA 2LD5A 4X1EA 1XPXA 4XL9A 2V4JC 3KLOA 1EH8A 2XB5A 1T0FA 3BY6A 2O5RA 2BBYA 2WAEA 4MIMA 2WWYA 2OUMA 2V9PA 1WI9A 3HYIA 2F4IA 4M3BA 5F0CA 1FOWA 2GQQA 3RKQA 2IGMA 4A0ZA 1X1DA 4XOPA 2PI0A 4LIVA 2V1UA 1R1TA 1OCPA 4RGSA 4U7DA 4ENMA 1K83J 1PUEE 5CLSA 3FXJA 1R1VA 3RZOJ 3L9FA 4CCLA 2F5VA 1MMAA 2F5FA 2BVMA 4FE4A 3R60A 3IWZA 4YEJA 3VPRA 4QIWN 1ONVA 4RBOA 1R9TJ 1QVTA 3G1OA 4LJZF 3EYYA 4CH7A 3K2AA 3HHHA 3BTIA 2CQNA 1GDTA 4WK8F 4G8XA 5DM6F 1WWXA 4PFOA 5DCFA 2ZJPF 4N4NB 3I4MJ 3T0YA 3M3YJ 2NOJB 5J4VA 2GA1A 5E8GA 1IC8A 2GLOA 4BJ5C 4EMSA 1WJEA 5JHUA 1FBQA 1WRJA 3BG5A 1D5VA 1BOAA 1MBFA 1LUJB 2Y75A 3L2RA 2ELJA 1ZG3A 2JQ7A 2CMPA 2E1MB 3LSTA 1VQPI 3KYDB 2HDWA 3W6VA 1LNWA 1WJBA 4E7LA 4F92B 5J3LA 4J19A 1K61A 4IHWA 1FY7A 3GFJA 1WJDA 3WG7H 1LE8A 3OR2C 3DEUA 2EFNA 1XN7A 2CWEA 4HG2A 3HUGB 3F6OA 4ZYHA 1QPIA 3S16J 3O3KA 4HA8A 4NC6A 5EG0A 3GVAA 1USTA 4UUTA 4XLNF 3HRMA 2CFXA 2DFFA 5LGUA 1V5FA 1X1PA 3DTIA 4A69C 2Y2ZA 4D7MA 3S1NJ 1ITYA 1U6GA 2NVQJ 4IQJA 5ILVA 4DW6A 5E3MA 2L7ZA 2RQQA 1PP8F 2MG4A 2QKMB 2XSJC 1MBKA 3TDZC 1XC5A 2GXAA 3W6JB 1RUOA 3A2KA 2Y31A 5FKOA 1SFXA 4Z6YA 4A3KJ 4HRIA 1ZG1A 1QQIA 1RESA 5F04A 4ETSA 1BJAA 3I56I 1D0YA 1AOYA 2VODA 4D1QA 2G7HA 1HCRA 1M1EB 3IKVA 4UHTA 5EZGA 3BG6A 5HNFA 4EQQA 3OYNA 4ZZLA 3P7NA 2QEXI 4ZYAA 2QENA 2L0KA 3VDXA 3CDLA 2WY8Q 2VJJA 5IP6A 1ZK8A 4PJNA 2LKXA 4A3CJ 2A6EF 2OTLI 3U2RA 2XDVA 4BU2A 3REOA 4CCOA 3ZQIA 1GV2A 2EA2A 1YOVB 4I98B 3S1QJ 2EA4A 1A6IA 2UXXA 1YTYA 4G7HF 3BQZA 2MW8A 4CICA 1FBSA 4IRIA 2RKHA 2K4JA 2IS1A 1J5YA 1USSA 2VIXA 3OIQA 4ENJA 1G2HA 1IF1A 1BA5A 5E1WA 2LF8A 3ASNH 5DYMA 2HU9A 4I01A 3KP7A 4DJAA 3CF2A 2L01A 3NWSA 5LRSA 2EIKH 1JJ6C 3I53A 3WU2C 3DTEA 4LLGF 3H5NA 3NEUA 1IGNA 1AHDP 2F4MB 1ETKA 1JGSA 4B1RA 1RI7A 2FU4A 1OYIA 2H27A 3IH2A 2HI3A 2R7TA 1BN5A 2HS5A 2XC7A 1JT0A 5KK1A 4A3JJ 3ZR8X 4I2OA 3CCJI 1F43A 3WE2A 1SD6A 1IUYA 2L5QA 4RB2C 2HQRA 4B48A 2OC6A 3ZOBA 4OOIA 3N97A 2XGCA 4ZDLA 2NXNB 1V4RA 1IXRC 4PUSA 4B43A 1R23A 4KT6A 5HS9A 3JRAA 2QZ8A 1YS6A 3JAMK 1VQKI 1WPKA 5GPCA 1UMQA 1Z9CA 2GXGA 1YITI 1PDNC 1N77A 1UB9A 3MVPA 2FUG2 1TWCJ 1N25A 2JUCA 3K4BA 3OYKA 3ABMH 1HDPA 1MIJA 3LL7A 4HX8A 4XNFA 3LSRA 2D1VA 3QU6A 4O5VA 5ICFA 4P9UA 1GV5A 1HSJA 2VBXA 2DMQA 4OIPF 2CUZA 3LQQA 3K70C 5FLXZ 2GIVA 2HYFA 3BJOA 2R7ZJ 1IN4A 3KCCA 3B6CA 2EB7A 2E35A 5L3CA 2OZ6A 5KHDA 1WJCA 3M1EA 1WI3A 5JVGF 2X1EA 2ZXHA 3F9KA 4HQEA 2EH3A 2MH9A 2XKPA 3FK6A 3O8GA 3OS1A 1W36C 2HVSA 1KU3A 2L3DA 1LDKB 2OJED 3CMMA 2VC0A 5F0FA 1TTYA 1LE8B 2DFIA 3MWMA 1BIBA 1A6QA 2NVYJ 4HZFA 3AL0B 3HOYJ 1V54H 1WH7A 2DA5A 3G1MA 3HOXJ 4UUSA 3R6SA 4A3LJ 4XICA 3HSEA 5HLTA 1HW5A 4XN0A 2FXAA 5ICCA 3BG7A 1J59A 4EVIA 2M0CA 5ILSA 4D5FA 3BDDA 4HBLA 5D5VB 5A2QK 1NH3A 4AVPA 1TL8A 2PMZA 3FXLA 4D0PA 2CUJA 1F1ZA 1Z91A 1YLFA 3DP7A 2FEZA 4HSRA 3M9AA 2OA4A 3GXOA 4HF2A 5GTIC 1LFPA 1WH5A 5C44J 4BE0A 2KRFA 3FHZA 2NNYA 2IAIA 2HNHA 2GOXB 1V55H 2ZNYA 5A2QZ 2KIUA 2RGVA 5CKTA 4E7JA 3RCOA 4IL6C 2Y48A 5LHHA 5DV5A 4KISA 2CSOA 4MGRA 3BROA 5H6RA 4BDYA 2Z2SB 3IRRA 2DN0A 1ZELA 2R7RA 3FIWA 1XGMA 4CCKA 3FMSA 4WWCA 3BG3A 3I0TA 3I64A 3I4PA 2M7AA 1BM9A 3N4MA 4FT8A 1XMKA 2YR2A 1EKEA 1SFEA 1XGOA 1B1BA 5CVVA 2ZO4A 4BHBA 1TC3C 1O7LA 1FOXA 2W48A 1EV7A 2ZKZA 4M6XA 3ZCOA 3H92A 2HQAA 3CDIA 2VE9A 4EV0A 1A31A 2ECCA 1BI3A 5LFAA 4ON0A 2ME0A 3H9QA 4CCMA 3BZCA 2MBFA 5JFRA 2Y0SA 1LJ9A 1YX5A 1E3PA 4FCYA 1HBXG 3GFIA 1ETWA 2PQ8A 1IUFA 2V26A 3V4GA 2K9LA 2VJ5A 5L3BA 4J01A 1YRNA 1SANA 2WADA 3QYFA 2DQRA 1KA8A 2LLKA 1IRXA 4LK1F 3ZN0A 4B3XA 3ERED 3KPHA 4K2EA 4KT5C 3HM5A 3M8EA 3C2BA 1SD4A 1J0RA 3MZYA 2LBFA 1XCBA 2Z16A 1GXPA 1GVJA 1P7IA 2JRTA 4DZJA 2BHZA 2DU9A 4MQVA 4A3EJ 2K40A 3WTSC 3HUGA 4E70A 2DMPA 3B6AA 3BPXA 4JP0A 5HS8A 2CGPA 4L0YB 3A0BC 4NDLA 5CJ9A 2K27A 3K7AJ 2YS9A 2K3PA 2HYJA 4BDZA 4NQWA 4BUPA 2HDDA 4FETA 2P7VB 1MBHA 2DPUA 5CVJA 3OIPA 2EZIA 3GYHX 3TMOA 1ZREA 3L2UA 2LDUA 1RIOH 2NS0A 3LSHA 4I99C 3TEDA 2KZGA 4IHTA 4M3GA 2GZWA 4YIFA 2L9SA 1JE8A 4ASNA 2VQLA 2VB6A 4FTHA 3KEOA 4EJVA 2WBMA 3F23A 3PM1A 3HXLA 4E7KA 2JUGA 1H8AC 3TO7A 1TWAJ 2CQQA 2RAEA 4UVCA 2ZFUA 6PAXA 2V9VA 5M3MJ 4KYWA 3FXKA 1OISA 2A5WA 2XGEA 4A2UA 2HOTA 3PSIA 2W25A 3KP4A 2LF7A 4N9IA 4U0WA 2MD5A 3G71I 2Y30A 1KQ9A 1R5GA 1XDUA 2A07F 1W5SA 5DS9A 3S1RJ 5E8IA 3V7SA 4CZCA 1SD7A 1WQ2A 3CCLI 2KDZA 3BR5A 3MMYB 3JREA 3MAJA 2PMUA 4HYEA 3CO7C 2CRGA 4JQFA 4BQNA 2L7FP 1YHQI 3CUQB 2WV1A 3VSLA 3S3NA 2DDAA 2NYXA 2NOGA 3C7JA 1X2NA 5EYRA 4DZPA 2VOOA 1TNSA 3WE3A 1KQ0A 2IA1A 2K5CA 3CJTB 4RB0A 1SFUA 1EF4A 4II2A 1D1CA 4LOCA 2DK8A 4FASD 1H9GA 3F22A 3QPTA 2LMDA 1HKTA 5LLQA 1I6HJ 4YIIA 1FYLA 1OR7C 5GAGJ 2HKOA 1YFHA 2VE8A 2W1OA 3JSOA 4Q48A 3HDDA 4JX4A 2DA7A 1FOKA 1TT5B 5FLMJ 4Y17A 3HPHA 1OYWA 5IY5H 2O8KA 1X1CA 2R7VA 2LBFB 1FYKA 4Y33A 1ERDA 1YO5C 1TBXA 2FMLA 1P92A 1VNDA 3OYAA 3JTGA 1VQ4I 1BOBA 3ONQA 2EZLA 3H9GA 1XDSA 1ULYA 3E6MA 4RM2A 3OY9A 2X6XA 4UB8C 1OCCH 2FNAA 5BPIA 3V8KA 3WHCA 1FNNA 3WGGA 3OYMA 5LEJA 2X1DA 4XLEA 1SMYF 1ZRCA 1YI2I 2CS3A 2A05A 3A0HC 4RMNA 5GPAA 5IP7J 2ESNA 2XF7A 2VBYA 4CO8A 3BR1A 4PZJA 5GADJ 4LMYA 2EZHA 2ACJA 4ANJA 4DOZA 1ZR4A 1BR1A 2OCCH 3M8FA 3K0LA 2QA4I 4IHYA 4G6TB 1S7AA 4RGRA 1W0UA 1PUFB 4M71A 3DF8A 2VPRA 1Z3YA 4GYIA 1FLIA 3WGHA 3VOEA 2QSGX 2ZFWA 1JTXA 5TRDA 2KMUA 4DIQA 4FE7A 1IZ1A 2F48A 5GP9A 2W57A 4M6YA 3FISA 3F21A 4PJ0C 1W7PD 2QVOA 2ZMEB 4A6DA 3E0JB 4I02A 4RGUA 5TJJA 3HL2A 3S1MJ 2BOLA 4GFBA 4UY8I 2IA2A 3BLYA 1JKQC 2TDXA 1MDMB 1VZ0A 4X0GA 4W97A 3JRGA 2B9SA 2E5ZA 4EJWA 3IWFA 1O3SA 1Y1VJ 1K7AA 3BCAA 2E2HJ 1PVEA 1TWHJ 3AG4H 1T8IA 3I59A 2HTSA 1SFOJ 1QVUA 2BGCA 2L4MA 3RKXA 3SFZA 1IW7F 3CDHA 5D4RA 4HQMA 4HF0A 3EUHA 2KT0A 1MMGA 1UHSA 1T56A 4F93B 1Z1DA 3H5AA 4BAYA 1K4SA 2VI6A 2CO5A 3ZPLA 4M74A 2LFBA 1Y39A 3C2GA 5J47A 4UVAA 4F55A 2LNBA 5FROA 3F3XA 1OFCX 3DBLB 3QRFF 3CTAA 1W36D 2BY1A 2ZMEC 4C9YA 3EUAA 3W2AA 5JI6A 4RLQA 4DYCA 3KP6A 2JK3A 2KIFA 4AIDA 3BT9A 1YRNB 4OWRB 4QTRA 2IGKA 3SJMA 2PEXA 2I10A 3K70D 3K1PA 2XF6A 1S8NA 4RB3C 2XPWA 4CSWA 5FO5A 5HVQC 2O61A 3GTKJ 2VN2A 3HKZA 2UUZA 1YS7A 2W85A 1SC7A 1A35A 2Q1ZB 4HAMA 1IRGA 5C4XJ 2LK2A 1S72I 3O2PE 3DKWA 1EJ9A 4DYRA 3SXYA 5D6FA 1W4MA 3PNYA 2NVUB 3K6GA 3JRFA 2PMZN 2BYVE 2W4SA 3M1CA 4L5JA 1BR4A 2JA5J 2ID3A 3BTJA 3BZ6A 3MCZA 1P4XA 4I0BA 4OIRF 1QU3A 4OMYA 4QPOA 2AXTC 1HSTA 3ABLH 3KEYA 1OKRA 1V3FA 2RREA 5IT3A 1KQ8A 2BE5F 2XGDA 5J1UA 3VEPA 3CCRI 4EJUA 1QO0D 3AG1H 2JT1A 1PYVA 1K6YA 2MC3A 1Y8RB 3QQAA 3WG9A 1T0FC 2EFQA 2K9SA 5FKLA 5K1YA 1MNDA 3DV8A 4ZTJA 2ZMEA 3TOAA 5K7HA 3Q0UA 1RUNA 3G1LA 1D5YA 1E0EA 2D1HA 2FBIA 1SAUA 2LY2A 3L2VA 2ZJRF 2Z9OA 1DU0A 2QUFA 4IOCF 4U0YA 5AIQA 1ZLKA 5HDKA 1VTNC 3S32A 1KU7A 2QQAA 3TW6A 1LFUP 1KGSA 1W7PA 2BXZA 5LRRA 3HPGA 2H1LA 3CCYA 2E71A 2P8TA 5ICEA 2AO9A 4M3FA 3CD6I 3GWZA 1ZQ3P 2DJIA 1R22A 3I4NJ 5F08A 2DYSH 4NC7A 2CUEA 4D9JA 4PGGA 4KIFA 9ANTA 4F7ZA 2BHYA 3BR2A 3HGYA 5K5RA 3FBIB 3PIPF 1LVKA 2FRHA 2KJCA 3N05A 2ZB9A 4IF4A 2FMYA 1NG7A 1G4DA 2E7WA 5F6FA 2ZC2A 2VASA 4RAGA 5HS7A 3TL4X 2K9QA 4EGYA 3GTQJ 1IN7A 3FKIJ 4IJAA 5EJCA 5CVIA 1R00A 3RYRA 2DXIA 3CMAI 2M30A 4CDGA 5AIPA 1D8KA 2Q2EA 2DMUA 1RKWA 3H0GJ 2M2EA 1ETQA 1XTAA 3BWGA 4UV8A 1G3WA 2EIJH 4CHUA 3FXMA 4UV9A 2GAUA 1FJLA 1DPRA 2M4KA 1V5EA 2F5EA 4ABZA 1AA7A 1G59A 5M3FJ 3H1CA 1R4MB 1WZ2A 3LA2A 3H3VK 1X1AA 3QYEA 3JW4A 1O57A 2CU7A 3OSFA 2BY3A 4HV6A 4DBQA 4KICA 3FKJA 1QGPA 1TLHB 4YG2F 2R7SA 2Z5UA 3P9CA 1QPMA 2PBIA 2IRFG 1U9OA 5GAHJ 4HV5A 3B02A 1VQLI 4WXCA 3HOZJ 2OAZA 3H3UA 4M6VA 3S2HJ 3S15J 2GBYA 4KDPA 4NNJA 2I5UA 2KLOA 4BNCA 1B9NA 2XRNA 2WY7Q 2IPQX 1D8JA 5D5WB 3J80K 2YPRA 4B09A 1XCVA 2XPVA 3HOUJ 1H89C 2QQ8A 3DPUA 3CCUI 3FZVA 4XKBA 3T1BA 3RPQA 2JMWA 5K5OA 3FK7A 2Y9ZA 2JA7J 4EM2A 3DBHB 2DK5A 1B6AA 2GA2A 5J1YA 2M1BA 5DTDA 4BXUA 5HLIA 1H0MA 4PK4A 2A5YB 2K85A 2DDBA 4M9XA 2R5YB 3CCEI 3VYRB 4HW0A 3J80Z 2M8EA 4AIHA 1CGPA 3JRIA 1SFKA 2FE3A 1VQ8I 2FQ4A 1JXSA 2V6CA 4KMUX 2M5WA 1J7KA 2RV8A 2E60A 2B7EA 2YU3A 4XSXF 1Z7LA 2G7UA 3PFIA 3HJEA 2VBWA 1R7JA 3FMRA 4MFDA 2ZXWH 1NK3P 1XSXA 3LSIA 3AAFA 2DOEA 4OMZA 4HDUA 2QBYB 4B3AA 3EDPA 4LB6B 2FJ1A 1FSHA 3DKXA 4CCJA 4UUSB 1AWCA 1YG2A 3RPUD 3OYBA 3RI4A 3ZMDA 5EEHA 2W00A 2HWVA 3S2WA 4ZC3A 2JSCA 2DODA 4XRMA 4NQWB 4CXFA 1QNTA 3IHUA 5HODA 3DPTA 1R5HA 3FBNB 3RSNA 2IBDA 4UNOA 1F5TA 4BHCA 3M7GA 4WXDA 4PJJA 4LK0F 4EM1A 2W82A 1F36A 1LDDA 1MBGA 5KAIC 3DLLF 4BJ6C 3HZJA 4MFEA 3VSKA 4Q4ZF 3GTGJ 4M3DA 3I9V2 2E19A 4ZYEA 4E7IA 3K1NA 3TDUC 5K5QA 1MDMA 1CF7B 2XKOA 4CYCB 2FOKA 4XQFA 1ACIA 1X3UA 3ZXSA 2KP6A 5IP9J 2TCTA 4GGGA 2R4GA 3H9JA 2HFHA 3WTWC 3I59B 4PSWA 2M9HA 5L3FA 2ZCWA 1S6LA 3TGNA 1L3LA 3K10A 1YJ9I 4WF2A 1E2XA 5FKNA 5BS6A 1MSFC 5CVRA 4KFCA 2M8GX 1FIAA 1KYZA 4IZZA 2J5OA 2BY0A 2RDPA 2GXBA 1ZRFA 1T33A 2JPCA 3CC4I 4C2UA 3EUKL 3W6KB 2H6CA 1Z6RA 3H5RA 4M9ZA 1ON2A 2XAGA 3LAPA 3CUQA 4OIOF 1NHAA 4IOAF 5F64A 2QLZA 3J7AO 5FRNA 5FRMA 2HGCA 3LSMA 3HOSA 2M4GA 3C1DA 3COAC 4BYYA 1TP4A 1XX5A 3DWLE 3QPLA 4U0VA 4BH9A 3KEQA 1AU7A 1FPQA 3MKZA 1FZPB 4YFXF 3LA7A 3JRBA 3ECOA 3BQYA 4NUBA 4Y3OA 4AIJA 1D3YA 3MKYB 2OQGA 4FISA 5CPRB 3OYEA 2CW8A 1JGGA 3OYHA 3E3VA 2W7NA 5BQTA 1Z6TA 2RC4A 5D8LB 3MD2A 1W5CC 4LITA 5JLXA 1IXCA 2R92J 3KETA 4Y7NJ 1FP2A 5ILUA 3KFWX 3ZGKA 2F4OB 2HR3A 4BKXA 4DQ2A 3K4KA 1BC7C 2ISZA 4E6KG 2JRMA 1TW2A 1X4PA 4N0BA 5J40A 1BW5A 1U5TC 1YX3A 4AC0A 1R71A 4BXXJ 3FXOA 5DUIA 2FBKA 3ZP5A 3B73A 1T08B 2XGXA 2HOEA 1I1SA 2V1XA 2V9KA 3I55I 2W84A 2YX4A 1OJLA 1IV6A 3ABTA 4MTDA 4BE2A 4D5CA 5IYDJ 2GM4A 3FDYA 1HKSA 2OF7A 3O6BB 1S5LC 2NRAC 4MEYF 3CJNA 4LD5A 3JCUC 3QOEA 2DI3A 3HBLA 3P5JA 1Y0UA 3WTXC 2ETHA 2NAZA 1U3EM 2H8WA 1SD5A 2AHQA 2JWTA 1FSEA 2HVRA 1APLC 4LG0B 3A4CA 3AG3H 5DD8A 3FM3A 3GMEA 3V42A 1Y8QB 3K1MA 4PJMA 3BC8A 2WC2A 5DCMB 2BW3B 4KN7X 3P9KA 3DEEA 2Q2EB 2IS4A 1JUSA 3R61A 4NBQA 4XMYA 2VJIA 2LH9A 2MLKA 3Q9SA 4LB5A 1R5ID 1YYVA 5DDGA 1I5ZA 5IPAA 1MJ9A 3ABUA 3DXJF 4P5OA 3WTVC 3CCQI 1XMXA 4HLYA 3F0CA 1TQMA 1XSDA 5K7FA 1U9NA 4IX7A 1R58A 2R3SA 2L9RA 5C3EJ 1ZHFA 3JRHA 2DLLA 2K3FA 5M5YJ 3VFZA 2PJRB 5FFZA 3SYTA 1IRFA 1FOYA 1X3WB 4OU0A 5FD5A 2TRTA 2O6GE 2CV1A 1MH3A 1IAWA 1YJNI 4U87A 5JHFA 2VQCA 3GZNB 5J6XA 1U5TB 1YE9A 2VXZA 1U5TA 1J2XA 3RPUA 3A02A 3CLOA 4IVNA 2IVMA 3W2VA 2XAJA 3A01B 2F6CA 3A01A 1RR7A 3GEZA 2MD0A 1X2MA 4G6DA 1I39A 4IKFA 3PSFA 4GYGA 3OS0A 4AM3A 2DAOA 1DGWY 1MKMA 4XLFA 2VPLA 3EPZA 1LKXA 4HEA2 4IXAA 4BY7J 3TKYA 5JVTA 1GT0C 3GTPJ 1IN6A 4E7SA 2G9WA 2HKXA 2OCEA 4BQOA 3NAUA 2KPMA 3DEWA 1BI1A 1BR2A 1NTCA 3VB2A 5B1AH 4S0HB 4PJLA 2QQ9A 3MEXA 1O4XA 4E4HA 3HOVJ 1O7FA 2GWRA 1UJ8A 3LWFA 1TT0A 1VQ9I 1ENHA 2O7OA 2R0QC 2ADUA 2L9NA 1B72B 1JKPC 1FYMA 1VQNI 1P6RA 2ZXJA 3GFMA 3SDGA 3C3WA 3I3LA 1KZHA 3QODA 3L1PA 4E7HA 1ZKGA 2LP0A 2AXLA 4HPQA 3L2CA 4WXHA 4AU7A 2F5CA 2HXIA 2M0MA 3WU1B 1HOMA 4EM0B 3PFYA 2QCOA 1SVLA 3OYFA 5FLXK 2IA0A 1FIPA 2WAQN 2KQRA 2Z33A 2P6TA 4I76A 2DA2A 3GO5A 5E18F 1RRJA 1XMAA 3F8NA 2CH0A 2HVQA 1YW9A 4KIGA 4C2MJ 4RB1A 3R4KA 1LB2A 1RKTA 3S8PA 4XRSG 2R7WA 2WAFA 1KU2A 4IPAA 3BPVA 2QBYA 3Q0WA 4DBRA 2COBA 2AQFA 3L2WA 2P6SA 1H88C 4CYCA 1E3HA 4YIRX 3LSKA 3H3ZA 4G7OF 4CGZA 2O9LA 5BPDA 3DFGA 3DLAA 5DD4A 2MYSA 5L3DA 2H6BA 4LFUA 4B8XA 4M72A 4ENNA 1WSUA 1JJ8C 2Q0OA 1RR8C 2X85A 2PJRA 1G6NA 3PNTA 2IGNA 3W2WA 2XB0X 5EZHA 2K9MA 4D7NA 4F3QA 3T5XA 1Y0NA 4IEJA 2HDCA 5TGTA 5JR3A 3JRCA 2KKOA 1OCRH 1MSEC 1K78A 2AS5F 2P4WA 1UFMA 2J5PA 4HNVA 3ECHA 3OIOA 2HTJA 3WTYC 1K78B 3KIOA 1XS9A 3MFKA 4ESJA 5FB2A 5CQEA 3R0AA 3PQJA 3CCVI 1OYYA 2WV0A 1K79A 5GAEJ 3ERMA 1JKOC 1P4WA 2H1KA 2E1CA 3BTCA 4MO7A 5FGMA 1H9TA 4OAYA 3RQ4A 1LQ1A 2A69F 4L0ZB 1VQOI 2EK5A 3OL4A 1HF0A 2BZTA 1RZ4A 2VXDA 4PSXA 2HEOA 1E3OC 4EJOA 2ESHA 1Q1HA 4R8HA 1HQCA 2RVCA 4M9SA 4HOBA 4ZJZA 4IRHA 2CW7A 2IJLA 2VKDA 3HRUA 2ELKA 2KIQA 5HDGA 1VQ5I 2PG4A 2JA8J 1IG7A 2X4HA 3TO9A 3A1YA 2CV0A 2OV7A 3L7WA 5FD6A 2XF5A 1KYWA 1WJFA 4II3A 1X3ZB 4AIKA 3RZDJ 1S29A 3MZHA 4I7HA 5EEAA 2LREA 1G3SA 2FF4A 1RPWA 3J7AY 2DW4A 3QP5A 5M5WJ 4A3FJ 4S05A 2EINH 3ZN1A 2EQRA 3UR3C 3S3OA 2WB1N 4C3JJ 2EZKA 3DKYA 4ENKA 3BP8A 3IKTA 1JHFA 3V8JA 1FP1D 1SVMA 1T6SA 3LSGA 2ZSHB 3AL0C 1TQPA 3CMYA 2DT6A 3K4MA 2DMTA 4BQQA 5JLWA 4ZYDA 4C3HJ 2R7OA 5LGNA 2EBIA 3E1SA 3SEZA 3VYTB 1IXSB 2EFWA 1OLTA 4C2TA 4UXNA 5CYVA 3CJQB 4G6QA 4LG0A 1MBJA 2IXSA 2K9NA 1BBYA 1R6RA 3ZQFA 4HNUA 1W7PB 1T38A 2JVHA 1S7EA 4LLLA 3ZQGA 2CQXA 2YX7A 2D2WA 3BZKA 1FBUA 1I3QJ 1Y56A 2Z99A 4KA4A 1JKRC 2V7FA 1QZYA 3HRSA 2KFDA 5E3NA 1XSVA 4KNYA 2F2EA 3WTZA 1SAXA 3M4OJ 1ETXA 1T98A 4RA2A 1VQMI 2VUMJ 2MGQA 5E1XA 3ZMTA 1TW3A 4Z2YA 3J7ZI 1ZTRA 2O3FA 4BBRJ 4IO9F 2HQNA 5GTHC 1Z3XA 4C3IJ 1IDZA 1PUFA 2Y69H 2WAQA 2VC1A 2XIGA 3RKWA 2Y0MA 3HTSB 3FXUA 4Q47A 4XKVA 3U21A 3S93A 3VODA 2P5KA 3OR1C 1DGRM 2QWWA 2JPBA 4LLNA 2XAFA 1I3AA 2EILH 2E7XA 4HX7A 4IRGA 4LIUA 4HNTA 3EUHC 4GCVA 2VKHA 3C18A 2GOMA 1VI0A 1JI8A 5EDNA 2X9DA 2H8RA 4L9NA 4BXFA 1YW8A 2VBZA 1RETA 4I6ZA 1ZRDA 3DQVC 3FXQA 2O03A 2KJBA 1J9IA 1JTYA 5E20A 2DBBA 2DA1A 4BBSJ 3EETA 2ME6A 5LGTA 5D8KB 4V19K 5CQGA 1VFCA 4RAZA 1ZYRF 3V8LA 2KRHA 2A61A 5F1RA 2DTZA 1ZR2A 2LTPA 3HEFA 1TNTA 3I5UA 4RS8A 5ERIA 2ID6A 4NB5A 5L3EA 5IOYA 4BY1J 3OWTA 1EA3A 3FM5A 3ZQ7A 2IW5A 4XLPF 1OQYA 1BJZA 3IUOA 3PIOF 3G6EI 1VQ7I 4N9HA 5AONA 3KZIC 2VQGA 2P5VA 2A6TA 5D4SA 4P1WA 4XBFA 5E17F 3G2BA 3GCMA 4BGDA 5EGOB 3SZTA 3IH4A 3OYJA 2HPIA 3LNQA 3F72A 2MABA 4GDFA 2PN6A 5B5EC 1HXDA 1OCOH 1DP3A 5DEQA 2MLGA 2QSHX 1Z21A 3SZGA 1G8XA 1W1WE 2PFBA 2HZTA 3U1DA 3CO6C 1O3TA 1FEXA 1IV8A 4OAZA 2XROA 4AYBN 3CC7I 3RKYA 1JT6A 5J8FA 4JK1X 3KZZA 3O8HA 1D1BA 2RQPA 5TISC 4HDVA 1B8IB 2K4BA 2Z3YA 3HC7A 3RTRA 4DNCA 1Z05A 2RNJA 3RJPA 1A04A 1T2KA 2KZVA 1ZAOA 1HKQA 3Q5FA 1HC8A 5BMZA 3S2DJ 2DT5A 1B9MA 2LC2A 4B47A 1U8BA 2PLYA 4F52A 1IRZA 1ZGAA 3TOBA 4QLCU 4FX0A 3ZQCA 3E6CC 2CV2A 1IDYA 3BTLA 4L5EA 5LHIA 1WCMJ 2VJ4A 2DFHA 3V7RA 2B63J 2ISYA 5CVUA 4V2GA 3HB9A 1FMVA 5HOOA 2CJJA 4XKWA 5F27A 1ZN2A 3FHNA 3BCBA 5H6QA 3VYSB 4CUGA 4YFKF 4E7ZA 2H09A 1S9HA 2K02A 2JZYA 1ORKA 3OOUA 2XASA 4TV7A 2NVTJ 2M87A 1O3RA 4JX6A 3K2ZA 5FJ8J 1REPC 2DA4A 4AVZA 2A6HF 1B4AA 4XLCA 3T8RA 1FC3A 4A6EA 4ZZDA 3HOTA 4G94A 2L7MP 3DPLC 1HDDC 1I50J 3IP4B 4M3EA 2HYGD 3UNGC 1HLVA 5J8CA 3CCMI 2CQ7A 1U8RA 1BI0A 1VF9A 3LFUA 1K4TA 1UG0A 1D1AA 2M34A 4XRSA 4C30A 4RGXA 3RYPA 2FA5A 4F91B 3M8JA 3PUBA 3JRDA 1QBJA 4Y13A 3OYDA 1UCRA 1GXQA 2V79A 2X6YA 4XONA 4MLOA 3ML6A 1MZBA 1WGXA 3ZMZA 2ICWG 3D1NI 1FTTA 5B1BH 1PJRA 3KE2A 3QWLA 1X1BA 4XK4A 1O3QA 3GTMJ 2ZJQF 1G3YA 3OYIA 3BG9A 1HW2A 1WKMA 2DTRA 4H4KC 2DQLA 4KMFA 4HF1A 2IS6A 3WTTC 3BOQA 1OMIA 1ON1A 2NS8A 4LG3A 1A36A 4YELA 2XRLA 2E1MC 4KIBA 2HXOA 1XGSA 3LFKA 3E6BA 1XB4A 2FX0A 4L9JA 4J00A 2NVXJ 3Q9VA 2VKEA 5E79C 3E97A 2LKSA 1QZZA 1V5GA 1LEBA 3OL3A 4P9FA 2E1NA 4A0XA 2IS2A 2L4AA 2XHKA 4G12A 3MQ0A 4BS9A 1LVAA 3H36A 2D45A 3SZPA 4BQAA 1XG1A 2L54A 3UKGA 1DPUA 3GUDA 5FFXA 1B8IA 3CF5F 2V1DA 3I58A 4WX9A 1X58A 1D0ZA 3K4LA 3GTOJ 3HG9A 4R1HA 3BR6A 3HTUA 4L9TA 1AKHB 4KITB 3ZRGA 1BL0A 3LOCA 5E3LA 2VKVA 3QAHA 1L0OC 3LQRA 2CYYA 2G0EA 2P81A 2WTEA 3ABKH 5J4YA 4ZYGA 3CZ6A 2O8XA 1OCZH 4X6AJ 3DBRB 2Y0SN 3SDBA 3L00A 3HSFA 4AYBA 5B3SH 3IL2A 4RDUA 4B44A 2YUSA 4V2FA 2F5DA 3D5LA 3I54A 4KJZA 1T39A 1FX7A 2E1OA 2FQ3A 2XPUA 1WVRA 3GW2A 5LBQA 5HLGA 2UZKA 1OCTC 1IO2A 1E17A 4A0YA 1WHUA 2X48A 3BR0A 2XSDC 1YIOA 1ZH5A 3PJRA 2LG4A 5LD2C 4PFPA 1T95A 2R5ZA 1MW7A 3MN2A 3TBIA 3OMYA 2MFZA 2R5YA 3K9TA 1JHHA 1TWGJ 2QM3A 4H0EA 4XLHA 3CP2A 5FKKA 1BC8C 4RAFA 2E5NA 3SHFA 4BHPA 2FNPA 1K6OA 1MJAA 2BW3A 2BV6A 2L9VA 5F1JA 2ELHA 4CZZA 2EV5A 2LY9A 4RAYA 1PP7U 4QPQA 2MC4A 3Q0VA 2OQRA 1RC9A 3MKWB 3AFHA 3E5UA 3IRQA 2VLAA 2E34A 4Q5SF 1UELB 2HOSA 1B59A 3CUQC 2OZUA 1CQTA 2IT0A 3LMMA 4OINF 5H2FC 3G4SI 2STWA 2OBPA 2JA6J 4Y52J 2MA3A 2KRCA 4ZTFA 1WJ5A 5DUKA 3E5QA 1Z67A 2DFEA 3HHGA 2LVSA 5D5UB 3CP8A 2MH2A 3OYCA 4BEHA 1J09A 4A3GJ 5DM7F 4BEHB 2LY1A 4QWQA 3ISPA 4A5NA 3CESA 2FBHA 3D0SA 1HA8A 2EIMH 3F8MA 4ZDOA 1YW7A 3J81Z 3KP3A 1F4KA 4U88A 2XV4S 2B0LA 3HKZN 1GUUA 2X6OA 4HSTA 2PMHA 5C4JJ 2DA3A 3QPHA 3A03A 4UB6C 5KVRA 4BE1A 4ESBA 1I6XA 2FOWA 3WGIA 1CF7A 3AKZA 1LEAA 4N4OB 2A68F 2DOFA 4YFNF 2R7XA 4A3BJ 2EV6A 2IP2A 3OSGA 5FLVA 1KONA 2N8GA 2I8DA 2R7QA 2ZJ2A 2DOAA 4G7ZF 5KAFC 5D6EA 1TZLA 2CUFA 3ESWB 3ELKA 3ZQQA 4A5MA 2BY2A 2E36A 1RNLA 3HOWJ 2M7BA 4UUVA 4A3IJ 2M45A 2WA0A 1DDNA 3VWBA 2Z1DA 4W1UA 4AUXA 4ESFA 2EFPA 1U2WA 4KN4X 2DCEA 1R1UA 3JAMZ 2HPMA 4DGWB 2H94A 2X6WA 1U78A 5IYCJ 1A5JA 3TP0A 2DO7A 1X19A 4XM3A 2NNNA 2V1NA 4I0AA 3RIRA 3SEQA 4G9YA 2LKPA 3NRVA 2R5ZB 1YIJI 1N78A 5IT9Z 1IJWC 2V6EA 3WODF 3F8BA 3GBGA 3TP3A 3BR3A 3X2QH 1GHCA 3G73A 1U0JA 5BOXA 1MNEA 3QPSA 4IHXA 1S7OA 4MTEA 4MNUA 1AKHA 4ITVA 4A93J 5L3GA 2LRDA 4EATA 2A3SA 5H20A 3F8CA 2P5LC 3EYIA 3CQZJ 1QZEA 2MSYA 1UAAA 4IHSA 1UHWA 1D0XA 2JSPA 3D5SC 4XORA 3WHBA 3GLLA 2D5VA 2QYOA 1MMSA 2L2OA 4MHGA 2FD5A 3GZ6A 1P7JA 2K86A 3D5RC 4I09A 5E3OA 3CC2I 1QA6A 3DTKA 1WJAA 1JUPA 3QP6A 2FSWA 3ROUA 3QOPA 2ZNZA 1G3TA 4JYKA 2NS7A 2XUBA 3KYLA 3IC7A 4L5IA 1UZCA 3H0DA 4P96A 2R93J 3U9GA 4NHJA 2LSOA 4CCNA 3GX4X 4QSHA 3V7CA 4O3MA 4GRIA 3P9IA 3PNVA 5EEGA 3NWTA 4PCQA 1DP7P 1XD7A 2CW0F 3EQLF 4JX5A 1P9QC 2X51A 2IGOA 1FMWA 2XVCA 1ZLJA 2VT3A
chains in the Genus database with same CATH topology
3CJQB 5HLTA 4XN0A 3OYLA 2IXSA 4DBQA 3BG7A 3FKJA 1R6RA 4HNUA 2R7SA 4XR6A 2JVHA 4CA0A 2PMZA 3W3CA 1Y56A 2UWMA 2CUJA 4R79A 2V7FA 1QHHD 5HNHA 4HSRA 4XOTA 4NNJA 2KLOA 2WY7Q 1LFPA 4Y4RA 4BE0A 2HNHA 3K4NA 3DPUA 2GOXB 4XKCA 3VYUB 5CKTA 1Z3XA 4XKBA 4E7JA 3RCOA 2WAQA 2KL4A 4KISA 4BDYA 4XKVA 4ZDPA 2Z2SB 3S93A 3U21A 3OR1C 4PK4A 1DGRM 1ZELA 3VYRB 2R7RA 2CFOA 4CCKA 1SFKA 1GLNA 2DT7B 4LIUA 4HNTA 2M7AA 2E60A 3EUHC 4JOMA 2VKHA 1Z7LA 2GOMA 1MMNA 1JI8A 3LSIA 4BXFA 3DU6A 2R7UA 3DQVC 3DKXA 4CCJA 3ZCOA 3RPUD 2JA2A 4NC8A 2HQAA 3OYBA 5CQGA 5KCMA 3OS2A 1N75A 2LYCA 2W00A 4RM3A 2LOOA 4ZC3A 2KRHA 2ZSIB 5LFAA 4NQWB 3H9QA 4CCMA 3DPTA 3FBNB 3OWTA 1EA3A 3RSNA 2HZDA 2Y0SA 1YX5A 3OYGA 1X4OA 2P0WA 3IUOA 2V26A 2K9LA 2VJ5A 4J01A 2WADA 4PJJA 3IAM2 3QYFA 2VQGA 4C2TA 2W82A 2A6TA 1IRXA 2WB1A 4P1WA 2M3AA 4B3XA 4RLFA 1DQUA 3G2BA 4BJ6C 4BGDA 2LBFA 3OYJA 2Z16A 3VSKA 2HPIA 3I9V2 2MABA 4E7IA 5KNLA 1DP3A 1Z21A 3SZGA 1G8XA 4XQFA 1Y6IA 3QYBA 3ZXSA 3CJRB 2KP6A 4OAZA 2R4GA 3H9JA 4PSWA 4XLAA 3S3MA 2K3PA 1D1BA 4BUPA 4BDZA 4FETA 3K10A 3HC7A 3RTRA 3DU5A 3IAS2 1NG6A 3OIPA 2KZVA 3TMOA 4IZZA 2L7KA 3L2UA 4BJTA 4BACA 2QKLB 2LC2A 4B47A 3LSHA 4F52A 3L2QA 2VQHA 2BVLA 4C2UA 2L9SA 3EUKL 3H5RA 2CV2A 2VQLA 2VB6A 2WBMA 2VJ4A 3HXLA 4E7KA 2JUGA 1FMVA 3K4CA 5FRNA 5HOOA 3LSMA 4XKWA 5FRMA 3HOSA 2M4GA 3FHNA 3C2HA 2ZFUA 3BCBA 4U7BA 3DWLE 3VYSB 2VL8A 4CUGA 1MMDA 2RNGA 4XN3A 4E7ZA 3MKZA 1S9HA 2JVGA 2A5WA 3OOUA 4NUBA 4Y3OA 3H35A 1QHGA 3MKYB 3OYEA 5CPRB 2CW8A 3PSIA 2KHMA 3OYHA 2W7NA 4AVZA 3HOTA 4XLCA 2XAUA 3MD2A 3DPLC 4LITA 3IP4B 3UNGC 4CZCA 3MMYB 3ZGKA 2AQEA 3LFUA 3K4KA 1UG0A 4E6KG 4BQNA 4JQFA 1X4PA 1D1AA 1YX3A 3VSLA 3S3NA 4C30A 4F91B 2X1CA 2V9KA 3M8JA 3PUBA 3PL8A 1WFXA 2K5CA 2UV1A 4II2A 4YRVA 1D1CA 4BL0B 4FASD 3OYDA 2X6YA 4XONA 4BE2A 4MLOA 1OR7C 2W1OA 3FDYA 2ZXIA 1PJRA 4IQ4A 3KX2A 1X1BA 3QOEA 3OYIA 2KDOA 3HPHA 4H4KC 3K4JA 1X1CA 2IS6A 2R7VA 4XL9A 2V4JC 4LG3A 2LBFB 4YELA 4Y33A 2E1MC 1ERDA 2O5RA 2WAEA 4J00A 3OYAA 2HVRA 2OUMA 3A4CA 1BOBA 3ONQA 2F4IA 3H9GA 1V5GA 3V42A 3OL3A 4PJMA 3OY9A 2IGMA 4RM2A 2IS2A 1X1DA 4XOPA 2X6XA 4LIVA 3BC8A 2BW3B 4BS9A 3DEEA 2Q2EB 3OYMA 2IS4A 4XMYA 4CCLA 2F5VA 2VJIA 1MMAA 2X1DA 2LH9A 4XLEA 2BVMA 2CS3A 4YEJA 1D0ZA 3K4LA 3HG9A 4RMNA 2XF7A 4KITB 3ZRGA 4P5OA 4CH7A 4ANJA 4DOZA 3CZ6A 1BR1A 4IX7A 3SDBA 4PFOA 4N4NB 4AYBA 2NOJB 4G6TB 4B44A 4BJ5C 1Z3YA 2PJRB 1WJEA 3D5LA 4KJZA 3SYTA 2CV1A 3L2RA 2KMUA 2ELJA 4U87A 4DIQA 5JHFA 2VQCA 2CMPA 2E1MB 1YE9A 2VXZA 2HDWA 1WJBA 4E7LA 3E0JB 4F92B 3HL2A 3W2VA 2BOLA 1WJDA 2F6CA 2LG4A 5LD2C 3PJRA 3BLYA 4PFPA 3OR2C 1T95A 1VZ0A 1MW7A 2MD0A 4X0GA 3TBIA 4HG2A 2E5ZA 3OMYA 2MFZA 4IKFA 3PSFA 3OS0A 3HUGB 1DGWY 4XLFA 2VPLA 3EPZA 1LKXA 4HEA2 3BCAA 4XLHA 3CP2A 2E5NA 4E7SA 2BW3A 4BQOA 2KPMA 1V5FA 3DTIA 4QPQA 2MC4A 1BR2A 3MKWB 1MMGA 3AFHA 4F93B 2VLAA 4PJLA 3H5AA 4IQJA 1UELB 2RQQA 4E4HA 2QKMB 2XSJC 3LMMA 1TT0A 3C2GA 2L9NA 2KRCA 4F55A 3A2KA 4ZTFA 1WJ5A 5FROA 3I3LA 4HRIA 3QODA 4E7HA 1D0YA 3CP8A 1W36D 4C9YA 3OYCA 4BEHA 3EUAA 4D1QA 1J09A 4HPQA 3W2AA 4RLQA 4BEHB 2LY1A 4AU7A 3CESA 3BG6A 1HA8A 5HNFA 2M0MA 4ZDOA 3PFYA 3OYFA 3OYNA 2KQRA 4OWRB 4ZYAA 4HSTA 2IGKA 3VDXA 3K70D 2WY8Q 2XF6A 2CH0A 2HVQA 4CSWA 2VJJA 5HVQC 4PJNA 4BE1A 3HKZA 3S8PA 2UUZA 2R7WA 2WAFA 4BU2A 2XDVA 4CCOA 2Q1ZB 3AKZA 4N4OB 2R7XA 4DBRA 2AQFA 3L2WA 2IS1A 1KONA 3PNYA 3K6GA 3LSKA 2I8DA 2R7QA 2W4SA 3M1CA 1BR4A 2DOAA 2VIXA 3OIQA 1TZLA 3DLAA 2MYSA 3ZQQA 1QU3A 4QPOA 2M7BA 2HU9A 2X85A 4DJAA 3CF2A 3NWSA 2PJRA 3KEYA 3PNTA 2IGNA 2RREA 2WA0A 3W2WA 3DTEA 3VWBA 3H5NA 2K9MA 2Z1DA 4F3QA 5TGTA 2R7TA 1PYVA 1K6YA 2DCEA 1T0FC 2HPMA 2XC7A 1MNDA 3SEZA 4DGWB 2X6WA 5CQEA 4ZTJA 3ZR8X 1X19A 4XM3A 1E0EA 2V1NA 2L5QA 1SAUA 2LY2A 3SEQA 3L2VA 4B48A 1N78A 2OC6A 2V6EA 4OAYA 4ZDLA 3S32A 3GBGA 4PUSA 4B43A 3RQ4A 4KT6A 1U0JA 3HPGA 3OL4A 2VXDA 4PSXA 1MNEA 1N77A 2DJIA 2FUG2 4ITVA 2LRDA 4NC7A 4EATA 4D9JA 4ZJZA 3K4BA 3OYKA 3LL7A 4XNFA 2CW7A 2VKDA 1UAAA 3FBIB 1D0XA 2JSPA 1LVKA 3D5SC 4XORA 3N05A 2CUZA 2L2OA 3K70C 1NG7A 3A1YA 2CV0A 2OV7A 2XF5A 2VASA 3D5RC 3TL4X 1WJFA 4II3A 5KHDA 3DTKA 1WJAA 1WJCA 2LREA 2DXIA 3J7AY 2X1EA 2ZXHA 3F9KA 3KYLA 3OS1A 3H0DA 3UR3C 3S3OA 1W36C 2HVSA 3DKYA 1LDKB 4CCNA 3CMMA 2M4KA 1V5EA 1AA7A 4GRIA 3LSGA 2ZSHB 3PNVA 1G59A 3AL0C 3AL0B 3NWTA 2DT6A 3K4MA 1P9QC 4BQQA 2R7OA 2X51A 2IGOA 1X1AA 3QYEA 3E1SA 3VYTB 1OLTA 1FMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GOX B;  2JVH A;  2JVG A;  2WY7 Q;  2GOM A;  3D5S C;  3D5R C;  2NOJ B;  2WY8 Q; 
#chains in the Genus database with same CATH topology
 2HQ5 A;  1VQ6 I;  3OYL A;  1FT9 A;  4MQ9 F;  5DCM A;  1OPC A;  3HSR A;  3HRT A;  4MEX F;  3LSJ A;  4OIQ F;  2K7L A;  4XR6 A;  3PO3 J;  3PUF A;  1TQI A;  4CA0 A;  3KYC B;  4CYD A;  1DU6 A;  3W3C A;  2UWM A;  1YJW I;  4R79 A;  2PJP A;  1SVO A;  2KIM A;  3KP5 A;  2W24 A;  3PQK A;  2L02 A;  1QHH D;  2OD5 A;  3ULQ B;  5HNH A;  1W0T A;  4XOT A;  3JTH A;  5IT9 K;  2DA6 A;  4Y4R A;  3I71 A;  4UVB A;  2RN7 A;  2R7F A;  1FTZ A;  3AG2 H;  4L18 B;  2DPD A;  3LAJ A;  3K4N A;  4XID A;  5M5X J;  1IN8 A;  3NAR A;  5BNG A;  4XKC A;  5EF6 A;  3VYU B;  5E1Z B;  1POG A;  2KL4 A;  1P2F A;  4GXO A;  3L09 A;  4ZDP A;  4GO1 A;  2E2J J;  5D5X B;  3GTJ J;  1STZ A;  1I1G A;  3MZ8 A;  3QU3 A;  2HOA A;  2CFO A;  3K69 A;  3NQO A;  3KP2 A;  1QRY A;  4WCG A;  3R0J A;  5K7Z A;  2QSF X;  1GLN A;  2DT7 B;  2KIS A;  3TQN A;  1HW1 A;  2YU9 J;  3FMQ A;  2EWN A;  4JOM A;  2CQK A;  3OV8 A;  1MMN A;  5EGO A;  3GTL J;  2P7C B;  1UHM A;  1MNM C;  3E5X A;  3DU6 A;  3ZQL A;  5J1R A;  4JBA A;  2R7U A;  1Q1V A;  2COM A;  3GLX A;  1JUM A;  4L9V A;  3ZMV A;  1J75 A;  4P55 A;  3LA3 A;  4DYQ A;  2VOP A;  2JA2 A;  4NC8 A;  2EPF A;  3SFI A;  1ETV A;  5KCM A;  3T8T A;  3OS2 A;  1N75 A;  2LYC A;  4RM3 A;  2LOO A;  1W5T A;  5ICG A;  3S17 J;  3TO6 A;  2ZSI B;  1Z7U A;  1I27 A;  3CUO A;  3ASO H;  2X0L A;  3JSP A;  2HZD A;  3TW7 A;  4PDK A;  3OYG A;  1FWZ A;  3S14 J;  1X4O A;  5HDN A;  2P0W A;  3U1K A;  2OTJ I;  3RQI A;  3ZQH A;  2EFO A;  2OU2 A;  3IAM 2;  1LPQ A;  3ZMU A;  4O6J A;  1B72 A;  1Y1W J;  2WB1 A;  1SEU A;  2M3A A;  3PO2 J;  1MJB A;  1UG2 A;  4RLF A;  1DQU A;  4IHV A;  2R7D A;  3F8F A;  2JJ7 A;  2JTV A;  1ZGW A;  3GFL A;  2XAH A;  2BEO A;  2DJN A;  4HLX A;  3DCF A;  4HX4 A;  2E2I J;  5KNL A;  3OOP A;  4AD9 A;  5HLH A;  4S04 A;  4EEF G;  1Y6I A;  2DYR H;  3QYB A;  3CJR B;  2QGU A;  1KU9 A;  1GVD A;  4B4C A;  5LEK A;  4EJT A;  2VON A;  1LFB A;  2OPT A;  2STT A;  3HIF A;  3BJA A;  3J7Y J;  1R36 A;  4XLA A;  3IV5 A;  2Q8K A;  3FX3 A;  3S3M A;  1IN5 A;  4ZH4 F;  2QQB A;  5EG0 B;  3KLN A;  3Q3S A;  1S3J A;  1F9N A;  3E7L A;  2GIZ A;  5IOZ A;  1BI2 A;  3DU5 A;  3IAS 2;  2ZBK A;  1NG6 A;  4XSZ F;  3SQN A;  5ED4 A;  1SMT A;  2BXY A;  1ZAR A;  3FF5 A;  2L7K A;  4BJT A;  4FHT A;  1Z0X A;  2QKL B;  4FQG A;  4BAC A;  3J81 K;  2QF7 A;  1ZGJ A;  4XRF A;  2VQH A;  2BVL A;  3BJ6 A;  3F6V A;  3KZY A;  3L2Q A;  2EJR A;  3JR9 A;  2C6Y A;  1YQA A;  1ODD A;  3K4C A;  5F0H A;  4Y15 A;  3GZ5 A;  1R49 A;  3C2H A;  3IH3 A;  3RDI A;  4U7B A;  4LGW A;  2VL8 A;  4A12 A;  1BIA A;  1MMD A;  3CCS I;  2RNG A;  4XN3 A;  2JVG A;  1OR7 A;  1MH4 A;  3H35 A;  1QHG A;  2DMN A;  2UXN A;  5FKM A;  3GF2 A;  2KHM A;  5IYB J;  2O0Y A;  2VT2 A;  1R4N B;  1ETY A;  2CG4 A;  2Y9Y A;  2XAU A;  3WU0 A;  1ETO A;  1DUX C;  3MKL A;  1EH6 A;  4M73 A;  1C0W A;  4AWX B;  2AQE A;  3G3Z A;  4FX4 A;  2YSR A;  4PGH A;  1XGN A;  3CME I;  3FXR A;  1Z77 A;  1MGT A;  3ZMS A;  1ZG5 A;  2XAQ A;  1LDJ A;  3HGG A;  1NK2 P;  1BW6 A;  4KUM A;  1MBE A;  1MD0 A;  1P4A A;  2X1C A;  3PL8 A;  1WFX A;  2UV1 A;  4YRV A;  3M07 A;  4BL0 B;  4A3M J;  4EGZ A;  3CLQ A;  3E6D A;  2EV0 A;  4A3D J;  2LR8 A;  3LSP A;  5LHG A;  2IEK A;  2JN6 A;  2ZXI A;  5B66 C;  4IQ4 A;  3KX2 A;  3FWE A;  1TWF J;  2KDO A;  1EH7 A;  3WTU C;  2PX9 A;  2ECB A;  3K4J A;  2LD5 A;  4X1E A;  1XPX A;  4XL9 A;  2V4J C;  3KLO A;  1EH8 A;  2XB5 A;  1T0F A;  3BY6 A;  2O5R A;  2BBY A;  2WAE A;  4MIM A;  2WWY A;  2OUM A;  2V9P A;  1WI9 A;  3HYI A;  2F4I A;  4M3B A;  5F0C A;  1FOW A;  2GQQ A;  3RKQ A;  2IGM A;  4A0Z A;  1X1D A;  4XOP A;  2PI0 A;  4LIV A;  2V1U A;  1R1T A;  1OCP A;  4RGS A;  4U7D A;  4ENM A;  1K83 J;  1PUE E;  5CLS A;  3FXJ A;  1R1V A;  3RZO J;  3L9F A;  4CCL A;  2F5V A;  1MMA A;  2F5F A;  2BVM A;  4FE4 A;  3R60 A;  3IWZ A;  4YEJ A;  3VPR A;  4QIW N;  1ONV A;  4RBO A;  1R9T J;  1QVT A;  3G1O A;  4LJZ F;  3EYY A;  4CH7 A;  3K2A A;  3HHH A;  3BTI A;  2CQN A;  1GDT A;  4WK8 F;  4G8X A;  5DM6 F;  1WWX A;  4PFO A;  5DCF A;  2ZJP F;  4N4N B;  3I4M J;  3T0Y A;  3M3Y J;  2NOJ B;  5J4V A;  2GA1 A;  5E8G A;  1IC8 A;  2GLO A;  4BJ5 C;  4EMS A;  1WJE A;  5JHU A;  1FBQ A;  1WRJ A;  3BG5 A;  1D5V A;  1BOA A;  1MBF A;  1LUJ B;  2Y75 A;  3L2R A;  2ELJ A;  1ZG3 A;  2JQ7 A;  2CMP A;  2E1M B;  3LST A;  1VQP I;  3KYD B;  2HDW A;  3W6V A;  1LNW A;  1WJB A;  4E7L A;  4F92 B;  5J3L A;  4J19 A;  1K61 A;  4IHW A;  1FY7 A;  3GFJ A;  1WJD A;  3WG7 H;  1LE8 A;  3OR2 C;  3DEU A;  2EFN A;  1XN7 A;  2CWE A;  4HG2 A;  3HUG B;  3F6O A;  4ZYH A;  1QPI A;  3S16 J;  3O3K A;  4HA8 A;  4NC6 A;  5EG0 A;  3GVA A;  1UST A;  4UUT A;  4XLN F;  3HRM A;  2CFX A;  2DFF A;  5LGU A;  1V5F A;  1X1P A;  3DTI A;  4A69 C;  2Y2Z A;  4D7M A;  3S1N J;  1ITY A;  1U6G A;  2NVQ J;  4IQJ A;  5ILV A;  4DW6 A;  5E3M A;  2L7Z A;  2RQQ A;  1PP8 F;  2MG4 A;  2QKM B;  2XSJ C;  1MBK A;  3TDZ C;  1XC5 A;  2GXA A;  3W6J B;  1RUO A;  3A2K A;  2Y31 A;  5FKO A;  1SFX A;  4Z6Y A;  4A3K J;  4HRI A;  1ZG1 A;  1QQI A;  1RES A;  5F04 A;  4ETS A;  1BJA A;  3I56 I;  1D0Y A;  1AOY A;  2VOD A;  4D1Q A;  2G7H A;  1HCR A;  1M1E B;  3IKV A;  4UHT A;  5EZG A;  3BG6 A;  5HNF A;  4EQQ A;  3OYN A;  4ZZL A;  3P7N A;  2QEX I;  4ZYA A;  2QEN A;  2L0K A;  3VDX A;  3CDL A;  2WY8 Q;  2VJJ A;  5IP6 A;  1ZK8 A;  4PJN A;  2LKX A;  4A3C J;  2A6E F;  2OTL I;  3U2R A;  2XDV A;  4BU2 A;  3REO A;  4CCO A;  3ZQI A;  1GV2 A;  2EA2 A;  1YOV B;  4I98 B;  3S1Q J;  2EA4 A;  1A6I A;  2UXX A;  1YTY A;  4G7H F;  3BQZ A;  2MW8 A;  4CIC A;  1FBS A;  4IRI A;  2RKH A;  2K4J A;  2IS1 A;  1J5Y A;  1USS A;  2VIX A;  3OIQ A;  4ENJ A;  1G2H A;  1IF1 A;  1BA5 A;  5E1W A;  2LF8 A;  3ASN H;  5DYM A;  2HU9 A;  4I01 A;  3KP7 A;  4DJA A;  3CF2 A;  2L01 A;  3NWS A;  5LRS A;  2EIK H;  1JJ6 C;  3I53 A;  3WU2 C;  3DTE A;  4LLG F;  3H5N A;  3NEU A;  1IGN A;  1AHD P;  2F4M B;  1ETK A;  1JGS A;  4B1R A;  1RI7 A;  2FU4 A;  1OYI A;  2H27 A;  3IH2 A;  2HI3 A;  2R7T A;  1BN5 A;  2HS5 A;  2XC7 A;  1JT0 A;  5KK1 A;  4A3J J;  3ZR8 X;  4I2O A;  3CCJ I;  1F43 A;  3WE2 A;  1SD6 A;  1IUY A;  2L5Q A;  4RB2 C;  2HQR A;  4B48 A;  2OC6 A;  3ZOB A;  4OOI A;  3N97 A;  2XGC A;  4ZDL A;  2NXN B;  1V4R A;  1IXR C;  4PUS A;  4B43 A;  1R23 A;  4KT6 A;  5HS9 A;  3JRA A;  2QZ8 A;  1YS6 A;  3JAM K;  1VQK I;  1WPK A;  5GPC A;  1UMQ A;  1Z9C A;  2GXG A;  1YIT I;  1PDN C;  1N77 A;  1UB9 A;  3MVP A;  2FUG 2;  1TWC J;  1N25 A;  2JUC A;  3K4B A;  3OYK A;  3ABM H;  1HDP A;  1MIJ A;  3LL7 A;  4HX8 A;  4XNF A;  3LSR A;  2D1V A;  3QU6 A;  4O5V A;  5ICF A;  4P9U A;  1GV5 A;  1HSJ A;  2VBX A;  2DMQ A;  4OIP F;  2CUZ A;  3LQQ A;  3K70 C;  5FLX Z;  2GIV A;  2HYF A;  3BJO A;  2R7Z J;  1IN4 A;  3KCC A;  3B6C A;  2EB7 A;  2E35 A;  5L3C A;  2OZ6 A;  5KHD A;  1WJC A;  3M1E A;  1WI3 A;  5JVG F;  2X1E A;  2ZXH A;  3F9K A;  4HQE A;  2EH3 A;  2MH9 A;  2XKP A;  3FK6 A;  3O8G A;  3OS1 A;  1W36 C;  2HVS A;  1KU3 A;  2L3D A;  1LDK B;  2OJE D;  3CMM A;  2VC0 A;  5F0F A;  1TTY A;  1LE8 B;  2DFI A;  3MWM A;  1BIB A;  1A6Q A;  2NVY J;  4HZF A;  3AL0 B;  3HOY J;  1V54 H;  1WH7 A;  2DA5 A;  3G1M A;  3HOX J;  4UUS A;  3R6S A;  4A3L J;  4XIC A;  3HSE A;  5HLT A;  1HW5 A;  4XN0 A;  2FXA A;  5ICC A;  3BG7 A;  1J59 A;  4EVI A;  2M0C A;  5ILS A;  4D5F A;  3BDD A;  4HBL A;  5D5V B;  5A2Q K;  1NH3 A;  4AVP A;  1TL8 A;  2PMZ A;  3FXL A;  4D0P A;  2CUJ A;  1F1Z A;  1Z91 A;  1YLF A;  3DP7 A;  2FEZ A;  4HSR A;  3M9A A;  2OA4 A;  3GXO A;  4HF2 A;  5GTI C;  1LFP A;  1WH5 A;  5C44 J;  4BE0 A;  2KRF A;  3FHZ A;  2NNY A;  2IAI A;  2HNH A;  2GOX B;  1V55 H;  2ZNY A;  5A2Q Z;  2KIU A;  2RGV A;  5CKT A;  4E7J A;  3RCO A;  4IL6 C;  2Y48 A;  5LHH A;  5DV5 A;  4KIS A;  2CSO A;  4MGR A;  3BRO A;  5H6R A;  4BDY A;  2Z2S B;  3IRR A;  2DN0 A;  1ZEL A;  2R7R A;  3FIW A;  1XGM A;  4CCK A;  3FMS A;  4WWC A;  3BG3 A;  3I0T A;  3I64 A;  3I4P A;  2M7A A;  1BM9 A;  3N4M A;  4FT8 A;  1XMK A;  2YR2 A;  1EKE A;  1SFE A;  1XGO A;  1B1B A;  5CVV A;  2ZO4 A;  4BHB A;  1TC3 C;  1O7L A;  1FOX A;  2W48 A;  1EV7 A;  2ZKZ A;  4M6X A;  3ZCO A;  3H92 A;  2HQA A;  3CDI A;  2VE9 A;  4EV0 A;  1A31 A;  2ECC A;  1BI3 A;  5LFA A;  4ON0 A;  2ME0 A;  3H9Q A;  4CCM A;  3BZC A;  2MBF A;  5JFR A;  2Y0S A;  1LJ9 A;  1YX5 A;  1E3P A;  4FCY A;  1HBX G;  3GFI A;  1ETW A;  2PQ8 A;  1IUF A;  2V26 A;  3V4G A;  2K9L A;  2VJ5 A;  5L3B A;  4J01 A;  1YRN A;  1SAN A;  2WAD A;  3QYF A;  2DQR A;  1KA8 A;  2LLK A;  1IRX A;  4LK1 F;  3ZN0 A;  4B3X A;  3ERE D;  3KPH A;  4K2E A;  4KT5 C;  3HM5 A;  3M8E A;  3C2B A;  1SD4 A;  1J0R A;  3MZY A;  2LBF A;  1XCB A;  2Z16 A;  1GXP A;  1GVJ A;  1P7I A;  2JRT A;  4DZJ A;  2BHZ A;  2DU9 A;  4MQV A;  4A3E J;  2K40 A;  3WTS C;  3HUG A;  4E70 A;  2DMP A;  3B6A A;  3BPX A;  4JP0 A;  5HS8 A;  2CGP A;  4L0Y B;  3A0B C;  4NDL A;  5CJ9 A;  2K27 A;  3K7A J;  2YS9 A;  2K3P A;  2HYJ A;  4BDZ A;  4NQW A;  4BUP A;  2HDD A;  4FET A;  2P7V B;  1MBH A;  2DPU A;  5CVJ A;  3OIP A;  2EZI A;  3GYH X;  3TMO A;  1ZRE A;  3L2U A;  2LDU A;  1RIO H;  2NS0 A;  3LSH A;  4I99 C;  3TED A;  2KZG A;  4IHT A;  4M3G A;  2GZW A;  4YIF A;  2L9S A;  1JE8 A;  4ASN A;  2VQL A;  2VB6 A;  4FTH A;  3KEO A;  4EJV A;  2WBM A;  3F23 A;  3PM1 A;  3HXL A;  4E7K A;  2JUG A;  1H8A C;  3TO7 A;  1TWA J;  2CQQ A;  2RAE A;  4UVC A;  2ZFU A;  6PAX A;  2V9V A;  5M3M J;  4KYW A;  3FXK A;  1OIS A;  2A5W A;  2XGE A;  4A2U A;  2HOT A;  3PSI A;  2W25 A;  3KP4 A;  2LF7 A;  4N9I A;  4U0W A;  2MD5 A;  3G71 I;  2Y30 A;  1KQ9 A;  1R5G A;  1XDU A;  2A07 F;  1W5S A;  5DS9 A;  3S1R J;  5E8I A;  3V7S A;  4CZC A;  1SD7 A;  1WQ2 A;  3CCL I;  2KDZ A;  3BR5 A;  3MMY B;  3JRE A;  3MAJ A;  2PMU A;  4HYE A;  3CO7 C;  2CRG A;  4JQF A;  4BQN A;  2L7F P;  1YHQ I;  3CUQ B;  2WV1 A;  3VSL A;  3S3N A;  2DDA A;  2NYX A;  2NOG A;  3C7J A;  1X2N A;  5EYR A;  4DZP A;  2VOO A;  1TNS A;  3WE3 A;  1KQ0 A;  2IA1 A;  2K5C A;  3CJT B;  4RB0 A;  1SFU A;  1EF4 A;  4II2 A;  1D1C A;  4LOC A;  2DK8 A;  4FAS D;  1H9G A;  3F22 A;  3QPT A;  2LMD A;  1HKT A;  5LLQ A;  1I6H J;  4YII A;  1FYL A;  1OR7 C;  5GAG J;  2HKO A;  1YFH A;  2VE8 A;  2W1O A;  3JSO A;  4Q48 A;  3HDD A;  4JX4 A;  2DA7 A;  1FOK A;  1TT5 B;  5FLM J;  4Y17 A;  3HPH A;  1OYW A;  5IY5 H;  2O8K A;  1X1C A;  2R7V A;  2LBF B;  1FYK A;  4Y33 A;  1ERD A;  1YO5 C;  1TBX A;  2FML A;  1P92 A;  1VND A;  3OYA A;  3JTG A;  1VQ4 I;  1BOB A;  3ONQ A;  2EZL A;  3H9G A;  1XDS A;  1ULY A;  3E6M A;  4RM2 A;  3OY9 A;  2X6X A;  4UB8 C;  1OCC H;  2FNA A;  5BPI A;  3V8K A;  3WHC A;  1FNN A;  3WGG A;  3OYM A;  5LEJ A;  2X1D A;  4XLE A;  1SMY F;  1ZRC A;  1YI2 I;  2CS3 A;  2A05 A;  3A0H C;  4RMN A;  5GPA A;  5IP7 J;  2ESN A;  2XF7 A;  2VBY A;  4CO8 A;  3BR1 A;  4PZJ A;  5GAD J;  4LMY A;  2EZH A;  2ACJ A;  4ANJ A;  4DOZ A;  1ZR4 A;  1BR1 A;  2OCC H;  3M8F A;  3K0L A;  2QA4 I;  4IHY A;  4G6T B;  1S7A A;  4RGR A;  1W0U A;  1PUF B;  4M71 A;  3DF8 A;  2VPR A;  1Z3Y A;  4GYI A;  1FLI A;  3WGH A;  3VOE A;  2QSG X;  2ZFW A;  1JTX A;  5TRD A;  2KMU A;  4DIQ A;  4FE7 A;  1IZ1 A;  2F48 A;  5GP9 A;  2W57 A;  4M6Y A;  3FIS A;  3F21 A;  4PJ0 C;  1W7P D;  2QVO A;  2ZME B;  4A6D A;  3E0J B;  4I02 A;  4RGU A;  5TJJ A;  3HL2 A;  3S1M J;  2BOL A;  4GFB A;  4UY8 I;  2IA2 A;  3BLY A;  1JKQ C;  2TDX A;  1MDM B;  1VZ0 A;  4X0G A;  4W97 A;  3JRG A;  2B9S A;  2E5Z A;  4EJW A;  3IWF A;  1O3S A;  1Y1V J;  1K7A A;  3BCA A;  2E2H J;  1PVE A;  1TWH J;  3AG4 H;  1T8I A;  3I59 A;  2HTS A;  1SFO J;  1QVU A;  2BGC A;  2L4M A;  3RKX A;  3SFZ A;  1IW7 F;  3CDH A;  5D4R A;  4HQM A;  4HF0 A;  3EUH A;  2KT0 A;  1MMG A;  1UHS A;  1T56 A;  4F93 B;  1Z1D A;  3H5A A;  4BAY A;  1K4S A;  2VI6 A;  2CO5 A;  3ZPL A;  4M74 A;  2LFB A;  1Y39 A;  3C2G A;  5J47 A;  4UVA A;  4F55 A;  2LNB A;  5FRO A;  3F3X A;  1OFC X;  3DBL B;  3QRF F;  3CTA A;  1W36 D;  2BY1 A;  2ZME C;  4C9Y A;  3EUA A;  3W2A A;  5JI6 A;  4RLQ A;  4DYC A;  3KP6 A;  2JK3 A;  2KIF A;  4AID A;  3BT9 A;  1YRN B;  4OWR B;  4QTR A;  2IGK A;  3SJM A;  2PEX A;  2I10 A;  3K70 D;  3K1P A;  2XF6 A;  1S8N A;  4RB3 C;  2XPW A;  4CSW A;  5FO5 A;  5HVQ C;  2O61 A;  3GTK J;  2VN2 A;  3HKZ A;  2UUZ A;  1YS7 A;  2W85 A;  1SC7 A;  1A35 A;  2Q1Z B;  4HAM A;  1IRG A;  5C4X J;  2LK2 A;  1S72 I;  3O2P E;  3DKW A;  1EJ9 A;  4DYR A;  3SXY A;  5D6F A;  1W4M A;  3PNY A;  2NVU B;  3K6G A;  3JRF A;  2PMZ N;  2BYV E;  2W4S A;  3M1C A;  4L5J A;  1BR4 A;  2JA5 J;  2ID3 A;  3BTJ A;  3BZ6 A;  3MCZ A;  1P4X A;  4I0B A;  4OIR F;  1QU3 A;  4OMY A;  4QPO A;  2AXT C;  1HST A;  3ABL H;  3KEY A;  1OKR A;  1V3F A;  2RRE A;  5IT3 A;  1KQ8 A;  2BE5 F;  2XGD A;  5J1U A;  3VEP A;  3CCR I;  4EJU A;  1QO0 D;  3AG1 H;  2JT1 A;  1PYV A;  1K6Y A;  2MC3 A;  1Y8R B;  3QQA A;  3WG9 A;  1T0F C;  2EFQ A;  2K9S A;  5FKL A;  5K1Y A;  1MND A;  3DV8 A;  4ZTJ A;  2ZME A;  3TOA A;  5K7H A;  3Q0U A;  1RUN A;  3G1L A;  1D5Y A;  1E0E A;  2D1H A;  2FBI A;  1SAU A;  2LY2 A;  3L2V A;  2ZJR F;  2Z9O A;  1DU0 A;  2QUF A;  4IOC F;  4U0Y A;  5AIQ A;  1ZLK A;  5HDK A;  1VTN C;  3S32 A;  1KU7 A;  2QQA A;  3TW6 A;  1LFU P;  1KGS A;  1W7P A;  2BXZ A;  5LRR A;  3HPG A;  2H1L A;  3CCY A;  2E71 A;  2P8T A;  5ICE A;  2AO9 A;  4M3F A;  3CD6 I;  3GWZ A;  1ZQ3 P;  2DJI A;  1R22 A;  3I4N J;  5F08 A;  2DYS H;  4NC7 A;  2CUE A;  4D9J A;  4PGG A;  4KIF A;  9ANT A;  4F7Z A;  2BHY A;  3BR2 A;  3HGY A;  5K5R A;  3FBI B;  3PIP F;  1LVK A;  2FRH A;  2KJC A;  3N05 A;  2ZB9 A;  4IF4 A;  2FMY A;  1NG7 A;  1G4D A;  2E7W A;  5F6F A;  2ZC2 A;  2VAS A;  4RAG A;  5HS7 A;  3TL4 X;  2K9Q A;  4EGY A;  3GTQ J;  1IN7 A;  3FKI J;  4IJA A;  5EJC A;  5CVI A;  1R00 A;  3RYR A;  2DXI A;  3CMA I;  2M30 A;  4CDG A;  5AIP A;  1D8K A;  2Q2E A;  2DMU A;  1RKW A;  3H0G J;  2M2E A;  1ETQ A;  1XTA A;  3BWG A;  4UV8 A;  1G3W A;  2EIJ H;  4CHU A;  3FXM A;  4UV9 A;  2GAU A;  1FJL A;  1DPR A;  2M4K A;  1V5E A;  2F5E A;  4ABZ A;  1AA7 A;  1G59 A;  5M3F J;  3H1C A;  1R4M B;  1WZ2 A;  3LA2 A;  3H3V K;  1X1A A;  3QYE A;  3JW4 A;  1O57 A;  2CU7 A;  3OSF A;  2BY3 A;  4HV6 A;  4DBQ A;  4KIC A;  3FKJ A;  1QGP A;  1TLH B;  4YG2 F;  2R7S A;  2Z5U A;  3P9C A;  1QPM A;  2PBI A;  2IRF G;  1U9O A;  5GAH J;  4HV5 A;  3B02 A;  1VQL I;  4WXC A;  3HOZ J;  2OAZ A;  3H3U A;  4M6V A;  3S2H J;  3S15 J;  2GBY A;  4KDP A;  4NNJ A;  2I5U A;  2KLO A;  4BNC A;  1B9N A;  2XRN A;  2WY7 Q;  2IPQ X;  1D8J A;  5D5W B;  3J80 K;  2YPR A;  4B09 A;  1XCV A;  2XPV A;  3HOU J;  1H89 C;  2QQ8 A;  3DPU A;  3CCU I;  3FZV A;  4XKB A;  3T1B A;  3RPQ A;  2JMW A;  5K5O A;  3FK7 A;  2Y9Z A;  2JA7 J;  4EM2 A;  3DBH B;  2DK5 A;  1B6A A;  2GA2 A;  5J1Y A;  2M1B A;  5DTD A;  4BXU A;  5HLI A;  1H0M A;  4PK4 A;  2A5Y B;  2K85 A;  2DDB A;  4M9X A;  2R5Y B;  3CCE I;  3VYR B;  4HW0 A;  3J80 Z;  2M8E A;  4AIH A;  1CGP A;  3JRI A;  1SFK A;  2FE3 A;  1VQ8 I;  2FQ4 A;  1JXS A;  2V6C A;  4KMU X;  2M5W A;  1J7K A;  2RV8 A;  2E60 A;  2B7E A;  2YU3 A;  4XSX F;  1Z7L A;  2G7U A;  3PFI A;  3HJE A;  2VBW A;  1R7J A;  3FMR A;  4MFD A;  2ZXW H;  1NK3 P;  1XSX A;  3LSI A;  3AAF A;  2DOE A;  4OMZ A;  4HDU A;  2QBY B;  4B3A A;  3EDP A;  4LB6 B;  2FJ1 A;  1FSH A;  3DKX A;  4CCJ A;  4UUS B;  1AWC A;  1YG2 A;  3RPU D;  3OYB A;  3RI4 A;  3ZMD A;  5EEH A;  2W00 A;  2HWV A;  3S2W A;  4ZC3 A;  2JSC A;  2DOD A;  4XRM A;  4NQW B;  4CXF A;  1QNT A;  3IHU A;  5HOD A;  3DPT A;  1R5H A;  3FBN B;  3RSN A;  2IBD A;  4UNO A;  1F5T A;  4BHC A;  3M7G A;  4WXD A;  4PJJ A;  4LK0 F;  4EM1 A;  2W82 A;  1F36 A;  1LDD A;  1MBG A;  5KAI C;  3DLL F;  4BJ6 C;  3HZJ A;  4MFE A;  3VSK A;  4Q4Z F;  3GTG J;  4M3D A;  3I9V 2;  2E19 A;  4ZYE A;  4E7I A;  3K1N A;  3TDU C;  5K5Q A;  1MDM A;  1CF7 B;  2XKO A;  4CYC B;  2FOK A;  4XQF A;  1ACI A;  1X3U A;  3ZXS A;  2KP6 A;  5IP9 J;  2TCT A;  4GGG A;  2R4G A;  3H9J A;  2HFH A;  3WTW C;  3I59 B;  4PSW A;  2M9H A;  5L3F A;  2ZCW A;  1S6L A;  3TGN A;  1L3L A;  3K10 A;  1YJ9 I;  4WF2 A;  1E2X A;  5FKN A;  5BS6 A;  1MSF C;  5CVR A;  4KFC A;  2M8G X;  1FIA A;  1KYZ A;  4IZZ A;  2J5O A;  2BY0 A;  2RDP A;  2GXB A;  1ZRF A;  1T33 A;  2JPC A;  3CC4 I;  4C2U A;  3EUK L;  3W6K B;  2H6C A;  1Z6R A;  3H5R A;  4M9Z A;  1ON2 A;  2XAG A;  3LAP A;  3CUQ A;  4OIO F;  1NHA A;  4IOA F;  5F64 A;  2QLZ A;  3J7A O;  5FRN A;  5FRM A;  2HGC A;  3LSM A;  3HOS A;  2M4G A;  3C1D A;  3COA C;  4BYY A;  1TP4 A;  1XX5 A;  3DWL E;  3QPL A;  4U0V A;  4BH9 A;  3KEQ A;  1AU7 A;  1FPQ A;  3MKZ A;  1FZP B;  4YFX F;  3LA7 A;  3JRB A;  3ECO A;  3BQY A;  4NUB A;  4Y3O A;  4AIJ A;  1D3Y A;  3MKY B;  2OQG A;  4FIS A;  5CPR B;  3OYE A;  2CW8 A;  1JGG A;  3OYH A;  3E3V A;  2W7N A;  5BQT A;  1Z6T A;  2RC4 A;  5D8L B;  3MD2 A;  1W5C C;  4LIT A;  5JLX A;  1IXC A;  2R92 J;  3KET A;  4Y7N J;  1FP2 A;  5ILU A;  3KFW X;  3ZGK A;  2F4O B;  2HR3 A;  4BKX A;  4DQ2 A;  3K4K A;  1BC7 C;  2ISZ A;  4E6K G;  2JRM A;  1TW2 A;  1X4P A;  4N0B A;  5J40 A;  1BW5 A;  1U5T C;  1YX3 A;  4AC0 A;  1R71 A;  4BXX J;  3FXO A;  5DUI A;  2FBK A;  3ZP5 A;  3B73 A;  1T08 B;  2XGX A;  2HOE A;  1I1S A;  2V1X A;  2V9K A;  3I55 I;  2W84 A;  2YX4 A;  1OJL A;  1IV6 A;  3ABT A;  4MTD A;  4BE2 A;  4D5C A;  5IYD J;  2GM4 A;  3FDY A;  1HKS A;  2OF7 A;  3O6B B;  1S5L C;  2NRA C;  4MEY F;  3CJN A;  4LD5 A;  3JCU C;  3QOE A;  2DI3 A;  3HBL A;  3P5J A;  1Y0U A;  3WTX C;  2ETH A;  2NAZ A;  1U3E M;  2H8W A;  1SD5 A;  2AHQ A;  2JWT A;  1FSE A;  2HVR A;  1APL C;  4LG0 B;  3A4C A;  3AG3 H;  5DD8 A;  3FM3 A;  3GME A;  3V42 A;  1Y8Q B;  3K1M A;  4PJM A;  3BC8 A;  2WC2 A;  5DCM B;  2BW3 B;  4KN7 X;  3P9K A;  3DEE A;  2Q2E B;  2IS4 A;  1JUS A;  3R61 A;  4NBQ A;  4XMY A;  2VJI A;  2LH9 A;  2MLK A;  3Q9S A;  4LB5 A;  1R5I D;  1YYV A;  5DDG A;  1I5Z A;  5IPA A;  1MJ9 A;  3ABU A;  3DXJ F;  4P5O A;  3WTV C;  3CCQ I;  1XMX A;  4HLY A;  3F0C A;  1TQM A;  1XSD A;  5K7F A;  1U9N A;  4IX7 A;  1R58 A;  2R3S A;  2L9R A;  5C3E J;  1ZHF A;  3JRH A;  2DLL A;  2K3F A;  5M5Y J;  3VFZ A;  2PJR B;  5FFZ A;  3SYT A;  1IRF A;  1FOY A;  1X3W B;  4OU0 A;  5FD5 A;  2TRT A;  2O6G E;  2CV1 A;  1MH3 A;  1IAW A;  1YJN I;  4U87 A;  5JHF A;  2VQC A;  3GZN B;  5J6X A;  1U5T B;  1YE9 A;  2VXZ A;  1U5T A;  1J2X A;  3RPU A;  3A02 A;  3CLO A;  4IVN A;  2IVM A;  3W2V A;  2XAJ A;  3A01 B;  2F6C A;  3A01 A;  1RR7 A;  3GEZ A;  2MD0 A;  1X2M A;  4G6D A;  1I39 A;  4IKF A;  3PSF A;  4GYG A;  3OS0 A;  4AM3 A;  2DAO A;  1DGW Y;  1MKM A;  4XLF A;  2VPL A;  3EPZ A;  1LKX A;  4HEA 2;  4IXA A;  4BY7 J;  3TKY A;  5JVT A;  1GT0 C;  3GTP J;  1IN6 A;  4E7S A;  2G9W A;  2HKX A;  2OCE A;  4BQO A;  3NAU A;  2KPM A;  3DEW A;  1BI1 A;  1BR2 A;  1NTC A;  3VB2 A;  5B1A H;  4S0H B;  4PJL A;  2QQ9 A;  3MEX A;  1O4X A;  4E4H A;  3HOV J;  1O7F A;  2GWR A;  1UJ8 A;  3LWF A;  1TT0 A;  1VQ9 I;  1ENH A;  2O7O A;  2R0Q C;  2ADU A;  2L9N A;  1B72 B;  1JKP C;  1FYM A;  1VQN I;  1P6R A;  2ZXJ A;  3GFM A;  3SDG A;  3C3W A;  3I3L A;  1KZH A;  3QOD A;  3L1P A;  4E7H A;  1ZKG A;  2LP0 A;  2AXL A;  4HPQ A;  3L2C A;  4WXH A;  4AU7 A;  2F5C A;  2HXI A;  2M0M A;  3WU1 B;  1HOM A;  4EM0 B;  3PFY A;  2QCO A;  1SVL A;  3OYF A;  5FLX K;  2IA0 A;  1FIP A;  2WAQ N;  2KQR A;  2Z33 A;  2P6T A;  4I76 A;  2DA2 A;  3GO5 A;  5E18 F;  1RRJ A;  1XMA A;  3F8N A;  2CH0 A;  2HVQ A;  1YW9 A;  4KIG A;  4C2M J;  4RB1 A;  3R4K A;  1LB2 A;  1RKT A;  3S8P A;  4XRS G;  2R7W A;  2WAF A;  1KU2 A;  4IPA A;  3BPV A;  2QBY A;  3Q0W A;  4DBR A;  2COB A;  2AQF A;  3L2W A;  2P6S A;  1H88 C;  4CYC A;  1E3H A;  4YIR X;  3LSK A;  3H3Z A;  4G7O F;  4CGZ A;  2O9L A;  5BPD A;  3DFG A;  3DLA A;  5DD4 A;  2MYS A;  5L3D A;  2H6B A;  4LFU A;  4B8X A;  4M72 A;  4ENN A;  1WSU A;  1JJ8 C;  2Q0O A;  1RR8 C;  2X85 A;  2PJR A;  1G6N A;  3PNT A;  2IGN A;  3W2W A;  2XB0 X;  5EZH A;  2K9M A;  4D7N A;  4F3Q A;  3T5X A;  1Y0N A;  4IEJ A;  2HDC A;  5TGT A;  5JR3 A;  3JRC A;  2KKO A;  1OCR H;  1MSE C;  1K78 A;  2AS5 F;  2P4W A;  1UFM A;  2J5P A;  4HNV A;  3ECH A;  3OIO A;  2HTJ A;  3WTY C;  1K78 B;  3KIO A;  1XS9 A;  3MFK A;  4ESJ A;  5FB2 A;  5CQE A;  3R0A A;  3PQJ A;  3CCV I;  1OYY A;  2WV0 A;  1K79 A;  5GAE J;  3ERM A;  1JKO C;  1P4W A;  2H1K A;  2E1C A;  3BTC A;  4MO7 A;  5FGM A;  1H9T A;  4OAY A;  3RQ4 A;  1LQ1 A;  2A69 F;  4L0Z B;  1VQO I;  2EK5 A;  3OL4 A;  1HF0 A;  2BZT A;  1RZ4 A;  2VXD A;  4PSX A;  2HEO A;  1E3O C;  4EJO A;  2ESH A;  1Q1H A;  4R8H A;  1HQC A;  2RVC A;  4M9S A;  4HOB A;  4ZJZ A;  4IRH A;  2CW7 A;  2IJL A;  2VKD A;  3HRU A;  2ELK A;  2KIQ A;  5HDG A;  1VQ5 I;  2PG4 A;  2JA8 J;  1IG7 A;  2X4H A;  3TO9 A;  3A1Y A;  2CV0 A;  2OV7 A;  3L7W A;  5FD6 A;  2XF5 A;  1KYW A;  1WJF A;  4II3 A;  1X3Z B;  4AIK A;  3RZD J;  1S29 A;  3MZH A;  4I7H A;  5EEA A;  2LRE A;  1G3S A;  2FF4 A;  1RPW A;  3J7A Y;  2DW4 A;  3QP5 A;  5M5W J;  4A3F J;  4S05 A;  2EIN H;  3ZN1 A;  2EQR A;  3UR3 C;  3S3O A;  2WB1 N;  4C3J J;  2EZK A;  3DKY A;  4ENK A;  3BP8 A;  3IKT A;  1JHF A;  3V8J A;  1FP1 D;  1SVM A;  1T6S A;  3LSG A;  2ZSH B;  3AL0 C;  1TQP A;  3CMY A;  2DT6 A;  3K4M A;  2DMT A;  4BQQ A;  5JLW A;  4ZYD A;  4C3H J;  2R7O A;  5LGN A;  2EBI A;  3E1S A;  3SEZ A;  3VYT B;  1IXS B;  2EFW A;  1OLT A;  4C2T A;  4UXN A;  5CYV A;  3CJQ B;  4G6Q A;  4LG0 A;  1MBJ A;  2IXS A;  2K9N A;  1BBY A;  1R6R A;  3ZQF A;  4HNU A;  1W7P B;  1T38 A;  2JVH A;  1S7E A;  4LLL A;  3ZQG A;  2CQX A;  2YX7 A;  2D2W A;  3BZK A;  1FBU A;  1I3Q J;  1Y56 A;  2Z99 A;  4KA4 A;  1JKR C;  2V7F A;  1QZY A;  3HRS A;  2KFD A;  5E3N A;  1XSV A;  4KNY A;  2F2E A;  3WTZ A;  1SAX A;  3M4O J;  1ETX A;  1T98 A;  4RA2 A;  1VQM I;  2VUM J;  2MGQ A;  5E1X A;  3ZMT A;  1TW3 A;  4Z2Y A;  3J7Z I;  1ZTR A;  2O3F A;  4BBR J;  4IO9 F;  2HQN A;  5GTH C;  1Z3X A;  4C3I J;  1IDZ A;  1PUF A;  2Y69 H;  2WAQ A;  2VC1 A;  2XIG A;  3RKW A;  2Y0M A;  3HTS B;  3FXU A;  4Q47 A;  4XKV A;  3U21 A;  3S93 A;  3VOD A;  2P5K A;  3OR1 C;  1DGR M;  2QWW A;  2JPB A;  4LLN A;  2XAF A;  1I3A A;  2EIL H;  2E7X A;  4HX7 A;  4IRG A;  4LIU A;  4HNT A;  3EUH C;  4GCV A;  2VKH A;  3C18 A;  2GOM A;  1VI0 A;  1JI8 A;  5EDN A;  2X9D A;  2H8R A;  4L9N A;  4BXF A;  1YW8 A;  2VBZ A;  1RET A;  4I6Z A;  1ZRD A;  3DQV C;  3FXQ A;  2O03 A;  2KJB A;  1J9I A;  1JTY A;  5E20 A;  2DBB A;  2DA1 A;  4BBS J;  3EET A;  2ME6 A;  5LGT A;  5D8K B;  4V19 K;  5CQG A;  1VFC A;  4RAZ A;  1ZYR F;  3V8L A;  2KRH A;  2A61 A;  5F1R A;  2DTZ A;  1ZR2 A;  2LTP A;  3HEF A;  1TNT A;  3I5U A;  4RS8 A;  5ERI A;  2ID6 A;  4NB5 A;  5L3E A;  5IOY A;  4BY1 J;  3OWT A;  1EA3 A;  3FM5 A;  3ZQ7 A;  2IW5 A;  4XLP F;  1OQY A;  1BJZ A;  3IUO A;  3PIO F;  3G6E I;  1VQ7 I;  4N9H A;  5AON A;  3KZI C;  2VQG A;  2P5V A;  2A6T A;  5D4S A;  4P1W A;  4XBF A;  5E17 F;  3G2B A;  3GCM A;  4BGD A;  5EGO B;  3SZT A;  3IH4 A;  3OYJ A;  2HPI A;  3LNQ A;  3F72 A;  2MAB A;  4GDF A;  2PN6 A;  5B5E C;  1HXD A;  1OCO H;  1DP3 A;  5DEQ A;  2MLG A;  2QSH X;  1Z21 A;  3SZG A;  1G8X A;  1W1W E;  2PFB A;  2HZT A;  3U1D A;  3CO6 C;  1O3T A;  1FEX A;  1IV8 A;  4OAZ A;  2XRO A;  4AYB N;  3CC7 I;  3RKY A;  1JT6 A;  5J8F A;  4JK1 X;  3KZZ A;  3O8H A;  1D1B A;  2RQP A;  5TIS C;  4HDV A;  1B8I B;  2K4B A;  2Z3Y A;  3HC7 A;  3RTR A;  4DNC A;  1Z05 A;  2RNJ A;  3RJP A;  1A04 A;  1T2K A;  2KZV A;  1ZAO A;  1HKQ A;  3Q5F A;  1HC8 A;  5BMZ A;  3S2D J;  2DT5 A;  1B9M A;  2LC2 A;  4B47 A;  1U8B A;  2PLY A;  4F52 A;  1IRZ A;  1ZGA A;  3TOB A;  4QLC U;  4FX0 A;  3ZQC A;  3E6C C;  2CV2 A;  1IDY A;  3BTL A;  4L5E A;  5LHI A;  1WCM J;  2VJ4 A;  2DFH A;  3V7R A;  2B63 J;  2ISY A;  5CVU A;  4V2G A;  3HB9 A;  1FMV A;  5HOO A;  2CJJ A;  4XKW A;  5F27 A;  1ZN2 A;  3FHN A;  3BCB A;  5H6Q A;  3VYS B;  4CUG A;  4YFK F;  4E7Z A;  2H09 A;  1S9H A;  2K02 A;  2JZY A;  1ORK A;  3OOU A;  2XAS A;  4TV7 A;  2NVT J;  2M87 A;  1O3R A;  4JX6 A;  3K2Z A;  5FJ8 J;  1REP C;  2DA4 A;  4AVZ A;  2A6H F;  1B4A A;  4XLC A;  3T8R A;  1FC3 A;  4A6E A;  4ZZD A;  3HOT A;  4G94 A;  2L7M P;  3DPL C;  1HDD C;  1I50 J;  3IP4 B;  4M3E A;  2HYG D;  3UNG C;  1HLV A;  5J8C A;  3CCM I;  2CQ7 A;  1U8R A;  1BI0 A;  1VF9 A;  3LFU A;  1K4T A;  1UG0 A;  1D1A A;  2M34 A;  4XRS A;  4C30 A;  4RGX A;  3RYP A;  2FA5 A;  4F91 B;  3M8J A;  3PUB A;  3JRD A;  1QBJ A;  4Y13 A;  3OYD A;  1UCR A;  1GXQ A;  2V79 A;  2X6Y A;  4XON A;  4MLO A;  3ML6 A;  1MZB A;  1WGX A;  3ZMZ A;  2ICW G;  3D1N I;  1FTT A;  5B1B H;  1PJR A;  3KE2 A;  3QWL A;  1X1B A;  4XK4 A;  1O3Q A;  3GTM J;  2ZJQ F;  1G3Y A;  3OYI A;  3BG9 A;  1HW2 A;  1WKM A;  2DTR A;  4H4K C;  2DQL A;  4KMF A;  4HF1 A;  2IS6 A;  3WTT C;  3BOQ A;  1OMI A;  1ON1 A;  2NS8 A;  4LG3 A;  1A36 A;  4YEL A;  2XRL A;  2E1M C;  4KIB A;  2HXO A;  1XGS A;  3LFK A;  3E6B A;  1XB4 A;  2FX0 A;  4L9J A;  4J00 A;  2NVX J;  3Q9V A;  2VKE A;  5E79 C;  3E97 A;  2LKS A;  1QZZ A;  1V5G A;  1LEB A;  3OL3 A;  4P9F A;  2E1N A;  4A0X A;  2IS2 A;  2L4A A;  2XHK A;  4G12 A;  3MQ0 A;  4BS9 A;  1LVA A;  3H36 A;  2D45 A;  3SZP A;  4BQA A;  1XG1 A;  2L54 A;  3UKG A;  1DPU A;  3GUD A;  5FFX A;  1B8I A;  3CF5 F;  2V1D A;  3I58 A;  4WX9 A;  1X58 A;  1D0Z A;  3K4L A;  3GTO J;  3HG9 A;  4R1H A;  3BR6 A;  3HTU A;  4L9T A;  1AKH B;  4KIT B;  3ZRG A;  1BL0 A;  3LOC A;  5E3L A;  2VKV A;  3QAH A;  1L0O C;  3LQR A;  2CYY A;  2G0E A;  2P81 A;  2WTE A;  3ABK H;  5J4Y A;  4ZYG A;  3CZ6 A;  2O8X A;  1OCZ H;  4X6A J;  3DBR B;  2Y0S N;  3SDB A;  3L00 A;  3HSF A;  4AYB A;  5B3S H;  3IL2 A;  4RDU A;  4B44 A;  2YUS A;  4V2F A;  2F5D A;  3D5L A;  3I54 A;  4KJZ A;  1T39 A;  1FX7 A;  2E1O A;  2FQ3 A;  2XPU A;  1WVR A;  3GW2 A;  5LBQ A;  5HLG A;  2UZK A;  1OCT C;  1IO2 A;  1E17 A;  4A0Y A;  1WHU A;  2X48 A;  3BR0 A;  2XSD C;  1YIO A;  1ZH5 A;  3PJR A;  2LG4 A;  5LD2 C;  4PFP A;  1T95 A;  2R5Z A;  1MW7 A;  3MN2 A;  3TBI A;  3OMY A;  2MFZ A;  2R5Y A;  3K9T A;  1JHH A;  1TWG J;  2QM3 A;  4H0E A;  4XLH A;  3CP2 A;  5FKK A;  1BC8 C;  4RAF A;  2E5N A;  3SHF A;  4BHP A;  2FNP A;  1K6O A;  1MJA A;  2BW3 A;  2BV6 A;  2L9V A;  5F1J A;  2ELH A;  4CZZ A;  2EV5 A;  2LY9 A;  4RAY A;  1PP7 U;  4QPQ A;  2MC4 A;  3Q0V A;  2OQR A;  1RC9 A;  3MKW B;  3AFH A;  3E5U A;  3IRQ A;  2VLA A;  2E34 A;  4Q5S F;  1UEL B;  2HOS A;  1B59 A;  3CUQ C;  2OZU A;  1CQT A;  2IT0 A;  3LMM A;  4OIN F;  5H2F C;  3G4S I;  2STW A;  2OBP A;  2JA6 J;  4Y52 J;  2MA3 A;  2KRC A;  4ZTF A;  1WJ5 A;  5DUK A;  3E5Q A;  1Z67 A;  2DFE A;  3HHG A;  2LVS A;  5D5U B;  3CP8 A;  2MH2 A;  3OYC A;  4BEH A;  1J09 A;  4A3G J;  5DM7 F;  4BEH B;  2LY1 A;  4QWQ A;  3ISP A;  4A5N A;  3CES A;  2FBH A;  3D0S A;  1HA8 A;  2EIM H;  3F8M A;  4ZDO A;  1YW7 A;  3J81 Z;  3KP3 A;  1F4K A;  4U88 A;  2XV4 S;  2B0L A;  3HKZ N;  1GUU A;  2X6O A;  4HST A;  2PMH A;  5C4J J;  2DA3 A;  3QPH A;  3A03 A;  4UB6 C;  5KVR A;  4BE1 A;  4ESB A;  1I6X A;  2FOW A;  3WGI A;  1CF7 A;  3AKZ A;  1LEA A;  4N4O B;  2A68 F;  2DOF A;  4YFN F;  2R7X A;  4A3B J;  2EV6 A;  2IP2 A;  3OSG A;  5FLV A;  1KON A;  2N8G A;  2I8D A;  2R7Q A;  2ZJ2 A;  2DOA A;  4G7Z F;  5KAF C;  5D6E A;  1TZL A;  2CUF A;  3ESW B;  3ELK A;  3ZQQ A;  4A5M A;  2BY2 A;  2E36 A;  1RNL A;  3HOW J;  2M7B A;  4UUV A;  4A3I J;  2M45 A;  2WA0 A;  1DDN A;  3VWB A;  2Z1D A;  4W1U A;  4AUX A;  4ESF A;  2EFP A;  1U2W A;  4KN4 X;  2DCE A;  1R1U A;  3JAM Z;  2HPM A;  4DGW B;  2H94 A;  2X6W A;  1U78 A;  5IYC J;  1A5J A;  3TP0 A;  2DO7 A;  1X19 A;  4XM3 A;  2NNN A;  2V1N A;  4I0A A;  3RIR A;  3SEQ A;  4G9Y A;  2LKP A;  3NRV A;  2R5Z B;  1YIJ I;  1N78 A;  5IT9 Z;  1IJW C;  2V6E A;  3WOD F;  3F8B A;  3GBG A;  3TP3 A;  3BR3 A;  3X2Q H;  1GHC A;  3G73 A;  1U0J A;  5BOX A;  1MNE A;  3QPS A;  4IHX A;  1S7O A;  4MTE A;  4MNU A;  1AKH A;  4ITV A;  4A93 J;  5L3G A;  2LRD A;  4EAT A;  2A3S A;  5H20 A;  3F8C A;  2P5L C;  3EYI A;  3CQZ J;  1QZE A;  2MSY A;  1UAA A;  4IHS A;  1UHW A;  1D0X A;  2JSP A;  3D5S C;  4XOR A;  3WHB A;  3GLL A;  2D5V A;  2QYO A;  1MMS A;  2L2O A;  4MHG A;  2FD5 A;  3GZ6 A;  1P7J A;  2K86 A;  3D5R C;  4I09 A;  5E3O A;  3CC2 I;  1QA6 A;  3DTK A;  1WJA A;  1JUP A;  3QP6 A;  2FSW A;  3ROU A;  3QOP A;  2ZNZ A;  1G3T A;  4JYK A;  2NS7 A;  2XUB A;  3KYL A;  3IC7 A;  4L5I A;  1UZC A;  3H0D A;  4P96 A;  2R93 J;  3U9G A;  4NHJ A;  2LSO A;  4CCN A;  3GX4 X;  4QSH A;  3V7C A;  4O3M A;  4GRI A;  3P9I A;  3PNV A;  5EEG A;  3NWT A;  4PCQ A;  1DP7 P;  1XD7 A;  2CW0 F;  3EQL F;  4JX5 A;  1P9Q C;  2X51 A;  2IGO A;  1FMW A;  2XVC A;  1ZLJ A;  2VT3 A; 
#chains in the Genus database with same CATH homology
 3CJQ B;  5HLT A;  4XN0 A;  3OYL A;  2IXS A;  4DBQ A;  3BG7 A;  3FKJ A;  1R6R A;  4HNU A;  2R7S A;  4XR6 A;  2JVH A;  4CA0 A;  2PMZ A;  3W3C A;  1Y56 A;  2UWM A;  2CUJ A;  4R79 A;  2V7F A;  1QHH D;  5HNH A;  4HSR A;  4XOT A;  4NNJ A;  2KLO A;  2WY7 Q;  1LFP A;  4Y4R A;  4BE0 A;  2HNH A;  3K4N A;  3DPU A;  2GOX B;  4XKC A;  3VYU B;  5CKT A;  1Z3X A;  4XKB A;  4E7J A;  3RCO A;  2WAQ A;  2KL4 A;  4KIS A;  4BDY A;  4XKV A;  4ZDP A;  2Z2S B;  3S93 A;  3U21 A;  3OR1 C;  4PK4 A;  1DGR M;  1ZEL A;  3VYR B;  2R7R A;  2CFO A;  4CCK A;  1SFK A;  1GLN A;  2DT7 B;  4LIU A;  4HNT A;  2M7A A;  2E60 A;  3EUH C;  4JOM A;  2VKH A;  1Z7L A;  2GOM A;  1MMN A;  1JI8 A;  3LSI A;  4BXF A;  3DU6 A;  2R7U A;  3DQV C;  3DKX A;  4CCJ A;  3ZCO A;  3RPU D;  2JA2 A;  4NC8 A;  2HQA A;  3OYB A;  5CQG A;  5KCM A;  3OS2 A;  1N75 A;  2LYC A;  2W00 A;  4RM3 A;  2LOO A;  4ZC3 A;  2KRH A;  2ZSI B;  5LFA A;  4NQW B;  3H9Q A;  4CCM A;  3DPT A;  3FBN B;  3OWT A;  1EA3 A;  3RSN A;  2HZD A;  2Y0S A;  1YX5 A;  3OYG A;  1X4O A;  2P0W A;  3IUO A;  2V26 A;  2K9L A;  2VJ5 A;  4J01 A;  2WAD A;  4PJJ A;  3IAM 2;  3QYF A;  2VQG A;  4C2T A;  2W82 A;  2A6T A;  1IRX A;  2WB1 A;  4P1W A;  2M3A A;  4B3X A;  4RLF A;  1DQU A;  3G2B A;  4BJ6 C;  4BGD A;  2LBF A;  3OYJ A;  2Z16 A;  3VSK A;  2HPI A;  3I9V 2;  2MAB A;  4E7I A;  5KNL A;  1DP3 A;  1Z21 A;  3SZG A;  1G8X A;  4XQF A;  1Y6I A;  3QYB A;  3ZXS A;  3CJR B;  2KP6 A;  4OAZ A;  2R4G A;  3H9J A;  4PSW A;  4XLA A;  3S3M A;  2K3P A;  1D1B A;  4BUP A;  4BDZ A;  4FET A;  3K10 A;  3HC7 A;  3RTR A;  3DU5 A;  3IAS 2;  1NG6 A;  3OIP A;  2KZV A;  3TMO A;  4IZZ A;  2L7K A;  3L2U A;  4BJT A;  4BAC A;  2QKL B;  2LC2 A;  4B47 A;  3LSH A;  4F52 A;  3L2Q A;  2VQH A;  2BVL A;  4C2U A;  2L9S A;  3EUK L;  3H5R A;  2CV2 A;  2VQL A;  2VB6 A;  2WBM A;  2VJ4 A;  3HXL A;  4E7K A;  2JUG A;  1FMV A;  3K4C A;  5FRN A;  5HOO A;  3LSM A;  4XKW A;  5FRM A;  3HOS A;  2M4G A;  3FHN A;  3C2H A;  2ZFU A;  3BCB A;  4U7B A;  3DWL E;  3VYS B;  2VL8 A;  4CUG A;  1MMD A;  2RNG A;  4XN3 A;  4E7Z A;  3MKZ A;  1S9H A;  2JVG A;  2A5W A;  3OOU A;  4NUB A;  4Y3O A;  3H35 A;  1QHG A;  3MKY B;  3OYE A;  5CPR B;  2CW8 A;  3PSI A;  2KHM A;  3OYH A;  2W7N A;  4AVZ A;  3HOT A;  4XLC A;  2XAU A;  3MD2 A;  3DPL C;  4LIT A;  3IP4 B;  3UNG C;  4CZC A;  3MMY B;  3ZGK A;  2AQE A;  3LFU A;  3K4K A;  1UG0 A;  4E6K G;  4BQN A;  4JQF A;  1X4P A;  1D1A A;  1YX3 A;  3VSL A;  3S3N A;  4C30 A;  4F91 B;  2X1C A;  2V9K A;  3M8J A;  3PUB A;  3PL8 A;  1WFX A;  2K5C A;  2UV1 A;  4II2 A;  4YRV A;  1D1C A;  4BL0 B;  4FAS D;  3OYD A;  2X6Y A;  4XON A;  4BE2 A;  4MLO A;  1OR7 C;  2W1O A;  3FDY A;  2ZXI A;  1PJR A;  4IQ4 A;  3KX2 A;  1X1B A;  3QOE A;  3OYI A;  2KDO A;  3HPH A;  4H4K C;  3K4J A;  1X1C A;  2IS6 A;  2R7V A;  4XL9 A;  2V4J C;  4LG3 A;  2LBF B;  4YEL A;  4Y33 A;  2E1M C;  1ERD A;  2O5R A;  2WAE A;  4J00 A;  3OYA A;  2HVR A;  2OUM A;  3A4C A;  1BOB A;  3ONQ A;  2F4I A;  3H9G A;  1V5G A;  3V42 A;  3OL3 A;  4PJM A;  3OY9 A;  2IGM A;  4RM2 A;  2IS2 A;  1X1D A;  4XOP A;  2X6X A;  4LIV A;  3BC8 A;  2BW3 B;  4BS9 A;  3DEE A;  2Q2E B;  3OYM A;  2IS4 A;  4XMY A;  4CCL A;  2F5V A;  2VJI A;  1MMA A;  2X1D A;  2LH9 A;  4XLE A;  2BVM A;  2CS3 A;  4YEJ A;  1D0Z A;  3K4L A;  3HG9 A;  4RMN A;  2XF7 A;  4KIT B;  3ZRG A;  4P5O A;  4CH7 A;  4ANJ A;  4DOZ A;  3CZ6 A;  1BR1 A;  4IX7 A;  3SDB A;  4PFO A;  4N4N B;  4AYB A;  2NOJ B;  4G6T B;  4B44 A;  4BJ5 C;  1Z3Y A;  2PJR B;  1WJE A;  3D5L A;  4KJZ A;  3SYT A;  2CV1 A;  3L2R A;  2KMU A;  2ELJ A;  4U87 A;  4DIQ A;  5JHF A;  2VQC A;  2CMP A;  2E1M B;  1YE9 A;  2VXZ A;  2HDW A;  1WJB A;  4E7L A;  3E0J B;  4F92 B;  3HL2 A;  3W2V A;  2BOL A;  1WJD A;  2F6C A;  2LG4 A;  5LD2 C;  3PJR A;  3BLY A;  4PFP A;  3OR2 C;  1T95 A;  1VZ0 A;  1MW7 A;  2MD0 A;  4X0G A;  3TBI A;  4HG2 A;  2E5Z A;  3OMY A;  2MFZ A;  4IKF A;  3PSF A;  3OS0 A;  3HUG B;  1DGW Y;  4XLF A;  2VPL A;  3EPZ A;  1LKX A;  4HEA 2;  3BCA A;  4XLH A;  3CP2 A;  2E5N A;  4E7S A;  2BW3 A;  4BQO A;  2KPM A;  1V5F A;  3DTI A;  4QPQ A;  2MC4 A;  1BR2 A;  3MKW B;  1MMG A;  3AFH A;  4F93 B;  2VLA A;  4PJL A;  3H5A A;  4IQJ A;  1UEL B;  2RQQ A;  4E4H A;  2QKM B;  2XSJ C;  3LMM A;  1TT0 A;  3C2G A;  2L9N A;  2KRC A;  4F55 A;  3A2K A;  4ZTF A;  1WJ5 A;  5FRO A;  3I3L A;  4HRI A;  3QOD A;  4E7H A;  1D0Y A;  3CP8 A;  1W36 D;  4C9Y A;  3OYC A;  4BEH A;  3EUA A;  4D1Q A;  1J09 A;  4HPQ A;  3W2A A;  4RLQ A;  4BEH B;  2LY1 A;  4AU7 A;  3CES A;  3BG6 A;  1HA8 A;  5HNF A;  2M0M A;  4ZDO A;  3PFY A;  3OYF A;  3OYN A;  2KQR A;  4OWR B;  4ZYA A;  4HST A;  2IGK A;  3VDX A;  3K70 D;  2WY8 Q;  2XF6 A;  2CH0 A;  2HVQ A;  4CSW A;  2VJJ A;  5HVQ C;  4PJN A;  4BE1 A;  3HKZ A;  3S8P A;  2UUZ A;  2R7W A;  2WAF A;  4BU2 A;  2XDV A;  4CCO A;  2Q1Z B;  3AKZ A;  4N4O B;  2R7X A;  4DBR A;  2AQF A;  3L2W A;  2IS1 A;  1KON A;  3PNY A;  3K6G A;  3LSK A;  2I8D A;  2R7Q A;  2W4S A;  3M1C A;  1BR4 A;  2DOA A;  2VIX A;  3OIQ A;  1TZL A;  3DLA A;  2MYS A;  3ZQQ A;  1QU3 A;  4QPO A;  2M7B A;  2HU9 A;  2X85 A;  4DJA A;  3CF2 A;  3NWS A;  2PJR A;  3KEY A;  3PNT A;  2IGN A;  2RRE A;  2WA0 A;  3W2W A;  3DTE A;  3VWB A;  3H5N A;  2K9M A;  2Z1D A;  4F3Q A;  5TGT A;  2R7T A;  1PYV A;  1K6Y A;  2DCE A;  1T0F C;  2HPM A;  2XC7 A;  1MND A;  3SEZ A;  4DGW B;  2X6W A;  5CQE A;  4ZTJ A;  3ZR8 X;  1X19 A;  4XM3 A;  1E0E A;  2V1N A;  2L5Q A;  1SAU A;  2LY2 A;  3SEQ A;  3L2V A;  4B48 A;  1N78 A;  2OC6 A;  2V6E A;  4OAY A;  4ZDL A;  3S32 A;  3GBG A;  4PUS A;  4B43 A;  3RQ4 A;  4KT6 A;  1U0J A;  3HPG A;  3OL4 A;  2VXD A;  4PSX A;  1MNE A;  1N77 A;  2DJI A;  2FUG 2;  4ITV A;  2LRD A;  4NC7 A;  4EAT A;  4D9J A;  4ZJZ A;  3K4B A;  3OYK A;  3LL7 A;  4XNF A;  2CW7 A;  2VKD A;  1UAA A;  3FBI B;  1D0X A;  2JSP A;  1LVK A;  3D5S C;  4XOR A;  3N05 A;  2CUZ A;  2L2O A;  3K70 C;  1NG7 A;  3A1Y A;  2CV0 A;  2OV7 A;  2XF5 A;  2VAS A;  3D5R C;  3TL4 X;  1WJF A;  4II3 A;  5KHD A;  3DTK A;  1WJA A;  1WJC A;  2LRE A;  2DXI A;  3J7A Y;  2X1E A;  2ZXH A;  3F9K A;  3KYL A;  3OS1 A;  3H0D A;  3UR3 C;  3S3O A;  1W36 C;  2HVS A;  3DKY A;  1LDK B;  4CCN A;  3CMM A;  2M4K A;  1V5E A;  1AA7 A;  4GRI A;  3LSG A;  2ZSH B;  3PNV A;  1G59 A;  3AL0 C;  3AL0 B;  3NWT A;  2DT6 A;  3K4M A;  1P9Q C;  4BQQ A;  2R7O A;  2X51 A;  2IGO A;  1X1A A;  3QYE A;  3E1S A;  3VYT B;  1OLT A;  1FMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...